METHODS IN ENZYMOLOGY Editors-in-Chief
JOHN N. ABELSON AND MELVIN I. SIMON Division of Biology California Institute of ...
24 downloads
1350 Views
16MB Size
Report
This content was uploaded by our users and we assume good faith they have the permission to share this book. If you own the copyright to this book and it is wrongfully on our website, we offer a simple DMCA procedure to remove your content from our site. Start by pressing the button below!
Report copyright / DMCA form
METHODS IN ENZYMOLOGY Editors-in-Chief
JOHN N. ABELSON AND MELVIN I. SIMON Division of Biology California Institute of Technology Pasadena, California Founding Editors
SIDNEY P. COLOWICK AND NATHAN O. KAPLAN
Academic Press is an imprint of Elsevier 525 B Street, Suite 1900, San Diego, CA 92101-4495, USA 225 Wyman Street, Waltham, MA 02451, USA 32 Jamestown Road, London NW1 7BY, UK First edition 2011 Copyright # 2011, Elsevier Inc. All Rights Reserved. No part of this publication may be reproduced, stored in a retrieval system or transmitted in any form or by any means electronic, mechanical, photocopying, recording or otherwise without the prior written permission of the publisher Permissions may be sought directly from Elsevier’s Science & Technology Rights Department in Oxford, UK: phone (+44) (0) 1865 843830; fax (+44) (0) 1865 853333; email: permissions@ elsevier.com. Alternatively you can submit your request online by visiting the Elsevier web site at http://elsevier.com/locate/permissions, and selecting Obtaining permission to use Elsevier material Notice No responsibility is assumed by the publisher for any injury and/or damage to persons or property as a matter of products liability, negligence or otherwise, or from any use or operation of any methods, products, instructions or ideas contained in the material herein. Because of rapid advances in the medical sciences, in particular, independent verification of diagnoses and drug dosages should be made For information on all Academic Press publications visit our website at elsevierdirect.com ISBN: 978-0-12-386489-5 ISSN: 0076-6879 Printed and bound in United States of America 11 12 13 14 10 9 8 7 6 5 4 3 2 1
CONTRIBUTORS
Rita Bartossek Centre for Geobiology, Department of Biology, University of Bergen, Bergen, Norway Nicholas Beckloff Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Micol Bellucci School of Civil Engineering and Geosciences, Newcastle University, Newcastle upon Tyne, United Kingdom Peter J. Bottomley Department of Crop and Soil Science, and Department of Microbiology, Oregon State University, Corvallis, Oregon, USA N. J. Bouskill Department of Geosciences, Princeton University, Princeton, New Jersey, USA Martin E. Brummell Department of Soil Science, University of Saskatchewan, Saskatoon, Saskatchewan, Canada Emily O. Burton Department of Soil Science, University of Wisconsin-Madison, Madison, Wisconsin, USA Mark Campbell Department of Biology, University of Louisville, Louisville, Kentucky, USA Huiluo Cao School of Biological Sciences, The University of Hong Kong, Pokfulam Road, Hong Kong SAR, PR China Patrick S. G. Chain Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA
xiii
xiv
Contributors
Thomas P. Curtis School of Civil Engineering and Geosciences, Newcastle University, Newcastle upon Tyne, United Kingdom Holger Daims Department of Microbial Ecology, Ecology Center, University of Vienna, Vienna, Austria Hajnalka E. Daligault Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Hongyue Dang State Key Laboratory of Heavy Oil Processing and Centre for Bioengineering and Biotechnology, China University of Petroleum (East China), Qingdao, PR China Karen W. Davenport Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA M. J. Dempsey Division of Biology and Conservation Ecology School of Science and the Environment, Faculty of Science and Engineering, Manchester Metropolitan University, and Advanced Bioprocess Development Ltd., c/o MMU, Manchester, UK J. Chris Detter Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Oliver Einsle Lehrstuhl fu¨r Biochemie, Institut fu¨r organische Chemie und Biochemie, Albert-Ludwigs-Universita¨t Freiburg, Freiburg, Germany Tracey A. K. Freitas Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Cheryl D. Gleasner Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA James E. Graham Department of Biology, and Department of Microbiology and Immunology, University of Louisville, Louisville, Kentucky, USA
xv
Contributors
Lance D. Green Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Ji-Dong Gu School of Biological Sciences, The University of Hong Kong, Pokfulam Road, Hong Kong SAR, PR China Cliff S. Han Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA William J. Hickey Department of Soil Science, and Molecular and Environmental Toxicology Program, University of Wisconsin-Madison, Madison, Wisconsin, USA Tomonori Kindaichi Graduate School of Engineering, Higashihiroshima, Japan
Hiroshima
University,
Kagamiyama,
Martin G. Klotz Department of Biology, and Department of Microbiology and Immunology, University of Louisville, Louisville, Kentucky, USA Dorien M. Kool Department of Soil Quality, Wageningen University and Research Centre, Wageningen, The Netherlands Ellen G. Lauchnor School of Chemical, Biological and Environmental Engineering, Oregon State University, Corvallis, Oregon, USA Thomas J. Lawton Departments of Molecular Biosciences and of Chemistry, Northwestern University, Evanston, Illinois, USA Meng Li School of Biological Sciences, The University of Hong Kong, Pokfulam Road, Hong Kong SAR, PR China Chien-Chi Lo Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Willm Martens-Habbena Department of Civil and Environmental Engineering, University of Washington, Seattle, Washington, USA
xvi
Contributors
Kim K. McMurry Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Linda J. Meincke Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA David D. Myrold Department of Crop and Soil Science, Oregon State University, Corvallis, Oregon, USA Graeme W. Nicol Institute of Biological and Environmental Sciences, University of Aberdeen, Aberdeen, United Kingdom Satoshi Okabe Division of Environmental Engineering, Graduate School of Engineering, Hokkaido University, Sapporo, Hokkaido, Japan Jennifer Pett-Ridge Chemical Sciences Division, Lawrence Livermore National Laboratory, California, USA James I. Prosser Institute of Biological and Environmental Sciences, University of Aberdeen, Aberdeen, United Kingdom Tyler S. Radniecki School of Chemical, Biological and Environmental Engineering, Oregon State University, Corvallis, Oregon, USA Laila J. Reigstad Centre for Geobiology, Department of Biology, University of Bergen, Bergen, Norway Krista G. Reitenga Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Amy C. Rosenzweig Departments of Molecular Biosciences and of Chemistry, Northwestern University, Evanston, Illinois, USA Hisashi Satoh Division of Environmental Engineering, Graduate School of Engineering, Hokkaido University, Sapporo, Hokkaido, Japan
Contributors
xvii
Christa Schleper Centre for Geobiology, Department of Biology, University of Bergen, Bergen, Norway, and Vienna Ecology Centre, Department of Genetics in Ecology, University of Vienna, Vienna, Austria Matthew B. Scholz Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Xiaohong Shen Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Steven D. Siciliano Department of Soil Science, University of Saskatchewan, Saskatoon, Saskatchewan, Canada Bongkeun Song Department of Biology and Marine Biology, University of North Carolina Wilmington, North Carolina, USA David A. Stahl Department of Civil and Environmental Engineering, University of Washington, Seattle, Washington, USA Shawn R. Starkenburg Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Craig R. Tobias Department of Marine Sciences, University of Connecticut, Groton, Connecticut, USA Jan Willem Van Groenigen Department of Soil Quality, Wageningen University and Research Centre, Wageningen, The Netherlands Michael Wagner Department of Microbial Ecology, Ecology Center, University of Vienna, Vienna, Austria Nicholas B. Wantland Department of Microbiology and Immunology, University of Louisville, Louisville, Kentucky, USA
xviii
Contributors
B. B. Ward Department of Geosciences, Princeton University, Princeton, New Jersey, USA, and Earth Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California, USA Nicole Wrage Institute of Grassland Science, University of Go¨ttingen, Go¨ttingen, Germany Gary Xie Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Ahmet Zeytun Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, and Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA
PREFACE
For well over 100 years, humans have learned how to alter the biogeochemistry of the Earth toward our own benefit. Nowhere is this trend clearer than in the nitrogen cycle where humans are now responsible for greater than 50% of the reactive-N (nitrogen) input to the biosphere, mostly in the form of chemically produced ammonium-based fertilizer for agricultural production. Humans have also harnessed the power of the N cycle to clean wastewater in more efficient ways and are using N-cycle microorganisms and their enzymes to monitor toxicity and contribute to pollutant remediation in a variety of industrial processes and ecosystems. Research on the transformation of reactive N in an environmental context has lagged behind similar research in the biomedical field. Until recently, this stagnation was largely due to missing instrumentation, tools, and molecular methods to describe and discriminate among the organisms and enzymes involved in transforming reactive N within a vast diversity of habitats. Due to several important breakthroughs over the past decade, the momentum has shifted and serious gains have been made in our understanding of how to measure and monitor reactive N transformations in nature. Through the application of improved methodologies and molecular tools, new groups of organisms including the anerobic ammonia-oxidizing bacteria (anammox Process: 1999; molecular verification: 2006) and the ammonia-oxidizing Thaumarchaea have been added to the growing list of microorganisms that carry out important, and perhaps ancient (anammox) to very recent (ammonia-oxidizing Thaumarchaea), steps in the conversion of reactive N. In large part, our discovery and understanding of environmentally relevant N-cycle organisms has accelerated due to a convergence with high-throughput genome sequencing and proteomics technologies. We now have an ever-increasing number of complete genome sequences to apply postgenomic tools for transcriptomic and proteomic analysis and were early adopters of metagenomics tools to better describe enriched or uncultivated microorganisms. The idea for developing a volume on “Research on Nitrification and Related Processes” came after a productive international meeting on the Nitrogen Cycle organized by the Agouron Institute in Scottsdale, Arizona, in October 2009 (http://agi.org/pdf/nmtg-abstracts/NMtgAbstractsforWeb. pdf), where we presented work on N-cycle evolution and the function of aerobic ammonia-oxidizing microorganisms. The Agouron Nitrogen meeting succeeded another significant event in the N-cycle community: the first xix
xx
Preface
International Conference on Nitrification (ICoN1) organized by the Nitrification Network (http://nitrificationnetwork.org/news%20and%20events. php#icon1) in Louisville, Kentucky, July 2009. We are now swiftly approaching the second meeting, ICoN2, which will be held in Nijmegen, the Netherlands, July 3–7, 2011. Both ICoN1 and ICoN2 were made possible by support from the U.S. National Science Foundation and the Gordon and Betty Moore Foundation. In addition, the University of Louisville supported ICoN1. Because of these international gatherings, we have become better informed as a community about the existing wealth of new approaches to gather and analyze data in N-cycle research, which led Martin to take on guest editorship for these two volumes 486 (Part A) and 496 (Part B) of Methods in Enzymology and Lisa to join as a guest editor of Part B to round out coverage on research areas on reactive N in environmental and application-based contexts. The chapters span the range of organisms and environments from basic to highly applied research areas. We believe that the readership will greatly benefit from both parts of this series, whether new or old to the field, as these chapters represent state-of-the-art techniques developed specifically to study reactive N transformations. These two parts would not have been possible without the generous sharing and enthusiasm of so many colleagues and friends inside and outside the Nitrification Network. We thank them all, and also Delsy Retchagar and Sujatha Thirugnanasambandam (Elsevier, Chennai, India) and Zoe Kruze (Elsevier, Oxford, UK), for their help and advice in steering both parts to a successful and timely outcome. We also gratefully acknowledge the external reviewers of chapters in volumes 486 and 496 for sharing their valuable time and skill to refine the words and ideas of the authors: Margarida Archer, Sharon Avrahami, Elizabeth Baggs, Do¨rte Becher, Dirk de Beer, J. Michael Beman, Anne Bernhard, Victoria Bertics, Annette Bollmann, Peter J. Bottomley, Karen L. Casciotti, Kartik Chandran, Ludmila Chistoserdova, Nabin Chowdhury, Hongyue Dang, Alan A. DiSpirito, Christopher A. Francis, Michael Y. Galperin, Peter R. Girguis, Ramesh Goel, Steven Hallam, Stephen C. Hart, Zhili He, James Hemp, Gerhard Herndl, Richard Higashi, Moritz Holtappels, Christopher K. Junium, Marlies Kampschreur, Boran Kartal, Jan Keltjens, Martin Ko¨nneke, Martin G. Klotz, Jessica Kozlowski, Gaute Lavik, Thomas Lawton, Ines Mandic-Mulec, Veronica Molina, J. Colin Murrell, Graeme Nicol, Jeanette M. Norton, Victoria J. Orphan, Andrew Pacheco, Ines Pereira, Tyler Radniecki, Andreas Schramm, Holly M. Simon, Markus Schmid, Martin Schmidt, Steven Siciliano, Bongkeun Song, David A. Stahl, Lisa Y. Stein, Marc Strous, Yuichi Suwa, Anne Taylor, Tamara Tikhonova, Hidetoshi Urakawa, Ste´phane Vuilleumier, Bess B. Ward, Chuanlun Zhang, and Xiang Zhang. LISA YAEL STEIN AND MARTIN GU¨NTER KLOTZ
METHODS IN ENZYMOLOGY
VOLUME I. Preparation and Assay of Enzymes Edited by SIDNEY P. COLOWICK AND NATHAN O. KAPLAN VOLUME II. Preparation and Assay of Enzymes Edited by SIDNEY P. COLOWICK AND NATHAN O. KAPLAN VOLUME III. Preparation and Assay of Substrates Edited by SIDNEY P. COLOWICK AND NATHAN O. KAPLAN VOLUME IV. Special Techniques for the Enzymologist Edited by SIDNEY P. COLOWICK AND NATHAN O. KAPLAN VOLUME V. Preparation and Assay of Enzymes Edited by SIDNEY P. COLOWICK AND NATHAN O. KAPLAN VOLUME VI. Preparation and Assay of Enzymes (Continued) Preparation and Assay of Substrates Special Techniques Edited by SIDNEY P. COLOWICK AND NATHAN O. KAPLAN VOLUME VII. Cumulative Subject Index Edited by SIDNEY P. COLOWICK AND NATHAN O. KAPLAN VOLUME VIII. Complex Carbohydrates Edited by ELIZABETH F. NEUFELD AND VICTOR GINSBURG VOLUME IX. Carbohydrate Metabolism Edited by WILLIS A. WOOD VOLUME X. Oxidation and Phosphorylation Edited by RONALD W. ESTABROOK AND MAYNARD E. PULLMAN VOLUME XI. Enzyme Structure Edited by C. H. W. HIRS VOLUME XII. Nucleic Acids (Parts A and B) Edited by LAWRENCE GROSSMAN AND KIVIE MOLDAVE VOLUME XIII. Citric Acid Cycle Edited by J. M. LOWENSTEIN VOLUME XIV. Lipids Edited by J. M. LOWENSTEIN VOLUME XV. Steroids and Terpenoids Edited by RAYMOND B. CLAYTON xxi
xxii
Methods in Enzymology
VOLUME XVI. Fast Reactions Edited by KENNETH KUSTIN VOLUME XVII. Metabolism of Amino Acids and Amines (Parts A and B) Edited by HERBERT TABOR AND CELIA WHITE TABOR VOLUME XVIII. Vitamins and Coenzymes (Parts A, B, and C) Edited by DONALD B. MCCORMICK AND LEMUEL D. WRIGHT VOLUME XIX. Proteolytic Enzymes Edited by GERTRUDE E. PERLMANN AND LASZLO LORAND VOLUME XX. Nucleic Acids and Protein Synthesis (Part C) Edited by KIVIE MOLDAVE AND LAWRENCE GROSSMAN VOLUME XXI. Nucleic Acids (Part D) Edited by LAWRENCE GROSSMAN AND KIVIE MOLDAVE VOLUME XXII. Enzyme Purification and Related Techniques Edited by WILLIAM B. JAKOBY VOLUME XXIII. Photosynthesis (Part A) Edited by ANTHONY SAN PIETRO VOLUME XXIV. Photosynthesis and Nitrogen Fixation (Part B) Edited by ANTHONY SAN PIETRO VOLUME XXV. Enzyme Structure (Part B) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME XXVI. Enzyme Structure (Part C) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME XXVII. Enzyme Structure (Part D) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME XXVIII. Complex Carbohydrates (Part B) Edited by VICTOR GINSBURG VOLUME XXIX. Nucleic Acids and Protein Synthesis (Part E) Edited by LAWRENCE GROSSMAN AND KIVIE MOLDAVE VOLUME XXX. Nucleic Acids and Protein Synthesis (Part F) Edited by KIVIE MOLDAVE AND LAWRENCE GROSSMAN VOLUME XXXI. Biomembranes (Part A) Edited by SIDNEY FLEISCHER AND LESTER PACKER VOLUME XXXII. Biomembranes (Part B) Edited by SIDNEY FLEISCHER AND LESTER PACKER VOLUME XXXIII. Cumulative Subject Index Volumes I-XXX Edited by MARTHA G. DENNIS AND EDWARD A. DENNIS VOLUME XXXIV. Affinity Techniques (Enzyme Purification: Part B) Edited by WILLIAM B. JAKOBY AND MEIR WILCHEK
Methods in Enzymology
VOLUME XXXV. Lipids (Part B) Edited by JOHN M. LOWENSTEIN VOLUME XXXVI. Hormone Action (Part A: Steroid Hormones) Edited by BERT W. O’MALLEY AND JOEL G. HARDMAN VOLUME XXXVII. Hormone Action (Part B: Peptide Hormones) Edited by BERT W. O’MALLEY AND JOEL G. HARDMAN VOLUME XXXVIII. Hormone Action (Part C: Cyclic Nucleotides) Edited by JOEL G. HARDMAN AND BERT W. O’MALLEY VOLUME XXXIX. Hormone Action (Part D: Isolated Cells, Tissues, and Organ Systems) Edited by JOEL G. HARDMAN AND BERT W. O’MALLEY VOLUME XL. Hormone Action (Part E: Nuclear Structure and Function) Edited by BERT W. O’MALLEY AND JOEL G. HARDMAN VOLUME XLI. Carbohydrate Metabolism (Part B) Edited by W. A. WOOD VOLUME XLII. Carbohydrate Metabolism (Part C) Edited by W. A. WOOD VOLUME XLIII. Antibiotics Edited by JOHN H. HASH VOLUME XLIV. Immobilized Enzymes Edited by KLAUS MOSBACH VOLUME XLV. Proteolytic Enzymes (Part B) Edited by LASZLO LORAND VOLUME XLVI. Affinity Labeling Edited by WILLIAM B. JAKOBY AND MEIR WILCHEK VOLUME XLVII. Enzyme Structure (Part E) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME XLVIII. Enzyme Structure (Part F) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME XLIX. Enzyme Structure (Part G) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME L. Complex Carbohydrates (Part C) Edited by VICTOR GINSBURG VOLUME LI. Purine and Pyrimidine Nucleotide Metabolism Edited by PATRICIA A. HOFFEE AND MARY ELLEN JONES VOLUME LII. Biomembranes (Part C: Biological Oxidations) Edited by SIDNEY FLEISCHER AND LESTER PACKER
xxiii
xxiv
Methods in Enzymology
VOLUME LIII. Biomembranes (Part D: Biological Oxidations) Edited by SIDNEY FLEISCHER AND LESTER PACKER VOLUME LIV. Biomembranes (Part E: Biological Oxidations) Edited by SIDNEY FLEISCHER AND LESTER PACKER VOLUME LV. Biomembranes (Part F: Bioenergetics) Edited by SIDNEY FLEISCHER AND LESTER PACKER VOLUME LVI. Biomembranes (Part G: Bioenergetics) Edited by SIDNEY FLEISCHER AND LESTER PACKER VOLUME LVII. Bioluminescence and Chemiluminescence Edited by MARLENE A. DELUCA VOLUME LVIII. Cell Culture Edited by WILLIAM B. JAKOBY AND IRA PASTAN VOLUME LIX. Nucleic Acids and Protein Synthesis (Part G) Edited by KIVIE MOLDAVE AND LAWRENCE GROSSMAN VOLUME LX. Nucleic Acids and Protein Synthesis (Part H) Edited by KIVIE MOLDAVE AND LAWRENCE GROSSMAN VOLUME 61. Enzyme Structure (Part H) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME 62. Vitamins and Coenzymes (Part D) Edited by DONALD B. MCCORMICK AND LEMUEL D. WRIGHT VOLUME 63. Enzyme Kinetics and Mechanism (Part A: Initial Rate and Inhibitor Methods) Edited by DANIEL L. PURICH VOLUME 64. Enzyme Kinetics and Mechanism (Part B: Isotopic Probes and Complex Enzyme Systems) Edited by DANIEL L. PURICH VOLUME 65. Nucleic Acids (Part I) Edited by LAWRENCE GROSSMAN AND KIVIE MOLDAVE VOLUME 66. Vitamins and Coenzymes (Part E) Edited by DONALD B. MCCORMICK AND LEMUEL D. WRIGHT VOLUME 67. Vitamins and Coenzymes (Part F) Edited by DONALD B. MCCORMICK AND LEMUEL D. WRIGHT VOLUME 68. Recombinant DNA Edited by RAY WU VOLUME 69. Photosynthesis and Nitrogen Fixation (Part C) Edited by ANTHONY SAN PIETRO VOLUME 70. Immunochemical Techniques (Part A) Edited by HELEN VAN VUNAKIS AND JOHN J. LANGONE
Methods in Enzymology
xxv
VOLUME 71. Lipids (Part C) Edited by JOHN M. LOWENSTEIN VOLUME 72. Lipids (Part D) Edited by JOHN M. LOWENSTEIN VOLUME 73. Immunochemical Techniques (Part B) Edited by JOHN J. LANGONE AND HELEN VAN VUNAKIS VOLUME 74. Immunochemical Techniques (Part C) Edited by JOHN J. LANGONE AND HELEN VAN VUNAKIS VOLUME 75. Cumulative Subject Index Volumes XXXI, XXXII, XXXIV–LX Edited by EDWARD A. DENNIS AND MARTHA G. DENNIS VOLUME 76. Hemoglobins Edited by ERALDO ANTONINI, LUIGI ROSSI-BERNARDI, AND EMILIA CHIANCONE VOLUME 77. Detoxication and Drug Metabolism Edited by WILLIAM B. JAKOBY VOLUME 78. Interferons (Part A) Edited by SIDNEY PESTKA VOLUME 79. Interferons (Part B) Edited by SIDNEY PESTKA VOLUME 80. Proteolytic Enzymes (Part C) Edited by LASZLO LORAND VOLUME 81. Biomembranes (Part H: Visual Pigments and Purple Membranes, I) Edited by LESTER PACKER VOLUME 82. Structural and Contractile Proteins (Part A: Extracellular Matrix) Edited by LEON W. CUNNINGHAM AND DIXIE W. FREDERIKSEN VOLUME 83. Complex Carbohydrates (Part D) Edited by VICTOR GINSBURG VOLUME 84. Immunochemical Techniques (Part D: Selected Immunoassays) Edited by JOHN J. LANGONE AND HELEN VAN VUNAKIS VOLUME 85. Structural and Contractile Proteins (Part B: The Contractile Apparatus and the Cytoskeleton) Edited by DIXIE W. FREDERIKSEN AND LEON W. CUNNINGHAM VOLUME 86. Prostaglandins and Arachidonate Metabolites Edited by WILLIAM E. M. LANDS AND WILLIAM L. SMITH VOLUME 87. Enzyme Kinetics and Mechanism (Part C: Intermediates, Stereo-chemistry, and Rate Studies) Edited by DANIEL L. PURICH VOLUME 88. Biomembranes (Part I: Visual Pigments and Purple Membranes, II) Edited by LESTER PACKER
xxvi
Methods in Enzymology
VOLUME 89. Carbohydrate Metabolism (Part D) Edited by WILLIS A. WOOD VOLUME 90. Carbohydrate Metabolism (Part E) Edited by WILLIS A. WOOD VOLUME 91. Enzyme Structure (Part I) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME 92. Immunochemical Techniques (Part E: Monoclonal Antibodies and General Immunoassay Methods) Edited by JOHN J. LANGONE AND HELEN VAN VUNAKIS VOLUME 93. Immunochemical Techniques (Part F: Conventional Antibodies, Fc Receptors, and Cytotoxicity) Edited by JOHN J. LANGONE AND HELEN VAN VUNAKIS VOLUME 94. Polyamines Edited by HERBERT TABOR AND CELIA WHITE TABOR VOLUME 95. Cumulative Subject Index Volumes 61–74, 76–80 Edited by EDWARD A. DENNIS AND MARTHA G. DENNIS VOLUME 96. Biomembranes [Part J: Membrane Biogenesis: Assembly and Targeting (General Methods; Eukaryotes)] Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 97. Biomembranes [Part K: Membrane Biogenesis: Assembly and Targeting (Prokaryotes, Mitochondria, and Chloroplasts)] Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 98. Biomembranes (Part L: Membrane Biogenesis: Processing and Recycling) Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 99. Hormone Action (Part F: Protein Kinases) Edited by JACKIE D. CORBIN AND JOEL G. HARDMAN VOLUME 100. Recombinant DNA (Part B) Edited by RAY WU, LAWRENCE GROSSMAN, AND KIVIE MOLDAVE VOLUME 101. Recombinant DNA (Part C) Edited by RAY WU, LAWRENCE GROSSMAN, AND KIVIE MOLDAVE VOLUME 102. Hormone Action (Part G: Calmodulin and Calcium-Binding Proteins) Edited by ANTHONY R. MEANS AND BERT W. O’MALLEY VOLUME 103. Hormone Action (Part H: Neuroendocrine Peptides) Edited by P. MICHAEL CONN VOLUME 104. Enzyme Purification and Related Techniques (Part C) Edited by WILLIAM B. JAKOBY
Methods in Enzymology
VOLUME 105. Oxygen Radicals in Biological Systems Edited by LESTER PACKER VOLUME 106. Posttranslational Modifications (Part A) Edited by FINN WOLD AND KIVIE MOLDAVE VOLUME 107. Posttranslational Modifications (Part B) Edited by FINN WOLD AND KIVIE MOLDAVE VOLUME 108. Immunochemical Techniques (Part G: Separation and Characterization of Lymphoid Cells) Edited by GIOVANNI DI SABATO, JOHN J. LANGONE, AND HELEN VAN VUNAKIS VOLUME 109. Hormone Action (Part I: Peptide Hormones) Edited by LUTZ BIRNBAUMER AND BERT W. O’MALLEY VOLUME 110. Steroids and Isoprenoids (Part A) Edited by JOHN H. LAW AND HANS C. RILLING VOLUME 111. Steroids and Isoprenoids (Part B) Edited by JOHN H. LAW AND HANS C. RILLING VOLUME 112. Drug and Enzyme Targeting (Part A) Edited by KENNETH J. WIDDER AND RALPH GREEN VOLUME 113. Glutamate, Glutamine, Glutathione, and Related Compounds Edited by ALTON MEISTER VOLUME 114. Diffraction Methods for Biological Macromolecules (Part A) Edited by HAROLD W. WYCKOFF, C. H. W. HIRS, AND SERGE N. TIMASHEFF VOLUME 115. Diffraction Methods for Biological Macromolecules (Part B) Edited by HAROLD W. WYCKOFF, C. H. W. HIRS, AND SERGE N. TIMASHEFF VOLUME 116. Immunochemical Techniques (Part H: Effectors and Mediators of Lymphoid Cell Functions) Edited by GIOVANNI DI SABATO, JOHN J. LANGONE, AND HELEN VAN VUNAKIS VOLUME 117. Enzyme Structure (Part J) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME 118. Plant Molecular Biology Edited by ARTHUR WEISSBACH AND HERBERT WEISSBACH VOLUME 119. Interferons (Part C) Edited by SIDNEY PESTKA VOLUME 120. Cumulative Subject Index Volumes 81–94, 96–101 VOLUME 121. Immunochemical Techniques (Part I: Hybridoma Technology and Monoclonal Antibodies) Edited by JOHN J. LANGONE AND HELEN VAN VUNAKIS VOLUME 122. Vitamins and Coenzymes (Part G) Edited by FRANK CHYTIL AND DONALD B. MCCORMICK
xxvii
xxviii
Methods in Enzymology
VOLUME 123. Vitamins and Coenzymes (Part H) Edited by FRANK CHYTIL AND DONALD B. MCCORMICK VOLUME 124. Hormone Action (Part J: Neuroendocrine Peptides) Edited by P. MICHAEL CONN VOLUME 125. Biomembranes (Part M: Transport in Bacteria, Mitochondria, and Chloroplasts: General Approaches and Transport Systems) Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 126. Biomembranes (Part N: Transport in Bacteria, Mitochondria, and Chloroplasts: Protonmotive Force) Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 127. Biomembranes (Part O: Protons and Water: Structure and Translocation) Edited by LESTER PACKER VOLUME 128. Plasma Lipoproteins (Part A: Preparation, Structure, and Molecular Biology) Edited by JERE P. SEGREST AND JOHN J. ALBERS VOLUME 129. Plasma Lipoproteins (Part B: Characterization, Cell Biology, and Metabolism) Edited by JOHN J. ALBERS AND JERE P. SEGREST VOLUME 130. Enzyme Structure (Part K) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME 131. Enzyme Structure (Part L) Edited by C. H. W. HIRS AND SERGE N. TIMASHEFF VOLUME 132. Immunochemical Techniques (Part J: Phagocytosis and Cell-Mediated Cytotoxicity) Edited by GIOVANNI DI SABATO AND JOHANNES EVERSE VOLUME 133. Bioluminescence and Chemiluminescence (Part B) Edited by MARLENE DELUCA AND WILLIAM D. MCELROY VOLUME 134. Structural and Contractile Proteins (Part C: The Contractile Apparatus and the Cytoskeleton) Edited by RICHARD B. VALLEE VOLUME 135. Immobilized Enzymes and Cells (Part B) Edited by KLAUS MOSBACH VOLUME 136. Immobilized Enzymes and Cells (Part C) Edited by KLAUS MOSBACH VOLUME 137. Immobilized Enzymes and Cells (Part D) Edited by KLAUS MOSBACH VOLUME 138. Complex Carbohydrates (Part E) Edited by VICTOR GINSBURG
Methods in Enzymology
xxix
VOLUME 139. Cellular Regulators (Part A: Calcium- and Calmodulin-Binding Proteins) Edited by ANTHONY R. MEANS AND P. MICHAEL CONN VOLUME 140. Cumulative Subject Index Volumes 102–119, 121–134 VOLUME 141. Cellular Regulators (Part B: Calcium and Lipids) Edited by P. MICHAEL CONN AND ANTHONY R. MEANS VOLUME 142. Metabolism of Aromatic Amino Acids and Amines Edited by SEYMOUR KAUFMAN VOLUME 143. Sulfur and Sulfur Amino Acids Edited by WILLIAM B. JAKOBY AND OWEN GRIFFITH VOLUME 144. Structural and Contractile Proteins (Part D: Extracellular Matrix) Edited by LEON W. CUNNINGHAM VOLUME 145. Structural and Contractile Proteins (Part E: Extracellular Matrix) Edited by LEON W. CUNNINGHAM VOLUME 146. Peptide Growth Factors (Part A) Edited by DAVID BARNES AND DAVID A. SIRBASKU VOLUME 147. Peptide Growth Factors (Part B) Edited by DAVID BARNES AND DAVID A. SIRBASKU VOLUME 148. Plant Cell Membranes Edited by LESTER PACKER AND ROLAND DOUCE VOLUME 149. Drug and Enzyme Targeting (Part B) Edited by RALPH GREEN AND KENNETH J. WIDDER VOLUME 150. Immunochemical Techniques (Part K: In Vitro Models of B and T Cell Functions and Lymphoid Cell Receptors) Edited by GIOVANNI DI SABATO VOLUME 151. Molecular Genetics of Mammalian Cells Edited by MICHAEL M. GOTTESMAN VOLUME 152. Guide to Molecular Cloning Techniques Edited by SHELBY L. BERGER AND ALAN R. KIMMEL VOLUME 153. Recombinant DNA (Part D) Edited by RAY WU AND LAWRENCE GROSSMAN VOLUME 154. Recombinant DNA (Part E) Edited by RAY WU AND LAWRENCE GROSSMAN VOLUME 155. Recombinant DNA (Part F) Edited by RAY WU VOLUME 156. Biomembranes (Part P: ATP-Driven Pumps and Related Transport: The Na, K-Pump) Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER
xxx
Methods in Enzymology
VOLUME 157. Biomembranes (Part Q: ATP-Driven Pumps and Related Transport: Calcium, Proton, and Potassium Pumps) Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 158. Metalloproteins (Part A) Edited by JAMES F. RIORDAN AND BERT L. VALLEE VOLUME 159. Initiation and Termination of Cyclic Nucleotide Action Edited by JACKIE D. CORBIN AND ROGER A. JOHNSON VOLUME 160. Biomass (Part A: Cellulose and Hemicellulose) Edited by WILLIS A. WOOD AND SCOTT T. KELLOGG VOLUME 161. Biomass (Part B: Lignin, Pectin, and Chitin) Edited by WILLIS A. WOOD AND SCOTT T. KELLOGG VOLUME 162. Immunochemical Techniques (Part L: Chemotaxis and Inflammation) Edited by GIOVANNI DI SABATO VOLUME 163. Immunochemical Techniques (Part M: Chemotaxis and Inflammation) Edited by GIOVANNI DI SABATO VOLUME 164. Ribosomes Edited by HARRY F. NOLLER, JR., AND KIVIE MOLDAVE VOLUME 165. Microbial Toxins: Tools for Enzymology Edited by SIDNEY HARSHMAN VOLUME 166. Branched-Chain Amino Acids Edited by ROBERT HARRIS AND JOHN R. SOKATCH VOLUME 167. Cyanobacteria Edited by LESTER PACKER AND ALEXANDER N. GLAZER VOLUME 168. Hormone Action (Part K: Neuroendocrine Peptides) Edited by P. MICHAEL CONN VOLUME 169. Platelets: Receptors, Adhesion, Secretion (Part A) Edited by JACEK HAWIGER VOLUME 170. Nucleosomes Edited by PAUL M. WASSARMAN AND ROGER D. KORNBERG VOLUME 171. Biomembranes (Part R: Transport Theory: Cells and Model Membranes) Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 172. Biomembranes (Part S: Transport: Membrane Isolation and Characterization) Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER
Methods in Enzymology
xxxi
VOLUME 173. Biomembranes [Part T: Cellular and Subcellular Transport: Eukaryotic (Nonepithelial) Cells] Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 174. Biomembranes [Part U: Cellular and Subcellular Transport: Eukaryotic (Nonepithelial) Cells] Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 175. Cumulative Subject Index Volumes 135–139, 141–167 VOLUME 176. Nuclear Magnetic Resonance (Part A: Spectral Techniques and Dynamics) Edited by NORMAN J. OPPENHEIMER AND THOMAS L. JAMES VOLUME 177. Nuclear Magnetic Resonance (Part B: Structure and Mechanism) Edited by NORMAN J. OPPENHEIMER AND THOMAS L. JAMES VOLUME 178. Antibodies, Antigens, and Molecular Mimicry Edited by JOHN J. LANGONE VOLUME 179. Complex Carbohydrates (Part F) Edited by VICTOR GINSBURG VOLUME 180. RNA Processing (Part A: General Methods) Edited by JAMES E. DAHLBERG AND JOHN N. ABELSON VOLUME 181. RNA Processing (Part B: Specific Methods) Edited by JAMES E. DAHLBERG AND JOHN N. ABELSON VOLUME 182. Guide to Protein Purification Edited by MURRAY P. DEUTSCHER VOLUME 183. Molecular Evolution: Computer Analysis of Protein and Nucleic Acid Sequences Edited by RUSSELL F. DOOLITTLE VOLUME 184. Avidin-Biotin Technology Edited by MEIR WILCHEK AND EDWARD A. BAYER VOLUME 185. Gene Expression Technology Edited by DAVID V. GOEDDEL VOLUME 186. Oxygen Radicals in Biological Systems (Part B: Oxygen Radicals and Antioxidants) Edited by LESTER PACKER AND ALEXANDER N. GLAZER VOLUME 187. Arachidonate Related Lipid Mediators Edited by ROBERT C. MURPHY AND FRANK A. FITZPATRICK VOLUME 188. Hydrocarbons and Methylotrophy Edited by MARY E. LIDSTROM VOLUME 189. Retinoids (Part A: Molecular and Metabolic Aspects) Edited by LESTER PACKER
xxxii
Methods in Enzymology
VOLUME 190. Retinoids (Part B: Cell Differentiation and Clinical Applications) Edited by LESTER PACKER VOLUME 191. Biomembranes (Part V: Cellular and Subcellular Transport: Epithelial Cells) Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 192. Biomembranes (Part W: Cellular and Subcellular Transport: Epithelial Cells) Edited by SIDNEY FLEISCHER AND BECCA FLEISCHER VOLUME 193. Mass Spectrometry Edited by JAMES A. MCCLOSKEY VOLUME 194. Guide to Yeast Genetics and Molecular Biology Edited by CHRISTINE GUTHRIE AND GERALD R. FINK VOLUME 195. Adenylyl Cyclase, G Proteins, and Guanylyl Cyclase Edited by ROGER A. JOHNSON AND JACKIE D. CORBIN VOLUME 196. Molecular Motors and the Cytoskeleton Edited by RICHARD B. VALLEE VOLUME 197. Phospholipases Edited by EDWARD A. DENNIS VOLUME 198. Peptide Growth Factors (Part C) Edited by DAVID BARNES, J. P. MATHER, AND GORDON H. SATO VOLUME 199. Cumulative Subject Index Volumes 168–174, 176–194 VOLUME 200. Protein Phosphorylation (Part A: Protein Kinases: Assays, Purification, Antibodies, Functional Analysis, Cloning, and Expression) Edited by TONY HUNTER AND BARTHOLOMEW M. SEFTON VOLUME 201. Protein Phosphorylation (Part B: Analysis of Protein Phosphorylation, Protein Kinase Inhibitors, and Protein Phosphatases) Edited by TONY HUNTER AND BARTHOLOMEW M. SEFTON VOLUME 202. Molecular Design and Modeling: Concepts and Applications (Part A: Proteins, Peptides, and Enzymes) Edited by JOHN J. LANGONE VOLUME 203. Molecular Design and Modeling: Concepts and Applications (Part B: Antibodies and Antigens, Nucleic Acids, Polysaccharides, and Drugs) Edited by JOHN J. LANGONE VOLUME 204. Bacterial Genetic Systems Edited by JEFFREY H. MILLER VOLUME 205. Metallobiochemistry (Part B: Metallothionein and Related Molecules) Edited by JAMES F. RIORDAN AND BERT L. VALLEE
Methods in Enzymology
xxxiii
VOLUME 206. Cytochrome P450 Edited by MICHAEL R. WATERMAN AND ERIC F. JOHNSON VOLUME 207. Ion Channels Edited by BERNARDO RUDY AND LINDA E. IVERSON VOLUME 208. Protein–DNA Interactions Edited by ROBERT T. SAUER VOLUME 209. Phospholipid Biosynthesis Edited by EDWARD A. DENNIS AND DENNIS E. VANCE VOLUME 210. Numerical Computer Methods Edited by LUDWIG BRAND AND MICHAEL L. JOHNSON VOLUME 211. DNA Structures (Part A: Synthesis and Physical Analysis of DNA) Edited by DAVID M. J. LILLEY AND JAMES E. DAHLBERG VOLUME 212. DNA Structures (Part B: Chemical and Electrophoretic Analysis of DNA) Edited by DAVID M. J. LILLEY AND JAMES E. DAHLBERG VOLUME 213. Carotenoids (Part A: Chemistry, Separation, Quantitation, and Antioxidation) Edited by LESTER PACKER VOLUME 214. Carotenoids (Part B: Metabolism, Genetics, and Biosynthesis) Edited by LESTER PACKER VOLUME 215. Platelets: Receptors, Adhesion, Secretion (Part B) Edited by JACEK J. HAWIGER VOLUME 216. Recombinant DNA (Part G) Edited by RAY WU VOLUME 217. Recombinant DNA (Part H) Edited by RAY WU VOLUME 218. Recombinant DNA (Part I) Edited by RAY WU VOLUME 219. Reconstitution of Intracellular Transport Edited by JAMES E. ROTHMAN VOLUME 220. Membrane Fusion Techniques (Part A) Edited by NEJAT DU¨ZGU¨NES¸ VOLUME 221. Membrane Fusion Techniques (Part B) Edited by NEJAT DU¨ZGU¨NES¸ VOLUME 222. Proteolytic Enzymes in Coagulation, Fibrinolysis, and Complement Activation (Part A: Mammalian Blood Coagulation Factors and Inhibitors) Edited by LASZLO LORAND AND KENNETH G. MANN
xxxiv
Methods in Enzymology
VOLUME 223. Proteolytic Enzymes in Coagulation, Fibrinolysis, and Complement Activation (Part B: Complement Activation, Fibrinolysis, and Nonmammalian Blood Coagulation Factors) Edited by LASZLO LORAND AND KENNETH G. MANN VOLUME 224. Molecular Evolution: Producing the Biochemical Data Edited by ELIZABETH ANNE ZIMMER, THOMAS J. WHITE, REBECCA L. CANN, AND ALLAN C. WILSON VOLUME 225. Guide to Techniques in Mouse Development Edited by PAUL M. WASSARMAN AND MELVIN L. DEPAMPHILIS VOLUME 226. Metallobiochemistry (Part C: Spectroscopic and Physical Methods for Probing Metal Ion Environments in Metalloenzymes and Metalloproteins) Edited by JAMES F. RIORDAN AND BERT L. VALLEE VOLUME 227. Metallobiochemistry (Part D: Physical and Spectroscopic Methods for Probing Metal Ion Environments in Metalloproteins) Edited by JAMES F. RIORDAN AND BERT L. VALLEE VOLUME 228. Aqueous Two-Phase Systems Edited by HARRY WALTER AND GO¨TE JOHANSSON VOLUME 229. Cumulative Subject Index Volumes 195–198, 200–227 VOLUME 230. Guide to Techniques in Glycobiology Edited by WILLIAM J. LENNARZ AND GERALD W. HART VOLUME 231. Hemoglobins (Part B: Biochemical and Analytical Methods) Edited by JOHANNES EVERSE, KIM D. VANDEGRIFF, AND ROBERT M. WINSLOW VOLUME 232. Hemoglobins (Part C: Biophysical Methods) Edited by JOHANNES EVERSE, KIM D. VANDEGRIFF, AND ROBERT M. WINSLOW VOLUME 233. Oxygen Radicals in Biological Systems (Part C) Edited by LESTER PACKER VOLUME 234. Oxygen Radicals in Biological Systems (Part D) Edited by LESTER PACKER VOLUME 235. Bacterial Pathogenesis (Part A: Identification and Regulation of Virulence Factors) Edited by VIRGINIA L. CLARK AND PATRIK M. BAVOIL VOLUME 236. Bacterial Pathogenesis (Part B: Integration of Pathogenic Bacteria with Host Cells) Edited by VIRGINIA L. CLARK AND PATRIK M. BAVOIL VOLUME 237. Heterotrimeric G Proteins Edited by RAVI IYENGAR VOLUME 238. Heterotrimeric G-Protein Effectors Edited by RAVI IYENGAR
Methods in Enzymology
xxxv
VOLUME 239. Nuclear Magnetic Resonance (Part C) Edited by THOMAS L. JAMES AND NORMAN J. OPPENHEIMER VOLUME 240. Numerical Computer Methods (Part B) Edited by MICHAEL L. JOHNSON AND LUDWIG BRAND VOLUME 241. Retroviral Proteases Edited by LAWRENCE C. KUO AND JULES A. SHAFER VOLUME 242. Neoglycoconjugates (Part A) Edited by Y. C. LEE AND REIKO T. LEE VOLUME 243. Inorganic Microbial Sulfur Metabolism Edited by HARRY D. PECK, JR., AND JEAN LEGALL VOLUME 244. Proteolytic Enzymes: Serine and Cysteine Peptidases Edited by ALAN J. BARRETT VOLUME 245. Extracellular Matrix Components Edited by E. RUOSLAHTI AND E. ENGVALL VOLUME 246. Biochemical Spectroscopy Edited by KENNETH SAUER VOLUME 247. Neoglycoconjugates (Part B: Biomedical Applications) Edited by Y. C. LEE AND REIKO T. LEE VOLUME 248. Proteolytic Enzymes: Aspartic and Metallo Peptidases Edited by ALAN J. BARRETT VOLUME 249. Enzyme Kinetics and Mechanism (Part D: Developments in Enzyme Dynamics) Edited by DANIEL L. PURICH VOLUME 250. Lipid Modifications of Proteins Edited by PATRICK J. CASEY AND JANICE E. BUSS VOLUME 251. Biothiols (Part A: Monothiols and Dithiols, Protein Thiols, and Thiyl Radicals) Edited by LESTER PACKER VOLUME 252. Biothiols (Part B: Glutathione and Thioredoxin; Thiols in Signal Transduction and Gene Regulation) Edited by LESTER PACKER VOLUME 253. Adhesion of Microbial Pathogens Edited by RON J. DOYLE AND ITZHAK OFEK VOLUME 254. Oncogene Techniques Edited by PETER K. VOGT AND INDER M. VERMA VOLUME 255. Small GTPases and Their Regulators (Part A: Ras Family) Edited by W. E. BALCH, CHANNING J. DER, AND ALAN HALL
xxxvi
Methods in Enzymology
VOLUME 256. Small GTPases and Their Regulators (Part B: Rho Family) Edited by W. E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 257. Small GTPases and Their Regulators (Part C: Proteins Involved in Transport) Edited by W. E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 258. Redox-Active Amino Acids in Biology Edited by JUDITH P. KLINMAN VOLUME 259. Energetics of Biological Macromolecules Edited by MICHAEL L. JOHNSON AND GARY K. ACKERS VOLUME 260. Mitochondrial Biogenesis and Genetics (Part A) Edited by GIUSEPPE M. ATTARDI AND ANNE CHOMYN VOLUME 261. Nuclear Magnetic Resonance and Nucleic Acids Edited by THOMAS L. JAMES VOLUME 262. DNA Replication Edited by JUDITH L. CAMPBELL VOLUME 263. Plasma Lipoproteins (Part C: Quantitation) Edited by WILLIAM A. BRADLEY, SANDRA H. GIANTURCO, AND JERE P. SEGREST VOLUME 264. Mitochondrial Biogenesis and Genetics (Part B) Edited by GIUSEPPE M. ATTARDI AND ANNE CHOMYN VOLUME 265. Cumulative Subject Index Volumes 228, 230–262 VOLUME 266. Computer Methods for Macromolecular Sequence Analysis Edited by RUSSELL F. DOOLITTLE VOLUME 267. Combinatorial Chemistry Edited by JOHN N. ABELSON VOLUME 268. Nitric Oxide (Part A: Sources and Detection of NO; NO Synthase) Edited by LESTER PACKER VOLUME 269. Nitric Oxide (Part B: Physiological and Pathological Processes) Edited by LESTER PACKER VOLUME 270. High Resolution Separation and Analysis of Biological Macromolecules (Part A: Fundamentals) Edited by BARRY L. KARGER AND WILLIAM S. HANCOCK VOLUME 271. High Resolution Separation and Analysis of Biological Macromolecules (Part B: Applications) Edited by BARRY L. KARGER AND WILLIAM S. HANCOCK VOLUME 272. Cytochrome P450 (Part B) Edited by ERIC F. JOHNSON AND MICHAEL R. WATERMAN VOLUME 273. RNA Polymerase and Associated Factors (Part A) Edited by SANKAR ADHYA
Methods in Enzymology
xxxvii
VOLUME 274. RNA Polymerase and Associated Factors (Part B) Edited by SANKAR ADHYA VOLUME 275. Viral Polymerases and Related Proteins Edited by LAWRENCE C. KUO, DAVID B. OLSEN, AND STEVEN S. CARROLL VOLUME 276. Macromolecular Crystallography (Part A) Edited by CHARLES W. CARTER, JR., AND ROBERT M. SWEET VOLUME 277. Macromolecular Crystallography (Part B) Edited by CHARLES W. CARTER, JR., AND ROBERT M. SWEET VOLUME 278. Fluorescence Spectroscopy Edited by LUDWIG BRAND AND MICHAEL L. JOHNSON VOLUME 279. Vitamins and Coenzymes (Part I) Edited by DONALD B. MCCORMICK, JOHN W. SUTTIE, AND CONRAD WAGNER VOLUME 280. Vitamins and Coenzymes (Part J) Edited by DONALD B. MCCORMICK, JOHN W. SUTTIE, AND CONRAD WAGNER VOLUME 281. Vitamins and Coenzymes (Part K) Edited by DONALD B. MCCORMICK, JOHN W. SUTTIE, AND CONRAD WAGNER VOLUME 282. Vitamins and Coenzymes (Part L) Edited by DONALD B. MCCORMICK, JOHN W. SUTTIE, AND CONRAD WAGNER VOLUME 283. Cell Cycle Control Edited by WILLIAM G. DUNPHY VOLUME 284. Lipases (Part A: Biotechnology) Edited by BYRON RUBIN AND EDWARD A. DENNIS VOLUME 285. Cumulative Subject Index Volumes 263, 264, 266–284, 286–289 VOLUME 286. Lipases (Part B: Enzyme Characterization and Utilization) Edited by BYRON RUBIN AND EDWARD A. DENNIS VOLUME 287. Chemokines Edited by RICHARD HORUK VOLUME 288. Chemokine Receptors Edited by RICHARD HORUK VOLUME 289. Solid Phase Peptide Synthesis Edited by GREGG B. FIELDS VOLUME 290. Molecular Chaperones Edited by GEORGE H. LORIMER AND THOMAS BALDWIN VOLUME 291. Caged Compounds Edited by GERARD MARRIOTT VOLUME 292. ABC Transporters: Biochemical, Cellular, and Molecular Aspects Edited by SURESH V. AMBUDKAR AND MICHAEL M. GOTTESMAN
xxxviii
Methods in Enzymology
VOLUME 293. Ion Channels (Part B) Edited by P. MICHAEL CONN VOLUME 294. Ion Channels (Part C) Edited by P. MICHAEL CONN VOLUME 295. Energetics of Biological Macromolecules (Part B) Edited by GARY K. ACKERS AND MICHAEL L. JOHNSON VOLUME 296. Neurotransmitter Transporters Edited by SUSAN G. AMARA VOLUME 297. Photosynthesis: Molecular Biology of Energy Capture Edited by LEE MCINTOSH VOLUME 298. Molecular Motors and the Cytoskeleton (Part B) Edited by RICHARD B. VALLEE VOLUME 299. Oxidants and Antioxidants (Part A) Edited by LESTER PACKER VOLUME 300. Oxidants and Antioxidants (Part B) Edited by LESTER PACKER VOLUME 301. Nitric Oxide: Biological and Antioxidant Activities (Part C) Edited by LESTER PACKER VOLUME 302. Green Fluorescent Protein Edited by P. MICHAEL CONN VOLUME 303. cDNA Preparation and Display Edited by SHERMAN M. WEISSMAN VOLUME 304. Chromatin Edited by PAUL M. WASSARMAN AND ALAN P. WOLFFE VOLUME 305. Bioluminescence and Chemiluminescence (Part C) Edited by THOMAS O. BALDWIN AND MIRIAM M. ZIEGLER VOLUME 306. Expression of Recombinant Genes in Eukaryotic Systems Edited by JOSEPH C. GLORIOSO AND MARTIN C. SCHMIDT VOLUME 307. Confocal Microscopy Edited by P. MICHAEL CONN VOLUME 308. Enzyme Kinetics and Mechanism (Part E: Energetics of Enzyme Catalysis) Edited by DANIEL L. PURICH AND VERN L. SCHRAMM VOLUME 309. Amyloid, Prions, and Other Protein Aggregates Edited by RONALD WETZEL VOLUME 310. Biofilms Edited by RON J. DOYLE
Methods in Enzymology
xxxix
VOLUME 311. Sphingolipid Metabolism and Cell Signaling (Part A) Edited by ALFRED H. MERRILL, JR., AND YUSUF A. HANNUN VOLUME 312. Sphingolipid Metabolism and Cell Signaling (Part B) Edited by ALFRED H. MERRILL, JR., AND YUSUF A. HANNUN VOLUME 313. Antisense Technology (Part A: General Methods, Methods of Delivery, and RNA Studies) Edited by M. IAN PHILLIPS VOLUME 314. Antisense Technology (Part B: Applications) Edited by M. IAN PHILLIPS VOLUME 315. Vertebrate Phototransduction and the Visual Cycle (Part A) Edited by KRZYSZTOF PALCZEWSKI VOLUME 316. Vertebrate Phototransduction and the Visual Cycle (Part B) Edited by KRZYSZTOF PALCZEWSKI VOLUME 317. RNA–Ligand Interactions (Part A: Structural Biology Methods) Edited by DANIEL W. CELANDER AND JOHN N. ABELSON VOLUME 318. RNA–Ligand Interactions (Part B: Molecular Biology Methods) Edited by DANIEL W. CELANDER AND JOHN N. ABELSON VOLUME 319. Singlet Oxygen, UV-A, and Ozone Edited by LESTER PACKER AND HELMUT SIES VOLUME 320. Cumulative Subject Index Volumes 290–319 VOLUME 321. Numerical Computer Methods (Part C) Edited by MICHAEL L. JOHNSON AND LUDWIG BRAND VOLUME 322. Apoptosis Edited by JOHN C. REED VOLUME 323. Energetics of Biological Macromolecules (Part C) Edited by MICHAEL L. JOHNSON AND GARY K. ACKERS VOLUME 324. Branched-Chain Amino Acids (Part B) Edited by ROBERT A. HARRIS AND JOHN R. SOKATCH VOLUME 325. Regulators and Effectors of Small GTPases (Part D: Rho Family) Edited by W. E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 326. Applications of Chimeric Genes and Hybrid Proteins (Part A: Gene Expression and Protein Purification) Edited by JEREMY THORNER, SCOTT D. EMR, AND JOHN N. ABELSON VOLUME 327. Applications of Chimeric Genes and Hybrid Proteins (Part B: Cell Biology and Physiology) Edited by JEREMY THORNER, SCOTT D. EMR, AND JOHN N. ABELSON
xl
Methods in Enzymology
VOLUME 328. Applications of Chimeric Genes and Hybrid Proteins (Part C: Protein–Protein Interactions and Genomics) Edited by JEREMY THORNER, SCOTT D. EMR, AND JOHN N. ABELSON VOLUME 329. Regulators and Effectors of Small GTPases (Part E: GTPases Involved in Vesicular Traffic) Edited by W. E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 330. Hyperthermophilic Enzymes (Part A) Edited by MICHAEL W. W. ADAMS AND ROBERT M. KELLY VOLUME 331. Hyperthermophilic Enzymes (Part B) Edited by MICHAEL W. W. ADAMS AND ROBERT M. KELLY VOLUME 332. Regulators and Effectors of Small GTPases (Part F: Ras Family I) Edited by W. E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 333. Regulators and Effectors of Small GTPases (Part G: Ras Family II) Edited by W. E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 334. Hyperthermophilic Enzymes (Part C) Edited by MICHAEL W. W. ADAMS AND ROBERT M. KELLY VOLUME 335. Flavonoids and Other Polyphenols Edited by LESTER PACKER VOLUME 336. Microbial Growth in Biofilms (Part A: Developmental and Molecular Biological Aspects) Edited by RON J. DOYLE VOLUME 337. Microbial Growth in Biofilms (Part B: Special Environments and Physicochemical Aspects) Edited by RON J. DOYLE VOLUME 338. Nuclear Magnetic Resonance of Biological Macromolecules (Part A) Edited by THOMAS L. JAMES, VOLKER DO¨TSCH, AND ULI SCHMITZ VOLUME 339. Nuclear Magnetic Resonance of Biological Macromolecules (Part B) Edited by THOMAS L. JAMES, VOLKER DO¨TSCH, AND ULI SCHMITZ VOLUME 340. Drug–Nucleic Acid Interactions Edited by JONATHAN B. CHAIRES AND MICHAEL J. WARING VOLUME 341. Ribonucleases (Part A) Edited by ALLEN W. NICHOLSON VOLUME 342. Ribonucleases (Part B) Edited by ALLEN W. NICHOLSON VOLUME 343. G Protein Pathways (Part A: Receptors) Edited by RAVI IYENGAR AND JOHN D. HILDEBRANDT VOLUME 344. G Protein Pathways (Part B: G Proteins and Their Regulators) Edited by RAVI IYENGAR AND JOHN D. HILDEBRANDT
Methods in Enzymology
xli
VOLUME 345. G Protein Pathways (Part C: Effector Mechanisms) Edited by RAVI IYENGAR AND JOHN D. HILDEBRANDT VOLUME 346. Gene Therapy Methods Edited by M. IAN PHILLIPS VOLUME 347. Protein Sensors and Reactive Oxygen Species (Part A: Selenoproteins and Thioredoxin) Edited by HELMUT SIES AND LESTER PACKER VOLUME 348. Protein Sensors and Reactive Oxygen Species (Part B: Thiol Enzymes and Proteins) Edited by HELMUT SIES AND LESTER PACKER VOLUME 349. Superoxide Dismutase Edited by LESTER PACKER VOLUME 350. Guide to Yeast Genetics and Molecular and Cell Biology (Part B) Edited by CHRISTINE GUTHRIE AND GERALD R. FINK VOLUME 351. Guide to Yeast Genetics and Molecular and Cell Biology (Part C) Edited by CHRISTINE GUTHRIE AND GERALD R. FINK VOLUME 352. Redox Cell Biology and Genetics (Part A) Edited by CHANDAN K. SEN AND LESTER PACKER VOLUME 353. Redox Cell Biology and Genetics (Part B) Edited by CHANDAN K. SEN AND LESTER PACKER VOLUME 354. Enzyme Kinetics and Mechanisms (Part F: Detection and Characterization of Enzyme Reaction Intermediates) Edited by DANIEL L. PURICH VOLUME 355. Cumulative Subject Index Volumes 321–354 VOLUME 356. Laser Capture Microscopy and Microdissection Edited by P. MICHAEL CONN VOLUME 357. Cytochrome P450, Part C Edited by ERIC F. JOHNSON AND MICHAEL R. WATERMAN VOLUME 358. Bacterial Pathogenesis (Part C: Identification, Regulation, and Function of Virulence Factors) Edited by VIRGINIA L. CLARK AND PATRIK M. BAVOIL VOLUME 359. Nitric Oxide (Part D) Edited by ENRIQUE CADENAS AND LESTER PACKER VOLUME 360. Biophotonics (Part A) Edited by GERARD MARRIOTT AND IAN PARKER VOLUME 361. Biophotonics (Part B) Edited by GERARD MARRIOTT AND IAN PARKER
xlii
Methods in Enzymology
VOLUME 362. Recognition of Carbohydrates in Biological Systems (Part A) Edited by YUAN C. LEE AND REIKO T. LEE VOLUME 363. Recognition of Carbohydrates in Biological Systems (Part B) Edited by YUAN C. LEE AND REIKO T. LEE VOLUME 364. Nuclear Receptors Edited by DAVID W. RUSSELL AND DAVID J. MANGELSDORF VOLUME 365. Differentiation of Embryonic Stem Cells Edited by PAUL M. WASSAUMAN AND GORDON M. KELLER VOLUME 366. Protein Phosphatases Edited by SUSANNE KLUMPP AND JOSEF KRIEGLSTEIN VOLUME 367. Liposomes (Part A) Edited by NEJAT DU¨ZGU¨NES¸ VOLUME 368. Macromolecular Crystallography (Part C) Edited by CHARLES W. CARTER, JR., AND ROBERT M. SWEET VOLUME 369. Combinational Chemistry (Part B) Edited by GUILLERMO A. MORALES AND BARRY A. BUNIN VOLUME 370. RNA Polymerases and Associated Factors (Part C) Edited by SANKAR L. ADHYA AND SUSAN GARGES VOLUME 371. RNA Polymerases and Associated Factors (Part D) Edited by SANKAR L. ADHYA AND SUSAN GARGES VOLUME 372. Liposomes (Part B) Edited by NEJAT DU¨ZGU¨NES¸ VOLUME 373. Liposomes (Part C) Edited by NEJAT DU¨ZGU¨NES¸ VOLUME 374. Macromolecular Crystallography (Part D) Edited by CHARLES W. CARTER, JR., AND ROBERT W. SWEET VOLUME 375. Chromatin and Chromatin Remodeling Enzymes (Part A) Edited by C. DAVID ALLIS AND CARL WU VOLUME 376. Chromatin and Chromatin Remodeling Enzymes (Part B) Edited by C. DAVID ALLIS AND CARL WU VOLUME 377. Chromatin and Chromatin Remodeling Enzymes (Part C) Edited by C. DAVID ALLIS AND CARL WU VOLUME 378. Quinones and Quinone Enzymes (Part A) Edited by HELMUT SIES AND LESTER PACKER VOLUME 379. Energetics of Biological Macromolecules (Part D) Edited by JO M. HOLT, MICHAEL L. JOHNSON, AND GARY K. ACKERS VOLUME 380. Energetics of Biological Macromolecules (Part E) Edited by JO M. HOLT, MICHAEL L. JOHNSON, AND GARY K. ACKERS
Methods in Enzymology
VOLUME 381. Oxygen Sensing Edited by CHANDAN K. SEN AND GREGG L. SEMENZA VOLUME 382. Quinones and Quinone Enzymes (Part B) Edited by HELMUT SIES AND LESTER PACKER VOLUME 383. Numerical Computer Methods (Part D) Edited by LUDWIG BRAND AND MICHAEL L. JOHNSON VOLUME 384. Numerical Computer Methods (Part E) Edited by LUDWIG BRAND AND MICHAEL L. JOHNSON VOLUME 385. Imaging in Biological Research (Part A) Edited by P. MICHAEL CONN VOLUME 386. Imaging in Biological Research (Part B) Edited by P. MICHAEL CONN VOLUME 387. Liposomes (Part D) Edited by NEJAT DU¨ZGU¨NES¸ VOLUME 388. Protein Engineering Edited by DAN E. ROBERTSON AND JOSEPH P. NOEL VOLUME 389. Regulators of G-Protein Signaling (Part A) Edited by DAVID P. SIDEROVSKI VOLUME 390. Regulators of G-Protein Signaling (Part B) Edited by DAVID P. SIDEROVSKI VOLUME 391. Liposomes (Part E) Edited by NEJAT DU¨ZGU¨NES¸ VOLUME 392. RNA Interference Edited by ENGELKE ROSSI VOLUME 393. Circadian Rhythms Edited by MICHAEL W. YOUNG VOLUME 394. Nuclear Magnetic Resonance of Biological Macromolecules (Part C) Edited by THOMAS L. JAMES VOLUME 395. Producing the Biochemical Data (Part B) Edited by ELIZABETH A. ZIMMER AND ERIC H. ROALSON VOLUME 396. Nitric Oxide (Part E) Edited by LESTER PACKER AND ENRIQUE CADENAS VOLUME 397. Environmental Microbiology Edited by JARED R. LEADBETTER VOLUME 398. Ubiquitin and Protein Degradation (Part A) Edited by RAYMOND J. DESHAIES
xliii
xliv
Methods in Enzymology
VOLUME 399. Ubiquitin and Protein Degradation (Part B) Edited by RAYMOND J. DESHAIES VOLUME 400. Phase II Conjugation Enzymes and Transport Systems Edited by HELMUT SIES AND LESTER PACKER VOLUME 401. Glutathione Transferases and Gamma Glutamyl Transpeptidases Edited by HELMUT SIES AND LESTER PACKER VOLUME 402. Biological Mass Spectrometry Edited by A. L. BURLINGAME VOLUME 403. GTPases Regulating Membrane Targeting and Fusion Edited by WILLIAM E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 404. GTPases Regulating Membrane Dynamics Edited by WILLIAM E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 405. Mass Spectrometry: Modified Proteins and Glycoconjugates Edited by A. L. BURLINGAME VOLUME 406. Regulators and Effectors of Small GTPases: Rho Family Edited by WILLIAM E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 407. Regulators and Effectors of Small GTPases: Ras Family Edited by WILLIAM E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 408. DNA Repair (Part A) Edited by JUDITH L. CAMPBELL AND PAUL MODRICH VOLUME 409. DNA Repair (Part B) Edited by JUDITH L. CAMPBELL AND PAUL MODRICH VOLUME 410. DNA Microarrays (Part A: Array Platforms and Web-Bench Protocols) Edited by ALAN KIMMEL AND BRIAN OLIVER VOLUME 411. DNA Microarrays (Part B: Databases and Statistics) Edited by ALAN KIMMEL AND BRIAN OLIVER VOLUME 412. Amyloid, Prions, and Other Protein Aggregates (Part B) Edited by INDU KHETERPAL AND RONALD WETZEL VOLUME 413. Amyloid, Prions, and Other Protein Aggregates (Part C) Edited by INDU KHETERPAL AND RONALD WETZEL VOLUME 414. Measuring Biological Responses with Automated Microscopy Edited by JAMES INGLESE VOLUME 415. Glycobiology Edited by MINORU FUKUDA VOLUME 416. Glycomics Edited by MINORU FUKUDA
Methods in Enzymology
VOLUME 417. Functional Glycomics Edited by MINORU FUKUDA VOLUME 418. Embryonic Stem Cells Edited by IRINA KLIMANSKAYA AND ROBERT LANZA VOLUME 419. Adult Stem Cells Edited by IRINA KLIMANSKAYA AND ROBERT LANZA VOLUME 420. Stem Cell Tools and Other Experimental Protocols Edited by IRINA KLIMANSKAYA AND ROBERT LANZA VOLUME 421. Advanced Bacterial Genetics: Use of Transposons and Phage for Genomic Engineering Edited by KELLY T. HUGHES VOLUME 422. Two-Component Signaling Systems, Part A Edited by MELVIN I. SIMON, BRIAN R. CRANE, AND ALEXANDRINE CRANE VOLUME 423. Two-Component Signaling Systems, Part B Edited by MELVIN I. SIMON, BRIAN R. CRANE, AND ALEXANDRINE CRANE VOLUME 424. RNA Editing Edited by JONATHA M. GOTT VOLUME 425. RNA Modification Edited by JONATHA M. GOTT VOLUME 426. Integrins Edited by DAVID CHERESH VOLUME 427. MicroRNA Methods Edited by JOHN J. ROSSI VOLUME 428. Osmosensing and Osmosignaling Edited by HELMUT SIES AND DIETER HAUSSINGER VOLUME 429. Translation Initiation: Extract Systems and Molecular Genetics Edited by JON LORSCH VOLUME 430. Translation Initiation: Reconstituted Systems and Biophysical Methods Edited by JON LORSCH VOLUME 431. Translation Initiation: Cell Biology, High-Throughput and Chemical-Based Approaches Edited by JON LORSCH VOLUME 432. Lipidomics and Bioactive Lipids: Mass-Spectrometry–Based Lipid Analysis Edited by H. ALEX BROWN
xlv
xlvi
Methods in Enzymology
VOLUME 433. Lipidomics and Bioactive Lipids: Specialized Analytical Methods and Lipids in Disease Edited by H. ALEX BROWN VOLUME 434. Lipidomics and Bioactive Lipids: Lipids and Cell Signaling Edited by H. ALEX BROWN VOLUME 435. Oxygen Biology and Hypoxia Edited by HELMUT SIES AND BERNHARD BRU¨NE VOLUME 436. Globins and Other Nitric Oxide-Reactive Protiens (Part A) Edited by ROBERT K. POOLE VOLUME 437. Globins and Other Nitric Oxide-Reactive Protiens (Part B) Edited by ROBERT K. POOLE VOLUME 438. Small GTPases in Disease (Part A) Edited by WILLIAM E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 439. Small GTPases in Disease (Part B) Edited by WILLIAM E. BALCH, CHANNING J. DER, AND ALAN HALL VOLUME 440. Nitric Oxide, Part F Oxidative and Nitrosative Stress in Redox Regulation of Cell Signaling Edited by ENRIQUE CADENAS AND LESTER PACKER VOLUME 441. Nitric Oxide, Part G Oxidative and Nitrosative Stress in Redox Regulation of Cell Signaling Edited by ENRIQUE CADENAS AND LESTER PACKER VOLUME 442. Programmed Cell Death, General Principles for Studying Cell Death (Part A) Edited by ROYA KHOSRAVI-FAR, ZAHRA ZAKERI, RICHARD A. LOCKSHIN, AND MAURO PIACENTINI VOLUME 443. Angiogenesis: In Vitro Systems Edited by DAVID A. CHERESH VOLUME 444. Angiogenesis: In Vivo Systems (Part A) Edited by DAVID A. CHERESH VOLUME 445. Angiogenesis: In Vivo Systems (Part B) Edited by DAVID A. CHERESH VOLUME 446. Programmed Cell Death, The Biology and Therapeutic Implications of Cell Death (Part B) Edited by ROYA KHOSRAVI-FAR, ZAHRA ZAKERI, RICHARD A. LOCKSHIN, AND MAURO PIACENTINI VOLUME 447. RNA Turnover in Bacteria, Archaea and Organelles Edited by LYNNE E. MAQUAT AND CECILIA M. ARRAIANO
Methods in Enzymology
xlvii
VOLUME 448. RNA Turnover in Eukaryotes: Nucleases, Pathways and Analysis of mRNA Decay Edited by LYNNE E. MAQUAT AND MEGERDITCH KILEDJIAN VOLUME 449. RNA Turnover in Eukaryotes: Analysis of Specialized and Quality Control RNA Decay Pathways Edited by LYNNE E. MAQUAT AND MEGERDITCH KILEDJIAN VOLUME 450. Fluorescence Spectroscopy Edited by LUDWIG BRAND AND MICHAEL L. JOHNSON VOLUME 451. Autophagy: Lower Eukaryotes and Non-Mammalian Systems (Part A) Edited by DANIEL J. KLIONSKY VOLUME 452. Autophagy in Mammalian Systems (Part B) Edited by DANIEL J. KLIONSKY VOLUME 453. Autophagy in Disease and Clinical Applications (Part C) Edited by DANIEL J. KLIONSKY VOLUME 454. Computer Methods (Part A) Edited by MICHAEL L. JOHNSON AND LUDWIG BRAND VOLUME 455. Biothermodynamics (Part A) Edited by MICHAEL L. JOHNSON, JO M. HOLT, AND GARY K. ACKERS (RETIRED) VOLUME 456. Mitochondrial Function, Part A: Mitochondrial Electron Transport Complexes and Reactive Oxygen Species Edited by WILLIAM S. ALLISON AND IMMO E. SCHEFFLER VOLUME 457. Mitochondrial Function, Part B: Mitochondrial Protein Kinases, Protein Phosphatases and Mitochondrial Diseases Edited by WILLIAM S. ALLISON AND ANNE N. MURPHY VOLUME 458. Complex Enzymes in Microbial Natural Product Biosynthesis, Part A: Overview Articles and Peptides Edited by DAVID A. HOPWOOD VOLUME 459. Complex Enzymes in Microbial Natural Product Biosynthesis, Part B: Polyketides, Aminocoumarins and Carbohydrates Edited by DAVID A. HOPWOOD VOLUME 460. Chemokines, Part A Edited by TRACY M. HANDEL AND DAMON J. HAMEL VOLUME 461. Chemokines, Part B Edited by TRACY M. HANDEL AND DAMON J. HAMEL VOLUME 462. Non-Natural Amino Acids Edited by TOM W. MUIR AND JOHN N. ABELSON VOLUME 463. Guide to Protein Purification, 2nd Edition Edited by RICHARD R. BURGESS AND MURRAY P. DEUTSCHER
xlviii
Methods in Enzymology
VOLUME 464. Liposomes, Part F Edited by NEJAT DU¨ZGU¨NES¸ VOLUME 465. Liposomes, Part G Edited by NEJAT DU¨ZGU¨NES¸ VOLUME 466. Biothermodynamics, Part B Edited by MICHAEL L. JOHNSON, GARY K. ACKERS, AND JO M. HOLT VOLUME 467. Computer Methods Part B Edited by MICHAEL L. JOHNSON AND LUDWIG BRAND VOLUME 468. Biophysical, Chemical, and Functional Probes of RNA Structure, Interactions and Folding: Part A Edited by DANIEL HERSCHLAG VOLUME 469. Biophysical, Chemical, and Functional Probes of RNA Structure, Interactions and Folding: Part B Edited by DANIEL HERSCHLAG VOLUME 470. Guide to Yeast Genetics: Functional Genomics, Proteomics, and Other Systems Analysis, 2nd Edition Edited by GERALD FINK, JONATHAN WEISSMAN, AND CHRISTINE GUTHRIE VOLUME 471. Two-Component Signaling Systems, Part C Edited by MELVIN I. SIMON, BRIAN R. CRANE, AND ALEXANDRINE CRANE VOLUME 472. Single Molecule Tools, Part A: Fluorescence Based Approaches Edited by NILS G. WALTER VOLUME 473. Thiol Redox Transitions in Cell Signaling, Part A Chemistry and Biochemistry of Low Molecular Weight and Protein Thiols Edited by ENRIQUE CADENAS AND LESTER PACKER VOLUME 474. Thiol Redox Transitions in Cell Signaling, Part B Cellular Localization and Signaling Edited by ENRIQUE CADENAS AND LESTER PACKER VOLUME 475. Single Molecule Tools, Part B: Super-Resolution, Particle Tracking, Multiparameter, and Force Based Methods Edited by NILS G. WALTER VOLUME 476. Guide to Techniques in Mouse Development, Part A Mice, Embryos, and Cells, 2nd Edition Edited by PAUL M. WASSARMAN AND PHILIPPE M. SORIANO VOLUME 477. Guide to Techniques in Mouse Development, Part B Mouse Molecular Genetics, 2nd Edition Edited by PAUL M. WASSARMAN AND PHILIPPE M. SORIANO VOLUME 478. Glycomics Edited by MINORU FUKUDA
Methods in Enzymology
VOLUME 479. Functional Glycomics Edited by MINORU FUKUDA VOLUME 480. Glycobiology Edited by MINORU FUKUDA VOLUME 481. Cryo-EM, Part A: Sample Preparation and Data Collection Edited by GRANT J. JENSEN VOLUME 482. Cryo-EM, Part B: 3-D Reconstruction Edited by GRANT J. JENSEN VOLUME 483. Cryo-EM, Part C: Analyses, Interpretation, and Case Studies Edited by GRANT J. JENSEN VOLUME 484. Constitutive Activity in Receptors and Other Proteins, Part A Edited by P. MICHAEL CONN VOLUME 485. Constitutive Activity in Receptors and Other Proteins, Part B Edited by P. MICHAEL CONN VOLUME 486. Research on Nitrification and Related Processes, Part A Edited by MARTIN G. KLOTZ VOLUME 487. Computer Methods, Part C Edited by MICHAEL L. JOHNSON AND LUDWIG BRAND VOLUME 488. Biothermodynamics, Part C Edited by MICHAEL L. JOHNSON, JO M. HOLT, AND GARY K. ACKERS VOLUME 489. The Unfolded Protein Response and Cellular Stress, Part A Edited by P. MICHAEL CONN VOLUME 490. The Unfolded Protein Response and Cellular Stress, Part B Edited by P. MICHAEL CONN VOLUME 491. The Unfolded Protein Response and Cellular Stress, Part C Edited by P. MICHAEL CONN VOLUME 492. Biothermodynamics, Part D Edited by MICHAEL L. JOHNSON, JO M. HOLT, AND GARY K. ACKERS VOLUME 493. Fragment-Based Drug Design Tools, Practical Approaches, and Examples Edited by LAWRENCE C. KUO VOLUME 494. Methods in Methane Metabolism, Part A Methanogenesis Edited by AMY C. ROSENZWEIG AND STEPHEN W. RAGSDALE VOLUME 495. Methods in Methane Metabolism, Part B Edited by AMY C. ROSENZWEIG AND STEPHEN W. RAGSDALE VOLUME 496. Research on Nitrification and Related Processes, Part B Edited by MARTIN G. KLOTZ AND LISA Y. STEIN
xlix
C H A P T E R
O N E
Strategies to Determine Diversity, Growth, and Activity of AmmoniaOxidizing Archaea in Soil Graeme W. Nicol and James I. Prosser Contents 1. Introduction 2. Common Methods 2.1. Soil sampling and experimental design 2.2. Nucleic acid extraction 2.3. Reverse transcription and cDNA production 2.4. PCR of 16S rRNA genes 2.5. PCR amplification of amoA genes 2.6. Genes involved in CO2 fixation in the 3-hydroxypropionate/ 4-hydroxybutyrate cycle 3. Community Composition and Diversity 3.1. Nucleic acid fingerprinting 3.2. Analysis of clone libraries 3.3. High-throughput sequencing methods 4. Determining Growth and Abundance 4.1. Changes in relative abundance 4.2. Quantification of gene abundance 5. Activity 5.1. Estimating activity from gene abundance data 5.2. Quantifying transcriptional activity 5.3. Stable isotope probing 6. Conclusions References
4 6 6 7 9 10 13 14 15 17 18 20 21 21 22 23 25 26 26 29 31
Abstract Ecological studies of soil microorganisms require reliable techniques for assessment of microbial community composition, abundance, growth, and activity. Soil structure and physicochemical properties seriously limit the
Institute of Biological and Environmental Sciences, University of Aberdeen, Aberdeen, United Kingdom Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00001-4
#
2011 Elsevier Inc. All rights reserved.
3
4
Graeme W. Nicol and James I. Prosser
applicability and value of methods involving direct observation, and ecological studies have focused on communities and populations, rather than single cells or microcolonies. Although ammonia-oxidizing archaea were discovered 5 years ago, there are still no cultured representatives from soil and there remains a lack of knowledge regarding their genomic composition, physiology, or functional diversity. Despite these limitations, however, significant insights into their distribution, growth characteristics, and metabolism have been made through the use of a range of molecular methodologies. As well as the analysis of taxonomic markers such as 16S rRNA genes, the development of PCR primers based on a limited number of (mostly marine) sequences has enabled the analysis of homologues encoding proteins involved in energy and carbon metabolism. This chapter will highlight the range of molecular methodologies available for examining the diversity, growth, and activity of ammonia-oxidizing archaea in the soil environment.
1. Introduction The composition of soil microbial communities was traditionally determined by enrichment, isolation, and identification of organisms grown on laboratory media, with cell abundances determined by enumeration of culturable organisms or total cell counts following staining. These cultivation-based methods were supplemented with quantitative chemical analysis of cell components, such as phospholipid fatty acids, peptidoglycan, and nucleic acids. Growth was determined by changes in abundance or was inferred from activity measurements of broad-scale functional groups, for example, as respiration, denitrification, and nitrification. Many of these methods have been supplanted by molecular, nucleicacid-based techniques, which remove the major biases associated with cultivation on laboratory media. The advantages of molecular methods are most evident for determination of community composition and abundance, but they also enable the targeting of specific functional groups, providing finer scale analysis of growth and activity. The composition of microbial communities is now typically determined by analysis of 16S rRNA or functional gene sequences and abundance and growth increasingly by quantitative PCR. Nucleic-acid-based methods are also being developed for assessment of physiological activity of specific groups and their contribution to soil ecosystem processes. Some involve molecular assessment of changes in absolute and relative abundance in combination with traditional activity measures, while others, such as stable isotope probing (SIP) and measurement of transcriptional activity, attempt more direct activity measurements. Although eliminating cultivation-bias, molecular techniques are by no means perfect and potentially suffer from a range of biases which, following initial development, are rarely assessed or quantified (Prosser et al., 2010).
Analysis of Soil Thaumarchaeota
5
Caution should therefore be used when applying these techniques and when interpreting data, particularly as analysis techniques become more affordable and routine. The limitations of cultivation-based approaches for analysis of soil microbial communities are exacerbated for ammonia oxidizers, because of major difficulties in isolating, enumerating, and identifying these organisms. Specific growth rates of soil ammonia oxidizers are low, with typical doubling times measured in days. Cultivated organisms are unlikely to reflect natural communities because of bias introduced by laboratory conditions (Smith et al., 2001) and traditional identification and classification are based on a limited number of phenotypic characteristics. These technical limitations prevented meaningful studies of soil ammonia oxidizer ecology until the 1990s, when development was initiated of molecular techniques to determine community composition, to quantify ammonia oxidizer abundance, and to distinguish the growth and activities of different populations within ammonia oxidizer communities. Initial molecular investigations focused on betaproteobacterial ammonia oxidizers, to which all known soil ammonia oxidizer isolates belong. These organisms are found in all soils with nitrifying activity, which are dominated by nitrosospiras, rather than more readily enriched nitrosomonads. Differences in ammonia oxidizer communities were associated with a range of environmental factors and soil management strategies and new phylogenetic groups were discovered and characterized, some of which have no cultivated representative, but are presumed to be ammonia oxidizers. Analysis of communities of soil bacterial ammonia oxidizers was facilitated by their apparent exclusive membership of a single phylogenetic group within the betaproteobacteria, enabling the use of specific 16S rRNA gene primers (Kowalchuk et al., 1997; Stephen et al., 1998). In addition, this approach was complemented by the design of primers for amoA genes encoding subunit A of ammonia monooxygenase (Rotthauwe et al., 1997), the enzyme which catalyzes the first step in oxidation of ammonia to hydroxylamine (Arp and Stein, 2003). These major advances in our understanding of soil ammonia oxidizer population and community ecology were extended by discovery of ammonia-oxidizing archaea. Initial evidence for putative soil archaeal ammonia oxidizers was the presence of a crenarchaeal 16S rRNA gene and a homologue of bacterial amoA and amoB genes on a 43 kb fosmid clone recovered from soil (Treusch et al., 2005). Isolation of the first archaeal ammonia oxidizer, Nitrosopumilus maritimus, from a marine aquarium conclusively demonstrated autotrophic growth on ammonia as a sole energy source (Ko¨nneke et al., 2005). This organism possessed highly similar ammonia monooxygenase subunit homologues to those found on the soil fosmid, providing further support that soil archaea are also capable of oxidizing ammonia. These discoveries led to widespread surveys of archaeal amoA genes in a broad range of habitats (Francis et al., 2005) demonstrating their ubiquity
6
Graeme W. Nicol and James I. Prosser
and frequent higher abundance than bacterial amoA genes in most soils (Leininger et al., 2006) and other environments such as marine waters (Wuchter et al., 2006). Although these surveys continue, attention has moved to assessment of the environmental factors that determine the relative abundance of putative bacterial and archaeal ammonia oxidizers, their relative contributions to soil nitrification and the potential to control and manipulate their activities (Prosser and Nicol, 2008). These studies are dependent on molecular techniques. There is currently no known inhibitor that clearly distinguishes bacterial and archaeal ammonia oxidation, and cultivation of archaeal ammonia oxidizers is currently even more difficult than that of bacterial ammonia oxidizers, particularly from soil. Current evidence indicates that archaeal ammonia monooxygenase is found only in a specific lineage of archaea which have been described as mesophilic crenarchaea due to a distinct but specific phylogenetic association with thermophilic crenarchaea based on the comparison of 16S rRNA gene sequences. However, recent phylogenetic analyses of genomic data indicate that these organisms belong to a phylum which is distinct from both the established Crenarchaeota and Euryarchaeota lineages (Brochier-Armanet et al., 2008; Kelly et al., 2010; Spang et al., 2010) and which has been placed in a novel phylum described as the Thaumarchaeota (Brochier-Armanet et al., 2008). This term will therefore be used throughout this article. Molecular analysis of thaumarchaeal ammonia oxidizers has been used in analysis of field samples, usually for surveys or to assess the influence of soil characteristics and management practices on community structure, and in soil microcosm systems designed to investigate mechanisms controlling community composition, growth, and activity. Many of these studies have also involved parallel analysis of bacterial ammonia oxidizers. Strategies and techniques for the two groups are very similar, often differing only in the nature of primers for target genes, but a major current distinction is the difficulty in enriching and isolating soil thaumarchaeal ammonia oxidizers, while bacterial ammonia oxidizers grow readily in culture, although they are difficult to isolate. This chapter describes the methods used to study the abundance, diversity, growth, and activity of putative soil archaeal ammonia oxidizers.
2. Common Methods 2.1. Soil sampling and experimental design Analysis of thaumarchaeal soil ammonia oxidizers is subject to the same sampling and experimental design considerations as other microbial groups. Soil sampling procedures will depend on the nature of the study, but there is some evidence that thaumarchaeal ammonia oxidizer relative abundance
Analysis of Soil Thaumarchaeota
7
increases with depth (Ho¨fferle et al., 2010; Jia and Conrad, 2009; Leininger et al., 2006) which may influence the choice of sampling procedures. For molecular analyses of communities present under “field conditions,” samples must be stored at 20 C or, preferably, 80 C, particularly when analyzing gene transcripts. Ammonia, nitrite, and nitrate concentrations are best determined as soon as possible after sampling, as concentrations (particularly of nitrate) can change with storage, even in refrigerated samples. If soil is to be used for microcosm experiments, short-to medium-term storage (at 5 C) of soil must be considered. For example, sieving and homogenizing soil cores may be required to produce a consistent starting soil substrate for future experimentation, but sieving also changes the soil structure drastically and will release nutrients. Although this may not have large effects on slowgrowing ammonia-oxidizing populations, other members of the community may be affected. Therefore, the storage of soil in original soil cores may be desirable.
2.2. Nucleic acid extraction Nucleic acids can be extracted from suspended cells or directly from soil. The latter approach is more common and most studies extract DNA by bead-beating soil at high speed in the presence of a buffer, to dissolve nucleic acids in combination with other solutions that remove proteins and reduce coextraction of humic acids, which can inhibit downstream processes. A number of manufacturers produce kits for extraction of both DNA and RNA from soil (e.g., MPBio, MoBio), but several “home-made” methods are used which produce highly reproducible results. A widely used protocol (cited 297 times; November 2010) is that based on the method published by Griffiths et al. (2000). It is relatively inexpensive ($5 per sample) and uses a phosphate buffer with cetyl trimethyl ammonium bromide (CTAB) to reduce coextraction of humic acids. Generally, it extracts nucleic acids efficiently from a wide range of soil types, although soils with a high clay content can be problematic. Importantly, the method allows recovery of both DNA and RNA. The following solutions and reagents are required: 1. 5% CTAB in 120 mM phosphate buffer (2.58 g K2HPO43H2O, 0.10 g KH2PO4, 5.0 g CTAB, 2.05 g NaCl, water to 100 ml). Sterilize by autoclaving and store at room temperature. [Note: CTAB may precipitate from the solution. The buffer should therefore be warmed to redissolve if necessary.] 2. 30% polyethylene glycol (PEG) 6000 solution in 1.6 mM NaCl (30 g PEG6000, 9.35 g NaCl, water to 100 ml). Sterilize by autoclaving and store at room temperature. 3. 70% ice-cold ethanol. Store at 20 C.
8
Graeme W. Nicol and James I. Prosser
4. Liquified phenol 5. 24:1 Chloroform:isoamyl alcohol 6. Optionally, prepare a 25:24:1 phenol:chloroform:isoamyl alcohol solution. 7. 2 ml screw-cap tubes containing glass beads (e.g., Roche Lysing Matrix B) Method 1. Add 0.50 g soil, 0.5 ml CTAB phosphate buffer, 0.25 ml phenol, 0.25 ml chloroform:isoamyl alcohol (25:24:1) to a 2 ml screw-cap tube with glass beads. For RNA work, these steps should be performed on ice. 2. Lyse cells by shaking in a bead-beater (e.g., a FastPrep instrument) for 30 s, speed 4 m s 1. [Note: different speeds and/or duration of beadbeating may influence the amount of recovered nucleic acids from a target group, and optimal conditions can be determined prior to analysis of experimental samples, for example, see Leininger et al., 2006.] 3. Centrifuge at top-speed (e.g., 16,000g) in a bench-top centrifuge for 5 min at 5 C, remove top aqueous layer, and place in fresh 1.5 ml microcentrifuge tube containing 0.5 ml chloroform:isoamyl alcohol (this is to remove any residual phenol). 4. Invert the aqueous/organic mixture several times and centrifuge for 5 min at 16,000g at 5 C. 5. Extract the top aqueous layer and place in a new microcentrifuge tube. It is important not to remove any chloroform, and leaving behind a known volume of some aqueous solution (e.g., 50 ml) is preferable to carry-over of organic solvent. 6. Precipitate DNA by adding two volumes of 30% PEG/NaCl solution and mix well. 7. Leave on the bench on ice for 2 h (or overnight at 5 C) and centrifuge at 16,000g for 20 min at 5 C. A pellet may be visible at the bottom of the tube. 8. Slowly pour off the supernatant and add 1 ml of ice-cold 70% ethanol. Invert slowly two to three times and centrifuge for 20 min at 16,000g at 5 C. A pellet should be visible at the bottom of the tube. 9. Slowly pour off ethanol wash (take care not to lose pellet) and place tube back in centrifuge and spin for 5 s to collect residual ethanol. Remove the remaining ethanol using a pipette. [Note: this decreases the time required to dry the pellet significantly.] Leave the pellet to air-dry or warm in hot-block at 55 C for 1–2 min. Be careful not to overdry the pellet. 10. Resuspend the pellet in 30–50 ml of sterile molecular grade H2O. 11. Examine yield and quality (size range/shearing) of DNA by standard agarose gel electrophoresis. Accurate quantification of DNA and RNA
Analysis of Soil Thaumarchaeota
9
(in particular) may be achieved by spectrophotometric analysis (e.g., Nanodrop, Labtech, UK) after subsequent removal and purification of RNA and DNA, respectively. Although this method is a relatively vigorous extraction protocol, bias could potentially be introduced in the cell-extraction step as cells and nucleic acids may be adsorbed to soil organic matter or clay minerals and lysis of different cell types may vary. Studies comparing extraction methods using spiked soils samples (DNA or cells) have reported significant differences in recovery of nucleic acids with different methods (e.g., Mumy and Findlay, 2004). Adequate replication and experimental design should enable accurate determination of changes in relative amounts of specific target groups. However, absolute gene abundances determined for soil samples should be interpreted with some caution. Cell lysis bias may be important when comparing bacterial and archaeal ammonia oxidizers, due to significant differences in cell structure. The lack of cultivated representatives of both bacterial and thaumarchaeal ammonia oxidizers makes it difficult to assess the significance and extent of cell lysis and nucleic acid extraction biases at present.
2.3. Reverse transcription and cDNA production RNA, rather than DNA, is often used to study which organisms are potentially metabolically active in an environmental sample. In particular, mRNA transcripts of functional genes (e.g., amoA) potentially have a very short-half life and are therefore more likely to be indicative of in situ activity in an environmental sample. The production of cDNA from extracted RNA is required for such analyses. RNA extracted from soil, like DNA, is often contaminated with coextracted humic acids. Depending on the level of contamination, extracts can simply be diluted before DNase treatment and reverse transcription, or further purification steps (e.g., using a Qiagen RNeasy purification kit) can be used if required. As initial template concentrations can affect the efficiency of cDNA production significantly (Chandler et al., 1998), comparison of different samples requires all extracts to be treated in a consistent manner. For example, if analyses are performed on a series of microcosm experiments using the same soil with RNA extracts exhibiting little variability in concentration and quality between treatments, then a specific dilution of extracted soil RNA applied to all samples can be appropriate. However, if different soil types or different RNA yields are being compared, it may be more appropriate to purify RNA extracts further and use identical, quantified amounts. The first step in generating cDNA is removal of contaminating DNA. For most soils, this can be successfully achieved using a simple dilution of a DNA/RNA nucleic acid extract and DNase (e.g., RQ1 DNase (Promega)). However, additional steps can be used prior to DNase treatment
10
Graeme W. Nicol and James I. Prosser
such as using an RNeasy kit (Qiagen) with gDNA columns to remove most DNA and humic acids, though these add considerable expense to the procedure. Control reactions should always be performed to ensure that all DNA is digested, as humic acids, high salt contents, and other factors can reduce the efficiency of the reaction. RNA can then be purified from the DNase reaction, but it can also be used directly in reverse transcription reactions. cDNA can be generated by using a gene-specific reverse primer, if only one target gene is analyzed. Alternatively, random hexamer primers can be used to produce a cDNA library for all RNA molecules and resultant cDNA can be used for any target gene (e.g., 16S rRNA and amoA of both ammonia-oxidizing bacteria and archaea). In addition, the use of random hexamer primers (e.g., Invitrogen) has been observed to be more successful in generating archaeal amoA cDNA than a specific amoA reverse primer (G. W. Nicol, unpublished data). Briefly, a relatively simple protocol used by Nicol et al. (2008) is as follows: 1. In a microcentrifuge tube (0.2 or 0.6 ml allows the use of a thermocycler for all incubation temperatures), add 1 ml RQ1 DNase buffer, 2 ml RQ1 DNase, and 7 ml of DNA/RNA nucleic acid extract (equivalent to around 100 ng RNA, but much lower should also be successful depending on the relative level of transcription). Incubate this 10 ml reaction for 60 min at 37 C before adding 1 ml stop solution (supplied) and incubating for 10 min at 65 C. 2. Briefly centrifuge tubes to collect contents, add 1 ml of 150 mM random hexamer primers (e.g., Invitrogen), 1 ml of 40 mM (i.e., 10 mM each) dNTPs, and optionally 1 ml of an RNase inhibitor (e.g., RNaseOUT (Invitrogen)). Incubate this 13 ml reaction mixture at 65 C for 2 min and then quickly move to an ice water bath to rapidly chill the contents and prevent secondary structure formation. 3. Add 4 ml 5 Superscript II buffer, 2 ml 0.1 M DTT (Invitrogen), and incubate at 25 C for 2 min. Add 1 ml Superscript II RT enzyme and incubate at 25 C for 10 min and then 42 C for 50 min. Inactivate the reaction by heating at 70 C for 15 min. Negative controls must always be performed and should include the treatment of RNA samples with all reagents except the addition of RT enzyme to ensure that positive PCR products are derived from cDNA. In addition, a water-only control ensures that all reagents are contaminant free (including the RT enzyme).
2.4. PCR of 16S rRNA genes Putative soil thaumarchaeal ammonia oxidizers have been investigated using both 16S rRNA genes and functional genes. The former are of great value for investigation of bacterial ammonia oxidizers, all of which appear to fall
Analysis of Soil Thaumarchaeota
11
within a single, monophyletic 16S rRNA-gene-defined group within the betaproteobacteria. All cultivated members of this group oxidize ammonia, and 16S rRNA genes have arguably been used more than amoA genes to examine ammonia-oxidizing bacterial populations. For thaumarchaea, although there is evidence of some congruency between 16S rRNA- and amoA-phylogenies (e.g., Nicol et al., 2008), few cultures are available and no soil thaumarchaeal ammonia oxidizers have been cultivated. All known ammonia-oxidizing archaea belong to the Thaumarchaeota, but it is not yet known whether all organisms within this lineage are capable of ammonia oxidation. As the known diversity of thaumarchaeal lineages (based on 16S rRNA gene sequences) is greater than that of amoA-defined lineages, there is a possibility that current amoA gene primer sets target a restricted diversity of sequences. The use of thaumarchaeal 16S rRNA gene primers may therefore be useful in assessing thaumarchaeal growth during nitrification activity (or some other functional process) in situations where amoA genes are either divergent and uncharacterized or simply absent in some thaumarchaeal populations. They will also be useful in addressing the potential for different metabolisms (autotrophy, mixotrophy, heterotrophy) within soil thaumarchaeal communities. In addition, RNA-targeted analysis of 16S rRNA genes could potentially provide information on the more “active” members of a community, rather than the total community of a particular phylotype. This is based on the assumption that active cells will contain greater numbers of ribosomes than inactive cells and that cellular RNA levels will increase prior to cell division, following stimulation of activity. However, it should be noted that high and low ribosome contents are not always indicative of high and low activity, respectively (Wagner et al., 2003). In many soil environments, thaumarchaea represent the dominant component of archaeal communities (Bates et al., 2010), that is, they are much more abundant than methanogenic euryarchaea, and therefore the use of “general” archaeal primers sets results in the recovery of mainly thaumarchaeal sequences. However, thaumarchaeal biased primers may be required where methanogens represent a significant component of the microbial community (e.g., high water contents soils such as rice paddies or peat bogs). A brief selection of widely used archaeal and thaumarchaeal 16S rRNA gene primers is presented in Table 1.1 and can be generally paired in any combination with little requirement for optimization. For phylogenetic analysis, longer sequences are of course more informative, but analyses commonly use the first 900 nucleotides or so of the 16S rRNA gene and this is suitable for discrimination and robust phylogenetic analysis of major thaumarchaeal lineages. It should be noted that while certain primers or primer sets may be purported to cover “archaea” or subgroups, there are no individual primers that exhibit 100% identity across all archaeal lineages and some level of mismatch and bias should be expected. If a particular lineage is
Table 1.1 A selection of primers used to amplify thaumarchaeal gene sequences in environmental samples Primer
16S rRNA 20F A109f PARCH519r 771f Ar9r 957r 1492r amoA Arch-amoAF CrenAmo1F CrenamoA23f Arch-amoAR CrenAmo1R CrenamoA616r accA Crena_529F Crena_981R AccAF573 AccAR279 AccTaq183 hcd hcd-465F hcd-911F hcd-1267R a b c
Specificity
Sequence
Positionc
Reference
Archaea Archaea Archaeaa Thaumarchaeac Archaea Thaumarchaeac Universalb
TTCCGGTTGATCCYGCCRG ACKGCTCAGTAACACGT TTACCGCGGCKGCTG ACGGTGAGGGATGAAAGCT CCCGCCAATTCCTTTAAGTTTC CGGCGTTGACTCCAATTG GYYACCTTGTTACGACTT
2–20 80–96 451–465 685–703 842–863 894–911 1420–1437
Massana et al. (1997) Grosskopf et al. (1998) vrea˚s et al. (1997) Ochsenreiter et al. (2003) Jurgens et al. (1997) Ochsenreiter et al. (2003) Nicol et al. (2008)
Thaumarchaea Thaumarchaea Thaumarchaea Thaumarchaea Thaumarchaea Thaumarchaea
STAATGGTCTGGCTTAGACG AATGGTCTGGCTWAGACGC ATGGTCTGGCTWAGACG GCGGCCATCCATCTGTATGT GACCARGCGGCCATCCA GCCATCCATCTGTATGTCCA
4–23 6–24 7–23 619–638 628–644 616–635
Francis et al. (2005) Ko¨nneke et al. (2005) Tourna et al. (2008) Francis et al. (2005) Ko¨nneke et al. (2005) Tourna et al. (2008)
Thaumarchaea Thaumarchaea Thaumarchaea Thaumarchaea Thaumarchaea
GCWATGACWGAYTTTGTYRTAATG TGGWTKRYTTGCAAYTATWCC GTTYGTYACDGGDCCYGAYG TGATRTRRTCCATRCAHTCRTA TTTCRWTBGAYGAWYTDGGTGGAGCWA
529–552 961–981 573–592 697–718 620–646
Yakimov et al. (2009) Yakimov et al. (2009) Yakimov et al. (2009) Yakimov et al. (2009) Yakimov et al. (2009)
Thaumarchaea Thaumarchaea Thaumarchaea
GGHGGTGCWATGACTGAT AGCTATGTBTGCAARACAGG CTCATTCTGTTTTCHACATC
448–465 892–911 1267–1286
Offre et al. (2010) Offre et al. (2010) Offre et al. (2010)
This primer is identical to several “bacterial-specific” primers over this region and can be considered suitable for PCR amplification of bacterial 16S rRNA genes sequences also. This is a modified version of the standard 1492r which has several mismatches to thaumarchaeal 16S rRNA gene sequences. According to 54d9 numbering for 16S rRNA and amoA primers, Nitrosopumilus maritimus for acc and hcd sequences.
Analysis of Soil Thaumarchaeota
13
of interest, it is often possible to use specific, biased primers (Nicol et al., 2006). Therefore, for most soil environments, primers A109f and 1492r (Table 1.1) are suitable for amplifying archaeal 16S rRNA genes. For specifically thaumarchaeal sequences, a suitable primer combination would be A109f and 957r (Table 1.1). For both these sets, a standard PCR cycling protocol with a 55 C annealing temperature is suitable (95 C 5 min; 95 C 30 s, 55 C 30 s, 72 C for 1 min per kb for 35 cycles; 72 C for 10 min). When soil DNA is used as a PCR template, it is generally recommended to add BSA (final concentration 0.2 mg ml 1).
2.5. PCR amplification of amoA genes Analysis of amoA genes enables specific detection of putative ammoniaoxidizing archaea. The presence of the amoA gene does not, however, provide direct evidence of ammonia-oxidizing activity by the host organism. Cells may be dormant, amoA gene products potentially have alternative functions and genes may not be expressed under prevailing environmental conditions. However, such reservations apply equally to bacterial ammonia oxidizers and comparison of bacterial and archaeal amoA genes is the most common approach to assessment of the potential relative importance of these groups in soil nitrification. Thaumarchaeal amoA gene sequences are distinct from those of bacteria, with only 25% identity and 40% similarity shared between AOA and AOB sequences at the amino acid level. Therefore, different primer sets are used to specifically amplify amoA gene sequences from either AOA or AOB. Initial primers sets for studying AOA amoA diversity and abundance (e.g., Francis et al., 2005; Ko¨nneke et al., 2005; Treusch et al., 2005) were designed on a limited number of sequences deposited in GenBank, specifically those from the soil fosmid 54d9 (Treusch et al., 2005) and sequences recovered in the Sargasso Sea metagenome sequencing project (Venter et al., 2004). Consequently, these primers are designed to hybridize at similar positions, producing PCR products of 600 bp. A number of other primers and probes were also designed which hybridize toward the center of the gene (e.g., Treusch et al., 2005) but increasing amounts of sequence data highlight that there are no suitable conserved primer sequences which cover all sequences toward the middle of the archaeal amoA gene. Therefore, primers which hybridize at the ends of the amoA gene remain the best choice for general assays. However, assays for specific AOA lineages can be designed using other positions (e.g., Beman et al., 2008; Offre et al., 2009) and their comparatively short length may increase the efficiency of amplification which may be particularly important in qPCR assays. Table 1.1 highlights a selection of commonly used thaumarchaeal amoA primers.
14
Graeme W. Nicol and James I. Prosser
2.6. Genes involved in CO2 fixation in the 3-hydroxypropionate/4-hydroxybutyrate cycle There is currently a large amount of uncertainty regarding the mode(s) of carbon metabolism possessed by soil thaumarchaea, particularly as they are represented by a relatively wide amount of phylogenetic diversity. SIP studies provide evidence for both heterotrophic ( Jia and Conrad, 2009) and autotrophic (Zhang et al., 2010) metabolism in soil and available pure (but nonsoil) cultures all grow autotrophically. Genomes and cultures of soil thaumarchaea are not currently available but the genomes of N. maritimus (Walker et al., 2010) and C. symbiosum (Hallam et al., 2006), both of marine origin, possess genes indicative of both heterotrophic and autotrophic metabolism. The latter indicate assimilation of inorganic carbon using the 3-hydroxypropionate/4-hydroxybutyrate cycle (Berg et al., 2007). A number of studies have therefore developed primers targeting genes encoding key enzymes of this pathway. 2.6.1. Analysis of acetyl-CoA carboxylase genes Acetyl-CoA carboxylase (ACCase) catalyzes the transformation of acetylCoA and one bicarbonate molecule into malonyl-CoA. This enzyme is involved in fatty acid synthesis in many organisms, but as archaea do not possess fatty acids this enzyme could be indicative of the 3-hydroxypropionate/4-hydroxybutyrate cycle in autotrophic archaea. Yakimov et al. (2009) developed assays for accA, encoding the a-subunit of ACCase. Several primer sets were developed (Table 1.1) based on analysis of N. maritimus and C. symbiosum genomes and six marine environmental sequences of assumed thaumarchaeal origin. Primers PcB_388F and PcB_1271R were used to amplify genes from DNA extracted from a deep-sea sample and amplified both bacterial and archaeal accA sequences which were derived from organisms placed in distinct phylogenetic clusters. Specific primers Crena_529F and Crena_981R (Table 1.1) were then designed to target crenarchaeal accA genes which were subsequently sequenced and used to develop a TaqMan qPCR protocol using primers AccAF573, AccAR279, and probe AccTaq183 (Table 1.1). qPCR analysis indicated similar abundance of amoA and accA genes. The study therefore demonstrates the potential for analysis of putative autotrophic thaumarchaea using these primer sets, though primer design and environmental analyses were restricted to marine environments and analysis of soil communities may require further development. Similarly, Auguet et al. (2008) designed primer sets targeting genes encoding the c-subunit (accC). While these retrieved sequences are of assumed archaeal origin, they also amplified a large proportion of bacterial accC gene sequences and may not be suitable for retrieving exclusively autotrophic thaumarchaeal sequences.
Analysis of Soil Thaumarchaeota
15
2.6.2. Analysis of hcd genes 4-Hydroxybutyryl-CoA dehydratase (4HCD) catalyzes the transformation of 4-hydroxybutyryl-CoA to crotonyl-CoA and has been reported in crenarchaeal orders Sulfolobales, Desulfurococcales, and Thermoproteales, the euryarchaeal orders Archaeoglobales and Thermoplasmatales (Berg et al., 2007), thaumarchaea (Hallam et al., 2006; Walker et al., 2010), and some bacteria. Importantly, however, unlike ACCase encoding genes, 4HCD has not been found in obligately organotrophic archaea and therefore may be a more appropriate marker for detecting autotrophic populations. Offre et al. (2010) designed three sets of hcd primers, for construction of clone libraries, community analysis by DGGE, and qPCR analysis of putative autotrophic thaumarchaea in both terrestrial and aquatic environments. Details of hcd primers are given in Table 1.1. hcd analyses were performed on DNA extracted from N. maritimus and from a variety of habitats including soils and sediments. Clone libraries were constructed using 850-bp hcd PCR products amplified using primers hcd-465F and hcd-1267R before performing phylogenetic analysis (Fig. 1.1). Distinct phylogenetic clusters associated with the different habitats were observed demonstrating that this gene is a suitable marker for phylogenetic analysis of distinct autotrophic thaumarchaeal communities. DGGE profiles from environmental samples also indicated potential environment-specific communities, equivalent to those obtained from phylogenetic analysis providing confidence in the reliability of the primers. Primers hcd-911F and hcd-1267R were used for qPCR amplification (see Section 4), generating a 400-bp fragment of hcd genes and suitable for SybrGreenI qPCR assays with amplification efficiencies greater than 98.4% and r2 values > 0.999. Design of hcd primers is currently limited by the lack of cultured thaumarchaea and environmental genomes. The primers employed by Offre et al. (2010) showed good specificity, but were based on only seven sequences of marine origin. They were efficient for analysis of community structure and abundance in environmental samples, but reproducibility was lower for acid soil samples. This suggests that coverage of soil sequences may be low and that further development of hcd primers will be required for application to a broad range of environments, as additional sequences from cultivated organisms and from environmental surveys become available.
3. Community Composition and Diversity Soil thaumarchaeal ammonia oxidizer communities are generally characterized by amplification of archaeal amoA genes from nucleic acids extracted from soil and subsequent analysis by fingerprinting techniques (e.g., denaturing gradient gel electrophoresis (DGGE; Nicol et al., 2008) or
to Crenarchaea type-2 and Marine cluster 2
16
Graeme W. Nicol and James I. Prosser
Ignicoccus hospitalis (ABU81777) Pyrobaculum aerophilum (NP_560189) Pyrobaculum islandicum (ABL87428) 1 Pyrobaculum calidifontis (ABO08816) 100 Sulfolobus solfataricus (NP_344059) 1 Sulfolobus tokodaii (BAB66740) 100 Metallosphaera sedula (ABP95479) Sulfolobus acidocaldarius (AAY81436) Archaeoglobus fulgidus (AAB90900) Fusobacterium nucleatum (ZP_00144047) 1 Clostridium kluyveri (EDK35028) 99 Clostridium aminobutyricum (CAB60035) Porphyromonas gingivalis (AAQ65866) Plesiocystis pacifica (ZP_01911327) 0.74 GOS_2467004 (ECX83722) 1 100 GOS_3005373 (ECU86878) 100 GOS_1581051 (EDB85322) GOS_2881847 (ECV53061) GOS_2593340 (ECX13204) HF4000_APKG3H9 (ABZ08580) 0.97 GOS_2981125 (ECU99544) 100 1 GOS_2974840 (ECV02783) 100 Craib20 Craib15 Craib4 Craib12 Craib17 Craib11 1 Craib3 Soil cluster 0.61 100 Craib8 81 Craib1 1 100
1 100
0.10
1 100
Craib7 Craib18 Craib16 Craib19 Craib14 1 GOS_2900658 (ECV42905) 100 GOS_1125765 (EDE46652) Craib5 1 Ythan1 100 Ythan18 1 Ythan11 100 Ythan13 Estuarine 1 Ythan19 sediment cluster 100 Ythan20 1 Ythan2 100 Ythan12 Ythan16 Ythan5 Cenarchaeum symbiosum (YP_874977) 1 Ythan15 95 Nitrosopumilus maritimus (ABX12103) Ythan6 Craib2 Craib9 1 77 Craib10 Soil cluster Craib13 Craib6 Ythan14 1 Ythan4 Estuarine 1 100 Ythan17 sediment Ythan9 86 cluster Ythan3 Ythan7 Ythan10
Crenarchaea type-1
Anaerobe cluster Marine bacteria
1 100
Thaumarchaea
Figure 1.1 Bayesian phylogenetic analysis of derived HCD protein sequences from Craibstone soil (pH 7) and Ythan river intertidal estuarine sediment. This analysis was performed on 260 unambiguously aligned positions and clustering of sequences associated with different habitats indicates that the hcd gene is a highly suitable marker for discriminating different autotrophic thaumarchaeal populations. Posterior probabilities and the most conservative value from three bootstrapping methods (ML, parsimony, and distance) are shown above and below nodes of major sequence groups, respectively. (Adapted from Offre et al., 2010, with permission.)
terminal restriction fragment length polymorphism (T-RFLP; Ho¨fferle et al., 2010) or by sequencing, comparison of sequences with those in databases and phylogenetic analysis (e.g., Leininger et al., 2006). The limitations of these approaches to characterize ammonia oxidizer communities, and microbial communities in general, are both conceptual (see Section 2.5)
Analysis of Soil Thaumarchaeota
17
and technical. Technical issues involve the possibility of preservation of amoA genes in extracellular nucleic acids, variation in cell lysis and cellextraction efficiency, PCR and primer biases, and other general limitations of molecular methods (Wintzingerode et al., 1997). Many controls and modifications are available to test for and limit potential technical problems. Nevertheless, many studies represent “true” molecular ecology, in studying the ecology of molecules, rather than the ecology of organisms that contain those molecules. In this respect, studies characterizing thaumarchaeal amoA genes must be aware of studying “communities” of amoA genes, rather than communities of thaumarchaeal ammonia oxidizers. Although frequently purporting to investigate diversity, many studies do not determine diversity in a meaningful way. Coverage is rarely determined and quantitative estimates of diversity (richness, evenness, diversity indices) are rarely calculated. Estimation of coverage is generally not possible using fingerprinting techniques, which also provide little information on richness (Bent and Forney, 2008). These techniques detect differences in dominant phylotypes only, and therefore much of the richness will be below the level of detection or beyond the discriminatory power of DGGE gels or T-RFLP traces. amoA richness is not equivalent to the number of DGGE bands or T-RFLP peaks. Coverage and diversity indices can be determined and quantified from sequence data and provide one of the major advantages of high-throughput sequencing, which can generate sufficient numbers of sequences to make meaningful estimates.
3.1. Nucleic acid fingerprinting Commonly used fingerprinting techniques to investigate thaumarchaeal ammonia oxidizers in soil are DGGE and T-RFLP. While not directly providing any information of the primary sequence of profiled organisms, these techniques allow the rapid and relatively inexpensive comparison of community compositions. Both approaches aim to distinguish PCRamplified 16S rRNA gene or amoA gene fragments with identical length but different sequences. DGGE separates PCR products of the same length but differing in primary sequence. Different sequences possess different melting domains resulting in contrasting denaturing and migration characteristics in an increasing gradient of urea and formamide (Muyzer et al., 1993). Similarly, T-RFLP involves the separation of amplicons amplified using a primer (s) with an attached fluorophore. After digestion with selected restriction enzymes, fragments containing the labeled primer (the terminal restriction fragment or T-RF) are separated and detected using a standard Sanger sequencer, with different sequences potentially having different restriction sites and therefore producing different T-RFs. The resolution of the two techniques is similar. T-RFLP has advantages in that greater numbers of samples can be analyzed more quickly and with greater consistency, but
18
Graeme W. Nicol and James I. Prosser
provides less information on identity, which can be obtained by excision, purification, and amplification of DGGE bands. (For a detailed description of T-RFLP, see Marsh, 2005.) For DGGE analysis of thaumarchaeal communities in soil, both 16S rRNA and amoA genes have been successfully used to profile community structures (e.g., Nicol et al., 2008; Fig. 1.2). DGGE analysis often (but not always) requires the use of primers with a 40 bp GC-clamp to improve resolution. A suitable primer set for profiling thaumarchaeal 16S rRNA genes is 771f and 957r (Table 1.2) but with the GC-clamp of Muyzer et al. (1993) added to the 50 end of 957r. For amoA genes, primers CrenamoA23f and CrenamoA616r (Table 1.2) produce excellent results with these primers not requiring a GC-clamp.
3.2. Analysis of clone libraries Thaumarchaeal putative ammonia oxidizer communities in soil can also be characterized by sequencing amplified archaeal amoA gene sequences (e.g., Francis et al., 2005). This therefore provides direct information on amoA sequences, rather than indirect analysis by fingerprinting techniques, but traditional analysis by construction of clone libraries and sequencing of 16S rRNA pH 4.9
pH 7.5
amoA pH 4.9
pH 7.5
Figure 1.2 DGGE analysis demonstrating differences in thaumarchaeal community structures in soils at pH 4.9 or 7.5 using PCR amplicons of 16S rRNA and amoA genes. For 16S rRNA genes, a nested PCR approach was used with archaea-specific primers A109f and 1492r in the first round, and thaumarchaea-specific primers 771f and 957r (with GC-clamp) in the second round (see Table 1.2) and a denaturing gradient of 35–70% denaturant. For amoA genes, a single round of amplification was used with primers CrenamoA23f and CrenamoA616r (Table 1.2) with a gradient of 15–55%. Each lane represents an individual field sample. (Adapted from Nicol et al., 2008, with permission.)
Table 1.2 A selection of primers used for DGGE analysis of thaumarchaeal communities Primer
16S rRNA 771f 957r-GC
Specificity
Sequence
Gradient (%)a Positionb Reference
Thaumarchaea ACGGTGAGGGATGAAAGCT 35–70 Thaumarchaea CGCCCGCCGCGCGCGGCGGG CGGGGCGGGGGCACGGGGG GCGGCGTTGACTCCAATTG
amoA CrenamoA23f Thaumarchaea ATGGTCTGGCTWAGACG 15–55 CrenamoA616r Thaumarchaea GCCATCCATCTGTATGTCCA hcd hcd-681F-SCM1-GC Thaumarchaea CGCCCGCCGCGCGCGGCGGG 20–50 CGGGGCGGGGGCACGGGG GGGCAATTCCTGCAGATGCA hcd-892R-SCM1 Thaumarchaea CCTGTTTTGCAAACATAGCT a b
100% denaturant defined as 40% formamide (v/v) and 7 M urea (42%, w/v). According to 54d9 numbering for 16S rRNA and amoA primers, Nitrosopumilus maritimus for hcd sequences.
685–703 Ochsenreiter et al. (2003) 894–911 Ochsenreiter et al. (2003)
7–23 Tourna et al. (2008) 616–635 Tourna et al. (2008) 664–681 Offre et al. (2010)
892–911 Offre et al. (2010)
20
Graeme W. Nicol and James I. Prosser
representatives from libraries is significantly more time consuming and expensive, particularly if a reasonable level of replicated coverage is desired. In addition, 16S rRNA gene analysis can also be useful, particularly for profiling thaumarchaeal lineages that are not yet known to possess ammonia monooxygenase genes (e.g., Groups 1.1c and 1.3 thaumarchaea which are abundant in acidic forest and flooded soils, respectively; Prosser and Nicol, 2008). Phylogenetic analysis of sequences places communities within the context of database sequences from cultivated organisms and other environmental studies and relative abundances of different phylotypes can be determined by quantification of relative proportions of phylotypes in clone libraries. Identity of individual sequences of phylotypes can be determined by phylogenetic analysis or by direct comparison with database sequences. For the analysis of amoA genes (or any coding gene), phylogenetic analysis can be performed on both the DNA and translated protein sequence. Selection pressure during evolution is on the resulting amino acid and functioning protein, and it could be considered most appropriate to use protein sequences for reconstructing phylogenies. However, due to the relatively high level of conservation of amoA sequences, discrimination of closely related sequences may be better achieved by performing analyses on DNA sequences. As with any phylogenetic analysis, it is recommended that careful consideration is given to the correction models used in analysis. Programs such as JModelTest (Posada, 2008) and ProtTest (Abascal et al., 2005) can be used for selecting suitable correction models in phylogenetic analysis, and comparison of different methods (e.g., maximum likelihood, Bayesian, distance, parsimony) will give confidence of particular tree topologies.
3.3. High-throughput sequencing methods High-throughput sequencing methods (typically 454 pyrosequencing in microbial ecology) are now becoming less expensive and are likely to replace traditional clone library analysis and potentially even fingerprinting techniques in the near future (for a detailed description of this approach, see Huse et al., 2008). Due to the large number of sequences obtained from a single plate (or a small portion of a plate such as one quarter or one eighth) and the increasing read-length of sequences obtained, high-throughput sequencing approaches offer an increase in the depth of coverage and the ability to detect particularly rare phylotypes, potentially providing more reliable estimates of relative abundance and assessment of diversity indices, such as richness and evenness, compared to traditional clone libraries. For simply determining similarities or differences in ammonia-oxidizing archaeal communities, the use of DGGE and T-RFLP analyses is likely to continue for some time as both are rapid and inexpensive. However, additional costs required to determine which community members contribute to changes (i.e., identification of band/peak sequences) are significant and relatively time consuming
Analysis of Soil Thaumarchaeota
21
and the cumulative costs may soon exceed those of high-throughput sequencing. A significant issue with pyrosequencing data is the level of sequence “noise,” that is, identification and removal or treatment of sequences which have errors and which can artificially increase diversity estimates (Kunin et al., 2010). The treatment of sequence data is therefore a critical issue and approaches are being developed which aim to remove sequencing noise from pyrosequencing data (e.g., Quince et al., 2009).
4. Determining Growth and Abundance Ammonia oxidizer abundance is traditionally determined using the most probable number (MPN) method (e.g., McCaig et al., 1999). This assesses viable cell abundance only, suffers from the limitations of all cultivation-based techniques (Head et al., 1998), and does not distinguish bacterial and archaeal ammonia oxidizers. Indeed, the difficulties experienced in enriching archaeal ammonia oxidizers in standard ammonia oxidizer inorganic media suggest that MPN counts were dominated by bacterial ammonia oxidizers. Abundance, or biomass concentration, can also be estimated through measurement of potential nitrification, in which nitrate production rates are measured under “optimal” growth conditions. This approach assumes constant and maximal growth and activity of all ammonia oxidizers, which is unlikely, and therefore also suffers many of the problems associated with cultivation-based methods. Quantification of marker genes potentially provides a better estimate of ammonia oxidizer abundance and qPCR of specific 16S rRNA genes (bacterial ammonia oxidizers) and amoA genes (bacterial and thaumarchaeal ammonia oxidizers) has been employed. Use of specific amoA gene primers distinguishes bacterial and archaeal ammonia oxidizers, and subgroups, and has been used to quantify the relative gene abundances of these two groups in attempts to assess their relative contributions to soil nitrification (e.g., Leininger et al., 2006; Offre et al., 2009). These methods quantify the abundance of genes and not cells, and the number of gene copies will vary between different populations. For example, the thaumarchaea N. maritimus and C. symbiosum each possess one copy (Hallam et al., 2006; Walker et al., 2010), whereas Nitrosomonas and Nitrosospira species can possess between one and three copies (Norton et al., 2002).
4.1. Changes in relative abundance Changes in community composition in environmental samples can be followed using fingerprinting techniques described previously, with relative abundance of dominant thaumarchaea ammonia oxidizer phylotypes potentially extrapolated by calculation of the relative area of T-RFLP traces or
22
Graeme W. Nicol and James I. Prosser
relative band intensities of DGGE profiles. Although assessment of relative abundance from fingerprint data has limitations, it has proved reliable for analysis of relatively simple profiles generated by ammonia oxidizers. In itself, however, information on changes in relative abundance does not provide evidence of growth, as increase in relative abundance of a phylotype could be due to its growth or decrease in abundance of other phylotypes. These data do, however, indicate whether communities are responding to different conditions, and this approach has been used to provide evidence of response of thaumarchaeal ammonia oxidizers to temperature (Tourna et al., 2008), pH (Nicol et al., 2008), and inhibition by particular compounds such as acetylene (Offre et al., 2009).
4.2. Quantification of gene abundance The most commonly used approach to measure the abundance of individual populations or communities of thaumarchaeal ammonia oxidizers in soil is quantitative PCR of amoA genes (see Smith and Osborn (2009) for a review of quantitative PCR methodologies). This enables not only quantification of population sizes in a soil sample, but allows relatively accurate assessment of changes in abundance during incubation studies. A significant issue in the analysis of ammonia-oxidizing archaea is the design of primers (and potentially probes) used in qPCR assays. Studies involving single organisms/populations (e.g., monitoring the expression of a particular gene in response to a particular stimulus) have the option of designing primers using standard optimality criteria (i.e., lack of dimerization and complementarity, primers possessing similar Tm, relatively and within relatively close proximity (100–200 bp apart), etc.). However, in most microbial ecology studies, researchers often do not have the luxury of designing primers based on thermodynamic considerations, but only those which enable selection for particular phylogenetic groups. The number of suitable discriminatory primer positions (i.e., those which are conserved between all members of a monophyletic lineage but exclude nontarget sequences) is often limited, primers hybridizing to suitably conserved regions may not possess optimal or comparable thermodynamic properties, and there may be relatively large distances between suitable primer sites. Therefore, substantial optimization may be required to produce a qPCR assay with acceptable amplification efficiencies. As with any qPCR assay, the choice of standard is critical. Primers must exhibit complete identity to the standard, as mismatches reduce the efficiency of amplification and potential overestimation of gene abundance in an environmental sample (if the primers match perfectly to environmental DNA templates). For example, the first primers designed for AOA amoA generally exhibit at least one mismatch with the amoA gene of N. maritimus, including those presented in Table 1.1, indicating that there should be a revision of primer sets which are currently used.
Analysis of Soil Thaumarchaeota
23
A common approach is to generate PCR products using the primers that will be used in the qPCR followed by subsequent cloning and preparation of a plasmid containing an amoA insert. While this will ensure that there is an exact match between the standard template DNA and primer, it must be noted that the primer sites used are “artificial” (i.e., they represent the sequence of synthesized primers and not native DNA sequences). It is good practice to linearize the plasmid, as this can affect the efficiency of amplification (Suzuki et al., 2000). While these approaches will enable comparison of gene abundance between different samples, caution must always be employed in interpreting data as absolute numbers. No extraction method will recover all nucleic acids, and different protocols will most probably vary in the quantities recovered. An example of the application of both fingerprinting and qPCR in assessing growth of thaumarchaeal putative ammonia oxidizers is illustrated in Fig. 1.3 (Offre et al., 2009). Soil microcosms were incubated in the presence and absence of acetylene (a nitrification inhibitor) and were destructively sampled at 10-day intervals for analysis of ammonia, nitrite, and nitrate. In microcosms containing acetylene, ammonia oxidation was inhibited (with ammonia concentrations increasing due to continued ammonification) while nitrite þ nitrate concentrations did not increase. Nitrification was accompanied by changes in DGGE profiles of thaumarchaeal amoA genes, with a number of bands appearing, indicative of growth. To demonstrate actual growth, thaumarchaeal ammonia oxidizers were quantified by qPCR of amoA genes, using primers targeting a specific subpopulation. These data therefore demonstrate the detection of growth of soil thaumarchaeal ammonia oxidizers directly associated with nitrification.
5. Activity The previous section describes analysis of growth of putative thaumarchaeal ammonia oxidizers by estimating changes in abundance or relative abundance of thaumarchaeal amoA genes. These methods target DNA amplified from environmental samples and there is often strong correlation between changes in gene abundance and activity in soils (e.g., Offre et al., 2009) and other environments (e.g., Beman et al., 2008). The high abundances of ammonia oxidizers in some soils, and high rates of cell activity, could, however, lead to high rates of ammonia oxidation without increases in actual cell numbers and detectable growth. This is particularly important where ammonia concentration or ammonia flux is low and insufficient to give significant increases in biomass or cell abundance. Soil nitrification activity is measured, in the simplest situations, as decreases in ammonia concentration or increases in concentrations of nitrite
24
Graeme W. Nicol and James I. Prosser
A
Day 0 Control (no C2H2)
Day 30
B
C amoA gene copies (g–1 soil)
Nitrite + Nitrate (mg N g–1 soil)
Control (no C2H2)
10 Pa C2H2
50 40 30 20 10 0
0
10
20 Time (days)
30
Control
3 × 106 2 × 106 1 × 106 0
0
10
20 Time (days)
30
10 Pa acetylene
Figure 1.3 Inhibition of growth of ammonia-oxidizing archaea by acetylene. (A) DGGE analysis of amoA genes from AOA communities. Arrow indicates the growth of a specific population for which a specific qPCR assay was developed. (B) Inhibition of ammonia-oxidizing activity in microcosms with a 0.01% acetylene headspace partial pressure. (C) qPCR analysis demonstrating growth of AOA only in microcosms with active nitrification. (Adapted from data obtained by Offre et al., 2009, with permission.)
plus nitrate. This approach assumes negligible rates of other nitrogen cycling processes influencing ammonia, nitrite, and nitrate (e.g., mineralization of organic nitrogen, assimilation of ammonia and nitrate, and denitrification of nitrate). However, in other situations where these processes are significant, more sophisticated methods are required. These include utilizing specific inhibitors of ammonia oxidation and/or 15N-based techniques (see Norton and Stark, 2011). Demonstration and measurement of ammonia oxidation is frequently ignored in molecular analyses. Nevertheless, demonstration of ammonia oxidation is essential when interpreting molecular data on abundance, relative abundance, and community structure of ammonia oxidizers. The current lack of reliable specific inhibitors of archaeal or bacterial ammonia oxidation prevents discrimination of activity of these two groups, but they can be distinguished using specific amoA primers, enabling
Analysis of Soil Thaumarchaeota
25
exploitation of molecular techniques for in situ, cultivation-independent analysis of microbial activity. Two approaches, determination of transcriptional activity and SIP, are applicable to soil thaumarchaeal ammonia oxidizers. In addition, estimates of maximal activity have been made on the basis of amoA abundance.
5.1. Estimating activity from gene abundance data Ammonia-oxidizing activity can theoretically be determined as the product of specific cell activity (i.e., ammonia-oxidizing activity per cell) and the abundance of active cells. In practice, this approach is severely limited by a number of factors. Reliable quantitative estimates of specific activity are available only for a limited number of cultivated ammonia oxidizers and activity will vary between and within communities and with physicochemical conditions. Specific cell activities of cultivated organisms under optimal conditions may differ significantly from those of organisms that have never been characterized in laboratory culture under suboptimal conditions in the soil. In addition, abundance estimates based on traditional MPN methods suffer from the disadvantages of all cultivation-based methods and do not distinguish bacterial and archaeal ammonia oxidizers, while quantification of amoA gene abundance does not distinguish active and inactive cells. Nevertheless, this approach has been used to estimate maximal activity of archaeal ammonia oxidizers by extrapolation from cell activity of the marine archaeal ammonia oxidizer, N. maritimus. Data from BoyleYarwood et al. (2008) are used in the example below: Estimated specific activity of N. maritimus ¼ 0.3 1015 mol cell1 h 1 Number of amoA genes per cell ¼ 1 Approximate cell (amoA gene) abundance ¼ 107 archaeal amoA g 1 soil Maximum ammonia-oxidizing activity ¼ 0.3 10 2 mmol g 1 soil h 1 5. Unit conversion
1. 2. 3. 4.
¼ 7:2 102 mmol g1 soil d1 ¼ 1:08 mg N g1 soil d1 ¼ 1:08 mg N kg1 soil d1 6. Measured nitrification potential ¼ 1.68–3.89 mg N kg 1 soil d 1 On the basis of these estimates and calculations, thaumarchaeal ammonia oxidizers could have contributed a maximum of 27–64% of the nitrification potential in this soil.
26
Graeme W. Nicol and James I. Prosser
5.2. Quantifying transcriptional activity As RNA is more labile than DNA, it is assumed that RNA (rRNA and mRNA) is a better indicator of activity than DNA. While this may be the case, it should be recognized that ribosomes can be relatively stable structures and ribosome content in metabolically inactive cells can be maintained at relatively high levels (e.g., Flardh et al., 1992). Also, changes in the abundance of gene transcripts may not necessarily relate directly to actual measured process activity (Freitag and Prosser, 2009), and knowledge of RNA turnover, mRNA stability, and rates of translation are difficult to determine for microbial communities in soil. Ratios of gene transcript to gene abundance can, however, show better correlation with process measurements (Freitag and Prosser, 2009). Therefore, quantitative PCR analysis of mRNA transcripts and gene abundance can be a useful approach in determining changes in potential activity. In terms of measuring absolute abundance of mRNA in an extracted RNA sample (rather than relative changes in response to an amendment or perturbation), there are a number of issues which must be considered and recognized. First, a significant issue is the efficiency of cDNA production from mRNA. For absolute amounts, standard curves should be generated from cDNA which is derived from known quantities of RNA copies, produced from a standard by in vitro transcription. Also, depending on the purification steps used before cDNA synthesis, there may be significant losses of RNA. Quantitative analysis of transcripts (or for that matter, gene copies) is perhaps more robust and informative when analyzing changes in transcript abundance (rather than absolute abundance) during an experiment, be it a microcosm experiment or response to perturbation.
5.3. Stable isotope probing SIP determines which members of a microbial community actively assimilate a substrate during incubation with a stable isotope of the substrate. The majority of SIP studies have involved incubation with 13C-labeled compounds and, for ammonia oxidation, have been used to investigate autotrophic activity, through incubation with 13C-labeled carbon dioxide or bicarbonate. SIP therefore measures assimilation of inorganic carbon by putative ammonia oxidizers which are autotrophs, and is not a direct measure of ammonia oxidation per se. Following incubation, extracted 13 C- and 12C-labeled DNA or RNA are fractionated and PCR/RTPCR (analysis of 16S rRNA or functional genes) is used to determine which organisms have incorporated inorganic carbon. Only autotrophic organisms will assimilate inorganic carbon and, in many cases, soil ammonia oxidizers will be detected by analysis of bacterial or archaeal 16S rRNA
Analysis of Soil Thaumarchaeota
27
gene sequences present in labeled nucleic acids. In the presence of other active autotrophs, analysis of amoA gene sequences provides greater specificity and more direct evidence for links between ammonia oxidation and carbon fixation. During extended incubation, cross-feeding may occur, through secondary utilization of organic carbon derived from autotrophs through death or excretion. This problem is much less important than when applying SIP to heterotrophs, as 13CO2 produced during respiration by both primary and secondary utilizers will be assimilated only by autotrophs, and analysis of functional genes will detect activity of ammonia oxidizers only. It is possible, however, that organisms with amoA genes may be mixotrophic or heterotrophic and secondary utilization of organic carbon, fixed by autotrophs, could lead to amoA genes in 13C-labeled nucleic acids. Problems of cross-feeding are therefore best solved by SIP analysis of samples taken over a time course during incubation. RNA-SIP may provide greater sensitivity than DNA-SIP as 13C can be incorporated into new RNA transcripts without the cell going through cell division. Sequence analysis of functional genes in 13C-labeled RNA provides information on which organisms are actively transcribing specific genes, rather than those that are growing, potentially using other metabolisms. SIP analysis has been used to investigate ammonia oxidizers in microcosms containing soil or sediment incubated with inorganic carbon in the form of 13CO2 in the headspace (e.g., Jia and Conrad, 2009; Zhang et al., 2010) or 13C-bicarbonate in solution (e.g., Freitag et al., 2006). For soil incubations, a typical protocol is the following: 1. Sample and prepare soil to be used in microcosm experiment. Soil should be sieved (e.g., using a 3.35 mm sieve) to remove stones and plant material and the water content determined (105 C for 24 ) so that the soil can be adjusted to a particular percentage of the water-holding capacity or water-filled pore space. 2. Aliquot soil into serum vial bottles, maintaining a large headspace:soil volume ratio to enable maintenance of aerobic conditions (e.g., 10 g soil (dry weight equivalent) in a 144-ml serum vial bottle). Apply amendment (if any, e.g., ammonium) and close with butyl rubber stoppers and crimp to seal. 3. Supply carbon dioxide from a gas cylinder by injection through a rubber suba-seal into a gas bag or “reservoir” syringe (Fig. 1.4A). Consideration should be given to any air that may have diffused into the regulator, and it is advisable to expel a volume of gas equal to or greater than that present in the regulator, to avoid sampling air. 4. Using a smaller syringe and needle, remove gas from the reservoir syringe/gas bag (Fig. 1.4B) and inject into a microcosm through the butyl rubber seal (Fig. 1.4C). Depending on the volume being added, a slight overpressure will be produced in the microcosm bottle. Although not always necessary, after allowing an adequate time for gas diffusion, a
28
Graeme W. Nicol and James I. Prosser
A
B
C MS MS
RS
RS
Microcosm
13CO 2
D
Peristaltic pump
E
Sampling assembly
Fraction collector
Water in
CsCl out
Figure 1.4 Establishing stable isotope probing experiments with 13CO2 gas and sampling isotopically enriched DNA after ultracentrifugation. (A) To ensure only small volumes of expensive 13CO2 gas are sampled, gas should be taken from a cylinder by slowly injecting gas through a suba-seal into a reservoir syringe (RS) (e.g., 50 ml in volume). (B) Small volumes can be removed from the large reservoir syringe using a smaller microcosm syringe (MS). (C) Gas is added to an individual microcosm by injection through a rubber septum. (D) After incubation, DNA extraction and ultracentrifugation (see text), genomic DNA of different buoyant densities is collected by fractionating CsCl gradients by water displacement. Water is slowly added to the top of a polyallomer tube using a peristaltic pump and displaced through a needle which pierces the bottom of the tube (E). To ensure equal volumes are collected, displaced CsCl is dropped into microcentrifuge tubes positioned in a fraction collector.
syringe and needle can be used to remove the same volume of gas added to maintain the original pressure. If the seal has been punctured several times, a very thin smear of liquid silicone rubber can be applied to the top of the seal to prevent leakage. 5. If it is important to maintain aerobic conditions, microcosms should be opened regularly and flushed with air for a few minutes. If respiration kinetic data are available for a particular soil, this can be used as a guide to determine oxygen consumption rates. However, replenishment at 3–4-day intervals is adequate for most soils with a 10:1 headspace:soil ratio. Microcosms are then resealed and any gas treatments reestablished immediately. 6. Upon sampling, soils should be removed and placed in a zip-lock bag and frozen immediately (20 C is adequate for non-mRNA work. Otherwise 80 C is recommended).
Analysis of Soil Thaumarchaeota
29
7. Extract and quantify DNA as described previously (see Section 2.2). 8. Prepare a CsCl solution with a buoyant density of 1.696 g ml 1 (refractive index 1.399) by adding 1.27 g CsCl ml 1 TE and adjusting the density by adding small amounts of CsCl or TE buffer. The buoyant density is (indirectly) determined accurately by measuring the refractive index using a refractometer (e.g., a Reichert AR200 digital refractometer) and converting to buoyant density. 9. Polyallomer tubes (typically 2 or 5 ml, with larger volumes easier to handle) are filled with CsCl solution and a small volume (e.g., 200 ml) of CsCl solution mixed with 0.5–1.0 mg DNA and 1.5 ml ethidium bromide (1 mg ml 1). [Depending on the choice of rotors available, a series of preliminary runs should be performed to achieve a density gradient of 1.64–1.74 g ml 1.] After careful balancing and sealing, suspensions are then centrifuged (e.g., in a Beckman Coulter VTI65.2 vertical rotor at 184,388g (45,000 rpm) for 24 h at 20 C). 10. CsCl density gradients are fractionated into equal volumes (e.g., 200 ml) by displacement with water and a fraction recovery system (Fig. 1.4D). The refractive index (buoyant density) is determined for each individual fraction (using 20 ml) and DNA recovered by overnight precipitation in PEG solution and ethanol washing as described previously (Section 2.2). 11. The distribution of genomic DNA of a target group (e.g., thaumarchaea) through the gradient is then determined by qPCR of an appropriate target gene (e.g., amoA or hcd). DNA moves within the CsCl gradient by diffusion and not all DNA migrates to the correct buoyant density. It is therefore important that both 12 C and 13C incubations are performed in parallel to remove ambiguities if levels of carbon incorporation are small. This approach has been used to demonstrate incorporation of inorganic carbon into actively growing thaumarchaeal populations in soil using a variety of genes encoding proteins putatively involved in carbon (hcd) and energy (amoA) metabolism as well as 16S rRNA genes (Zhang et al., 2010; Fig. 1.5). However, DNA-SIP does require that cells are actively growing in order to be detected and therefore other biomarkers may potentially be more sensitive for SIP of autotrophic populations in soil. These include analysis of RNA (rRNA and mRNA; Whiteley et al., 2007), analysis of thaumarchaeal-specific lipids such as crenarchaeol (Wuchter et al., 2003), and potentially even the analysis of individual proteins ( Jehmlich et al., 2009).
6. Conclusions Thaumarchaeal ammonia oxidizers were discovered only 5 years ago, few laboratory cultures have been obtained, and no soil isolate has yet been reported. Although soil isolates are likely to be obtained, molecular analysis
30
Graeme W. Nicol and James I. Prosser
0.5
Proportion of total copies in CsCl gradient
0.4
0.5 Archaeal hcd Day 0 0.4
Archaeal amoA Day 0
0.3
0.3
0.2
0.2
0.1
0.1
0.0
0.0 1.66
1.68
1.70
1.72
1.74
1.66
1.68
0.5 Archaeal amoA Day 14 0.4
0.5 Archaeal hcd Day 14 0.4
0.3
0.3
0.2
0.2
0.1
0.1
0.0
1.70
1.72
1.74
1.70
1.72
1.74
1.70
1.72
1.74
0.0 1.66
1.68
1.70
1.72
1.74
1.66
1.68
0.5 Archaeal amoA Day 28 0.4
0.5 Archaeal hcd Day 28 0.4
0.3
0.3
0.2
0.2
0.1
0.1
0.0
0.0 1.66
1.68
1.70
1.72
1.74
1.66
1.68
–1
Buoyant density (g ml ) 12C
13C
Figure 1.5 Buoyant density distribution of thaumarchaeal genomic DNA extracted from soil after incubation with a headspace concentration of 5% (v/v) 12C- or 13CO2. Replicate CsCl gradients were fractionated and represented a density range from 1.66 to 1.74 g ml 1. DNA was precipitated from each individual fraction and the abundance of thaumarchaeal amoA and hcd and bacterial amoA genes was determined in each fraction by quantitative PCR and plotted on a proportional scale. Vertical error bars represent the standard error of proportional abundance from triplicate CsCl spins (representing triplicate microcosms). Horizontal error bars represent the standard error of the buoyant density of fractions collected from the same point in replicate CsCl tubes. (Adapted from data obtained by Zhang et al., 2010, with permission.)
is limited by a lack of information on both metabolic and sequence diversity. For example, there is evidence for autotrophic, mixotrophic, and heterotrophic growth of thaumarchaea containing amoA genes, and the breadth of
Analysis of Soil Thaumarchaeota
31
coverage of primers for amoA and other functional genes is uncertain. Within these limitations, the diversity, abundance, growth, and activity of thaumarchaea can be, and have been, investigated using a range of molecular microbial ecology techniques. In general, the only modification required for application of these techniques has been the use of specific primers. Importantly, however, the molecular analysis of thaumarchaeal gene and gene transcript diversity and abundance must be performed alongside appropriate process activity measurements.
REFERENCES Abascal, F., Zardoya, R., and Posada, D. (2005). ProtTest. Selection of best-fit models of protein evolution. Bioinformatics 21, 2104–2105. Arp, D. J., and Stein, L. Y. (2003). Metabolism of inorganic N compounds by ammoniaoxidizing bacteria. Crit. Rev. Biochem. Mol. Biol. 38, 471–495. Auguet, J.-C., Borrego, C. M., Ban˜eras, L., and Casamayor, E. O. (2008). Fingerprinting the genetic diversity of the biotin carboxylase gene (accC) in aquatic ecosystems as a potential marker for studies of carbon dioxide assimilation in the dark. Environ. Microbiol. 10, 2527–2536. Bates, S. T., Berg-Lyons, D., Caporaso, J. G., Walters, W. A., Knight, R., and Fierer, N. (2010). Examining the global distribution of dominant archaeal populations in soil. ISME J. in press. Beman, J. M., Popp, B. N., and Francis, C. A. (2008). Molecular and biogeochemical evidence for ammonia oxidation by marine Crenarchaeota in the Gulf of California. ISME J. 2, 429–441. Bent, S. J., and Forney, L. J. (2008). The tragedy of the uncommon: Understanding limitations in the analysis of microbial diversity. ISME J. 2, 689–695. Berg, I. A., Kockelkorn, D., Buckel, W., and Fuchs, G. (2007). A 3-hydroxypropionate/ 4-hydroxybutyrate autotrophic carbon dioxide assimilation pathway in archaea. Science 318, 1782–1786. Boyle-Yarwood, S. A., Bottomley, P. J., and Myrold, D. D. (2008). Community composition of ammonia-oxidizing bacteria and archaea in soils under stands of red alder and Douglas fir in Oregon. Environ. Microbiol. 10, 2956–2965. Brochier-Armanet, C., Boussau, B., Gribaldo, S., and Forterre, P. (2008). Mesophilic crenarchaeota. Proposal for a third archaeal phylum, the Thaumarchaeota. Nat. Rev. Microbiol. 6, 245–252. Chandler, D. P., Wagnon, C. A., and Bolton, H., Jr. (1998). Reverse transcriptase (RT) inhibition of PCR at low concentrations of template and its implications for quantitative RT-PCR. Appl. Environ. Microbiol. 64, 669–677. Flardh, K., Cohen, P. S., and Kjelleberg, S. (1992). Ribosomes exist in large excess over the apparent demand for protein synthesis during carbon starvation in marine Vibrio sp. strain CCUG 15956. J. Bacteriol. 174, 6780–6788. Francis, C. A., Roberts, K. J., Beman, J. M., Santoro, A. E., and Oakley, B. B. (2005). Ubiquity and diversity of ammonia-oxidizing archaea in water columns and sediments of the ocean. Proc. Natl. Acad. Sci. USA 102, 14683–14688. Freitag, T. E., and Prosser, J. I. (2009). Correlation of methane production and functional gene transcriptional activity in a peat soil. Appl. Environ. Microbiol. 75, 6679–6687.
32
Graeme W. Nicol and James I. Prosser
Freitag, T. E., Chang, L., and Prosser, J. I. (2006). Changes in the community structure and activity of betaproteobacterial ammonia-oxidizing sediment bacteria along a freshwatergradient. Environ. Microbiol. 8, 684–696. Griffiths, R. I., Whiteley, A. S., O’Donnell, A. G., and Bailey, M. J. (2000). Rapid method for coextraction of DNA and RNA from natural environments for analysis of ribosomal DNA- and rRNA-based microbial community composition. Appl. Environ. Microbiol. 66, 5488–5491. Grosskopf, R., Stubner, S., and Liesack, W. (1998). Novel euryarchaeotal lineages detected on rice roots and in the anoxic bulk soil of flooded rice microcosms. Appl. Environ. Microbiol. 64, 4983–4989. Hallam, S. J., Mincer, T. J., Schleper, C., Preston, C. M., Roberts, K., Richardson, P. M., and DeLong, E. F. (2006). Pathways of carbon assimilation and ammonia oxidation suggested by environmental genomic analyses of marine Crenarchaeota. PLoS Biol. 4, 520–536. Head, I. M., Saunders, J. R., and Pickup, R. W. (1998). Microbial evolution, diversity, and ecology. A decade of ribosomal RNA analysis of uncultivated microorganisms. Microbiol. Ecol. 35, 1–21. Ho¨fferle, S., Nicol, G. W., Pal, G. W., Hacin, J., Prosser, J. I., and Mandic´-Mulec, I. (2010). Nature of the ammonium supply is selective for ammonia oxidising archaea and bacteria in a wetland soil vertical profile. FEMS Microbiol. Ecol. 74, 302–315. Huse, S., Dethlefsen, L., Huber, J. A., Mark Welch, D., Relman, D. A., and Sogin, M. L. (2008). Exploring microbial diversity and taxonomy using SSU rRNA hypervariable tag sequencing. PLoS Genet. 4, e1000255. Jehmlich, N., Schmidt, F., Taubert, M., Seifert, J., Von Bergen, M., Richnow, H.-H., and Vogt, C. (2009). Comparison of methods for simultaneous identification of bacterial species and determination of metabolic activity by protein-based stable isotope probing (Protein-SIP) experiments. Rapid Commun. Mass Spectrom. 23, 1871–1878. Jia, Z., and Conrad, R. (2009). Bacteria rather than Archaea dominate microbial ammonia oxidation in an agricultural soil. Environ. Microbiol. 11, 1658–1671. Jurgens, G., Lindstro¨m, K., and Saano, A. (1997). Novel group within the kingdom Crenarchaeota from boreal forest soil. Appl. Environ. Microbiol. 63, 803–805. Kelly, S., Wickstead, B., and Gull, K. (2010). Archaeal phylogenomics provides evidence in support of a methanogenic origin of the Archaea and a thaumarchaeal origin for the eukaryotes. Proc. R. Soc. B 278, 1009–1018. Ko¨nneke, M., Bernhard, A. E., de la Torre, J. R., Walker, C. B., Waterbury, J. B., and Stahl, D. A. (2005). Isolation of an autotrophic ammonia-oxidizing marine archaeon. Nature 437, 543–546. Kowalchuk, G. A., Stephen, J. R., De Boer, W., Prosser, J. I., Embley, T. M., and Woldendorp, J. W. (1997). Analysis of ammonia oxidising bacteria of the beta subdivision of the class Proteobacteria in coastal sand dunes by denaturing gradient gel electrophoresis and sequencing of PCR-amplified 16S ribosomal DNA fragments. Appl. Environ. Microbiol. 63, 1489–1497. Kunin, V., Engelbrektson, A., Ochman, H., and Hugenholtz, P. (2010). Wrinkles in the rare biosphere. Pyrosequencing errors can lead to artificial inflation of diversity estimates. Environ. Microbiol. 12, 118–123. Leininger, S., Urich, T., Schloter, M., Schwark, L., Qi, J., Nicol, G. W., et al. (2006). Archaea predominate among ammonia-oxidizing prokaryotes in soils. Nature 442, 806–809. Marsh, T. L. (2005). Culture-independent microbial community analysis with terminal restriction fragment length polymorphism. Methods Enzymol. 397, 308–329. Massana, R., Murray, A. E., Preston, C. M., and DeLong, E. F. (1997). Vertical distribution and phylogenetic characterization of marine planktonic Archaea in the Santa Barbara Channel. Appl. Environ. Microbiol. 63, 50–56.
Analysis of Soil Thaumarchaeota
33
McCaig, A. E., Phillips, C. J., Stephen, J. R., Kowalchuk, G. A., Martyn Harvey, S., Herbert, R. A., et al. (1999). Nitrogen cycling and community structure of proteobacterial beta-subgroup ammonia-oxidizing bacteria within polluted marine fish farm sediments. Appl. Environ. Microbiol. 65, 213–220. Mumy, K. L., and Findlay, R. H. (2004). Convenient determination of DNA extraction efficiency using an external DNA recovery standard and quantitative-competitive PCR. J. Microbiol. Methods 57, 259–268. Muyzer, G., De Waal, E. C., and Uitterlinden, A. G. (1993). Profiling of complex microbial populations by denaturing gradient gel electrophoresis analysis of polymerase chain reaction-amplified genes coding for 16S rRNA. Appl. Environ. Microbiol. 59, 695–700. Nicol, G. W., Tscherko, D., Chang, L., Hammesfahr, U., and Prosser, J. I. (2006). Crenarchaeal community assembly and microdiversity in developing soils at two sites associated with deglaciation. Environ. Microbiol. 8, 1382–1393. Nicol, G. W., Leininger, S., Schleper, C., and Prosser, J. I. (2008). The influence of soil pH on the diversity, abundance and transcriptional activity of ammonia oxidizing archaea and bacteria. Environ. Microbiol. 10, 2966–2978. Norton, J. M., Alzerreca, J. J., Suwa, Y., and Klotz, M. G. (2002). Diversity of ammonia monooxygenase operon in autotrophic ammonia-oxidizing bacteria. Arch. Microbiol. 177, 139–149. Norton, J. M., and Stark, J. M. (2011). Regulation and measurement of nitrification in terrestrial systems. Methods Enzymol. 486, 343–368. Offre, P. O., Prosser, J. I., and Nicol, G. W. (2009). Growth of ammonia-oxidizing archaea in soil microcosms is inhibited by acetylene. FEMS Microbiol. Ecol. 70, 99–108. Offre, P. O., Nicol, G. W., and Prosser, J. I. (2010). Autotrophic community profiling and quantification of putative autotrophic thuamarchaeal communities in environmental samples. Environ. Microbiol. Rep. (in press). Ochsenreiter, T., Selezi, D., Quaiser, A., Bonch-Osmolovskaya, L., and Schleper, C. (2003). Diversity and abundance of Crenarchaeota in terrestrial habitats studied by 16S RNA surveys and real time PCR. Environ. Microbiol. 5, 787–797. vrea˚s, L., Forney, L., Daae, F. L., and Torsvik, V. L. (1997). Distribution of bacterioplankton in meromictic Lake Saelenvannet as determined by denaturing gradient gel electrophoresis of PCR-amplified gene fragments coding for 16S rRNA. Appl. Environ. Microbiol. 63, 3367–3373. Posada, D. (2008). jModelTest. Phylogenetic model averaging. Mol. Biol. Evol. 25, 1253–1256. Prosser, J. I., and Nicol, G. W. (2008). Relative contributions of archaea and bacteria to aerobic ammonia oxidation in the environment. Environ. Microbiol. 10, 2931–2941. Prosser, J. I., Jansson, J. K., and Liu, W.-T. (2010). Nucleic-acid-based characterisation of community structure and function. In “Environmental Molecular Microbiology,” (W.-T. Liu and J. K. Jansson, eds.), pp. 63–86. Caister Academic Press, Norwich. Quince, C., Lanze´n, A., Curtis, T. P., Davenport, R. J., Hall, N., Head, I. M., et al. (2009). Accurate determination of microbial diversity from 454 pyrosequencing data. Nat. Methods 6, 639–641. Rotthauwe, J.-H., Witzel, K.-P., and Liesack, W. (1997). The ammonia monooxygenase structural gene amoA as a functional marker: Molecular fine-scale analysis of natural ammonia-oxidizing populations. Appl. Environ. Microbiol. 63, 4704–4712. Smith, C. J., and Osborn, A. M. (2009). Advantages and limitations of quantitative PCR (QPCR)-based approaches in microbial ecology. FEMS Microbiol. Ecol. 67, 6–20. Smith, Z., McCaig, A. E., Stephen, J. R., Embley, T. M., and Prosser, J. I. (2001). Species diversity of uncultured and cultured populations of soil and marine ammonia oxidising bacteria. Microbial Ecol. 42, 228–237.
34
Graeme W. Nicol and James I. Prosser
Spang, A., Hatzenpichler, R., Brochier-Armanet, C., Rattei, T., Tischler, P., Spieck, E., et al. (2010). Distinct gene set in two different lineages of ammonia-oxidizing archaea supports the phylum Thaumarchaeota. Trends Microbiol. 18, 331–340. Stephen, J. R., Kowalchuk, G. A., Bruns,, M.-.V., McCaig, A. E., Phillips, C. J., Embley, T. M., and Prosser, J. I. (1998). Analysis of b-subgroup proteobacterial ammonia oxidizer populations in soil by denaturing gradient gel electrophoresis analysis and hierarchical phylogenetic probing. Appl. Environ. Microbiol. 64, 2958–2965. Suzuki, M. T., Taylor, L. T., and DeLong, E. F. (2000). Quantitative analysis of smallsubunit rRNA genes in mixed microbial populations via 5’-nuclease assays. Appl. Environ. Microbiol. 66, 4605–4614. Treusch, A. H., Leininger, S., Kietzin, A., Schuster, S. C., Klenk, H.-P., and Schleper, C. (2005). Novel genes for nitrite reductase and Amo-related proteins indicate a role of uncultivated mesophilic crenarchaeota in nitrogen cycling. Environ. Microbiol. 7, 1985–1995. Tourna, M., Freitag, T. E., Nicol, G. W., and Prosser, J. I. (2008). Growth, activity and temperature responses of ammonia-oxidizing archaea and bacteria in soil microcosms. Environ. Microbiol. 10, 1357–1364. Venter, J. C., Remington, K., Heidelberg, J. F., Halpern, A. L., Rusch, D., Eisen, J. A., et al. (2004). Environmental genome shotgun sequencing of the sargasso sea. Science 304, 66–74. Wagner, M., Horn, M., and Daims, H. (2003). Fluorescence in situ hybridisation for the identification and characterisation of prokaryotes. Curr. Opin. Microbiol. 6, 302–309. Walker, C. B., de la Torre, J. R., Klotz, M. G., Urakawa, H., Pinel, N., Arp, D. J., et al. (2010). Nitrosopumilus maritimus genome reveals unique mechanisms for nitrification and autotrophy in globally distributed marine crenarchaea. Proc. Natl. Acad. Sci. USA 107, 8818–8823. Whiteley, A. S., Thomson, B., Lueders, T., and Manefield, M. (2007). RNA stable-isotope probing. Nat. Protoc. 2, 838–844. Wintzingerode, F. V., Go¨bel, U. B., and Stackebrandt, E. (1997). Determination of microbial diversity in environmental samples: Pitfalls of PCR-based rRNA analysis. FEMS Microbiol. Rev. 21, 213–229. Wuchter, C., Schouten, S., Boschker, H. T. S., and Sinninghe Damste´, J. S. (2003). Bicarbonate uptake by marine Crenarchaeota. FEMS Microbiol. Lett. 219, 203–207. Wuchter, C., Abbas, B., Coolen, M. J. L., Herfort, L., Van Bleijswijk, J., Timmers, P., et al. (2006). Archaeal nitrification in the ocean. Proc. Natl. Acad. Sci. USA 103, 12317–12322. Yakimov, M. M., Cono, V. L., and Denaro, R. (2009). A first insight into the occurrence and expression of functional amoA and accA genes of autotrophic and ammonia-oxidizing bathypelagic Crenarchaeota of Tyrrhenian Sea. Deep Sea Res. II 56, 748–754. Zhang, L., Offre, P. O., He, J.-Z., Verhamme, D. T., Nicol, G. W., and Prosser, J. I. (2010). Autotrophic ammonia oxidation by soil thaumarchaea. Proc. Natl. Acad. Sci. USA 107, 17240–17245.
C H A P T E R
T W O
Responses of Aerobic and Anaerobic Ammonia/Ammonium-Oxidizing Microorganisms to Anthropogenic Pollution in Coastal Marine Environments Huiluo Cao,* Meng Li,* Hongyue Dang,† and Ji-Dong Gu* Contents 1. Introduction 2. Selection of Sampling Sites and Physicochemical Characterization 3. Molecular Ecological Characterization 3.1. Genetic markers 3.2. Extraction methods of total genomic DNA and clone library constructions 3.3. The abundance of aerobic and anaerobic ammonia/ ammonium-oxidizing microbes as determined by real-time fluorescent PCR (qPCR) 4. Community Structure Analyses 4.1. The diversity and richness of microbial community 4.2. Phylogenetic lineages 4.3. Community classification 5. Relationship Between the Community Structure and Physicochemical Parameters 5.1. Preparation of the input files 5.2. CCA analysis 5.3. Explanation of CCA statistical results 6. Relationships Between the Community Change and the Environments 7. Conclusions Acknowledgments References
36 38 39 39 42
43 44 44 46 47 50 51 52 52 54 55 56 56
* School of Biological Sciences, The University of Hong Kong, Pokfulam Road, Hong Kong SAR, PR China State Key Laboratory of Heavy Oil Processing and Centre for Bioengineering and Biotechnology, China University of Petroleum (East China), Qingdao, PR China
{
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00002-6
#
2011 Elsevier Inc. All rights reserved.
35
36
Huiluo Cao et al.
Abstract Up to date, numerous studies have shown that the community structure of aerobic ammonia oxidizers including ammonia-oxidizing Betaproteobacteria (Beta-AOB) and ammonia-oxidizing archaea (AOA) and, more recently, the anaerobic ammonium-oxidizing (anammox) bacteria is responsive to environmental conditions including salinity, pH, selected metal ions, concentrations of inorganic nitrogen, total phosphorus, the ratio of organic carbon and nitrogen, and sedimentological factors such as the sediment median grain size. Identification of these responses to known anthropogenic pollution is of particular interest to better understand the growth dynamics and activities of nitrogen transforming microorganisms in marine environments. This chapter discusses currently available methods including molecular ecological analysis using clone library constructions with specific molecular genetic markers for delineating community changes of Beta-AOB, AOA, and anammox bacteria. Using data on ammonia-oxidizing microbial community structures from Jiaozhou Bay in North China and three marine environments with anthropogenic pollution gradients in South China from coastal Mai Po Nature Reserve of Hong Kong to the South China Sea as examples, statistical analyses packages (DOTUR, UniFrac, and Canoco) are presented as useful tools to illustrate the relationship between changes in nitrogen metabolizing microbial communities and established environmental variables.
1. Introduction Autotrophic oxidation of ammonia/ammonium plays a significant role in the global nitrogen cycle. Ammonia/ammonium is being oxidized by various types of microorganisms: in the presence of oxygen by obligate aerobic ammonia-oxidizing Gamma- and Betaproteobacteria (Gamma- and Beta-AOB) (Head et al., 1993; Kowalchuk and Stephen, 2001) and a newly discovered cohort of archaea, the ammonia-oxidizing archaea (AOA) (Ko¨nneke et al., 2005; Treusch et al., 2005; Venter et al., 2004), and in the absence of oxygen by anaerobic ammonium-oxidizing (anammox) bacteria identified as members of the Planctomycetes (Strous et al., 1999; van de Graaf et al., 1995). Aerobic ammonia-oxidizing microorganisms are known to catalyze the biochemical reaction from ammonia to nitrite, which is the first and rate-limiting step in nitrification (Kowalchuk and Stephen, 2001), while anammox bacteria oxidize ammonium to N2 using nitric oxide as oxidant under anoxic conditions ( Jetten et al., 2009). Earlier studies identified nitrite as electron acceptor (van de Graaf et al., 1995), but recent genome-informed studies showed that nitrite is first reduced to NO, which enables the oxidation of ammonium in the anammox process ( Jetten et al., 2009, and references therein).
Ammonia-Oxidizing Community and Anammox to Pollution
37
Recent comprehensive molecular ecological studies have provided substantial information in that aerobic ammonia oxidizers respond to a wide range of environmental factors (Erguder et al., 2009; Kowalchuk and Stephen, 2001) indicating the possibility to utilize them as bioindicators for environmental changes (Dang et al., 2009a,b) and anthropogenic pollution (Cao et al., 2011; Li et al., 2010b, 2011b). The distinct AOB assemblages identified in these reports in correlation with particular environmental factors such as salinity, pH, concentrations of ammonium and oxygen may be the result of their differential ecophysiological adaptivity (Arp et al., 2007; Purkhold et al., 2003). Moreover, because the Beta-AOB are monophyletic, represent a greater phylotypic and ecophysiological diversity than GammaAOB, and contribute essential ecosystem functions to their diverse habitats, determination of their community structure (diversity and abundance) has been proposed to serve as a model system for the study of fundamental aspects of molecular microbial ecology (Kowalchuk and Stephen, 2001; Ward, 2005). Dang et al. (2010b) reported recently on the diversity, abundance, and spatial distribution of sediment Beta-AOB in response to environmental gradients and coastal eutrophication in Jiaozhou Bay, China, in which particular Beta-AOB community structures correlated with degrees of pollution in marine sediments, which prompted the proposal to use them as bioindicators for pollution. Other studies showed that spatial distribution and structure of sediment AOA communities were also influenced by a variety of environmental factors (Beman and Francis, 2006; Cao et al., 2011; Dang et al., 2008c, 2009a; Erguder et al., 2009; Li et al., 2011a,b; Mosier and Francis, 2008; Sahan and Muyzer, 2008; Santoro et al., 2008). The relative contributions by archaea and bacteria to aerobic ammonia oxidation in the environment have been recently reviewed (Prosser and Nicol, 2008; Schleper and Nicol, 2010). All of these reports indicated in particular, that estuarine and continental margin systems were significantly affected by continental input and these authors hypothesized that the sediment AOA community may serve as useful biotracers and bioindicators for specific environmental disturbances, especially land related wastewater pollution (Dang et al., 2008c, 2009a). For instance, the spatial distribution of putative soil-related AOA in the Changjiang (Yangtze) Estuary and the adjacent East China Sea indicated a strong influence of the Changjiang freshwater discharge on the microbial community in the coastal areas (Dang et al., 2008c). Likewise, the abundances of AOA and Beta-AOB correlated with the levels of environmental perturbation, and they may thus “bioindicate” feedback responses to environmental changes (Dang et al., 2010b; Mosier and Francis, 2008; Santoro et al., 2008). For example, AOA and Beta-AOB appear to respond to the availability of inorganic nitrogen species in different depths of the sediment and at different distances from the mangrove trees at Mai Po Nature Reserve in Hong Kong where anthropogenic pollution has been persistent for several decades (Li et al., 2011b). Collectively, sediment Beta-AOB or AOA community profiles
38
Huiluo Cao et al.
appear to provide important and characteristic information about coastal marine environments under various degrees of pollution pressure including especially anthropogenic wastewater. The diversity and distribution of anammox bacteria indicate also niche specificity among various ecosystems (Dale et al., 2009). Whereas the Candidatus “Scalindua” genus dominates in marine environments (Schmid et al., 2007; Woebken et al., 2008), the Candidatus genera “Brocadia” and “Kuenenia” are usually found in engineered systems such as wastewater treatment plants (WWTP) though a few reports indicated their presence also in freshwater and marine ecosystems (Amano et al., 2007; Nakajima et al., 2008; Zhang et al., 2007). Several recent reports showed that the structures of anammox bacterial communities might be strongly affected by anthropogenic pollution input (Amano et al., 2011; Dang et al., 2010a; Li et al., 2010b). These results suggest that specific anammox bacteria closely associated with wastewater and anthropogenic contamination may serve as bioindicators for environmental quality, and they may thus be also suited for forensic detection of past environmental pollution (Li et al., 2010b).
2. Selection of Sampling Sites and Physicochemical Characterization Beta-AOB abundance and activity is higher in environments with high input of nitrogenous compounds, for example, sewage and agricultural runoff pollution, and the surface sediments beneath the influx-rich water column may be a site of choice for detecting evidence for past and present nitrification activity (Satoh et al., 2007). In addition, existing records of water and sediment physicochemical analyses are helpful in the selection of the specific sampling sites, because the available information may provide necessary and important background information with regard to polluted versus nonpolluted areas or existing gradients of pollution. Such strategy guided the research conducted at Jiaozhou Bay of China in that sampling sites of known different degrees of pollution were selected to detect differences in BetaAOB community structures as a function of pollution thereby constituting bioindicators (Dang et al., 2010b). In that study, the sampling stations of the Eastern Bay formed a group of “hyper-eutrophied” habitats with river runoffs and WWTP discharges from the nearby area (Dang et al., 2010b), while all other sampling sites grouped together representing the “non-eutrophied” type with lower nutrient concentrations. This study was complemented by a structure analysis of the anammox bacterial community in the same Jiaozhou Bay sediments in northern China (Dang et al., 2010a). Similarly, surface sediments from both the long-term marine aquaculture zones, the Mai Po Nature Reserve in Hong Kong, and the South China Sea have been studied,
Ammonia-Oxidizing Community and Anammox to Pollution
39
because these three adjacent environments form a strong gradient of anthropogenic pollution from the coastal shelf of the Pearl River Delta to the open ocean, thereby providing an ideal set of samples to elucidate the relationship between ammonia oxidizers and anthropogenic pollution (Li et al., 2010b). Considering historical events, stability, and higher biomass, surface sediments are generally better suited for analysis of the aerobic and anaerobic ammonia/ammonium oxidizer communities than the water column. Water samples are most problematic due to the hydrodynamics and, in particular, the high mobility due to tidal and current activity in coastal areas and circulation patterns in the open sea. This is different for sediment. While coastal sediment samples may exhibit significant site heterogeneity and should be sampled at least in triplicate, the open ocean sea floor is fairly homogenous. Sediment samples are usually collected from the surface layer (1–5 cm depth) and/or from sediment cores at different depths in regular intervals using a core sampler. It is highly recommended to collect overlying water simultaneously from each site for analysis of water chemistry, especially in coastal areas. Further, it is necessary to measure a range of physical and chemical parameters in situ, such as temperature, dissolved oxygen (DO), pH, salinity, turbidity, chlorophyll a content, etc., using portable instruments for accurate and quick measurement. All samples must be stored in ice-cooled containers and transported back to laboratory quickly. Water samples can be stored at 4 C prior to chemical analysis, while sediment samples should be treated quickly for pore water chemistry analysis. For molecular analysis, sediment samples can be stored frozen at 80 C before extraction of nucleic acids, but freeze-and-thaw cycles should be minimized as much as possible to avoid alteration of the sample characteristics. Among the physical and chemical characteristics of water, temperature, pH, and DO of the overlying seawater and sediments can be easily measured in situ. All other analyses of environmental parameters such as salinity and the concentrations of ammonium, nitrite, and nitrate are best carried out in the laboratory. These parameters could be determined from the pore water obtained by centrifugation of sediments before analysis of nutrients as mentioned above (Dang et al., 2008c, 2009a). Other sediment chemical parameters including organic carbon (OrgC), organic nitrogen (OrgN), and total phosphorus (TP) contents can be measured (Dang et al., 2009c), and the quantification of metals and other pollutants of known importance in the area is desirable.
3. Molecular Ecological Characterization 3.1. Genetic markers The 16S rRNA gene is still the most widely used phylogenetic marker gene for studying microbial communities and AOB have been successfully studied through amplification and analysis of the 16S rRNA gene for
40
Huiluo Cao et al.
almost 2 decades. This lead to the early recognition of two monophyletic lineages, the Beta- and Gamma-AOB (Head et al., 1993; Norton, 2011; Purkhold et al., 2003), and the phylogenetic coherence of AOB has prompted to develop several specific 16S rRNA gene PCR primers (reviewed in Junier et al., 2010; Sekido et al., 2008). However, the 16S rRNA gene sequence identity is usually very high (for instance, >99% within the genus Nitrosospira), thereby providing a low resolution, which leads to proposals to employ functional marker genes (Klotz and Norton, 1995; Rotthauwe et al., 1997) and comparisons with the 16S rRNA gene considering their functionality and conserved features ( Junier et al., 2010). Functional molecular marker genes suited for studying aerobic and anaerobic ammonia oxidizers have been reviewed recently ( Junier et al., 2010; Kartal et al., 2011; Li et al., 2010b; Schmid et al., 2008; Sekido et al., 2008). The community structure of aerobic ammonia oxidizers in polluted coastal marine environments can be detected through amplifying functional genes such as the amoA gene, which encodes Subunit A of ammonia monooxygenase (AMO). AMO facilitates the first and rate-limiting step of the ammonia-oxidizing process (Kowalchuk and Stephen, 2001). The amoA gene has been successfully used to unravel the relationship between sediment aerobic obligate ammonia-oxidizing Beta-AOB and their environment in Jiaozhou Bay of China (Dang et al., 2010b) and the Mai Po Nature Reserve in Hong Kong (Cao et al., 2011; Li et al., 2011b). It was demonstrated already in the pregenomic era that cells of Beta-AOB encode multiple homologous copies of amoA gene (McTavish et al., 1993) with nearly identical nucleic acid sequence (Norton et al., 1996) and the amoA gene orthologs in cells of different strains differ significantly enough in sequence to make them suitable for use as highly efficient genetic biomarkers (Rotthauwe et al., 1997). Following genomic studies confirmed that the genomes of Beta-AOB encode multiple homologous copies of amoCAB gene clusters and singletons of the amoC gene (Arp et al., 2007; Chain et al., 2003; Norton et al., 2008; Stein et al., 2007). Several published bacterial amoA PCR primers have been successfully used to amplify a portion DNA templates of the amoA gene in environmental samples (Hoshino et al., 2001; Juretschko et al., 1998; Nicolaisen and Ramsing, 2002; Nold et al., 2000; Norton et al., 2002; Okano et al., 2004; Purkhold et al., 2000; Rotthauwe et al., 1997; Webster et al., 2002), and a recent comparison of these primers indicated considerable differences in their performance and specificity ( Junier et al., 2008). When considering its unique features, for instance, the functionality and available conserved sites, the amoA gene remains still the best genetic biomarker for determination of AOB community structures. Interestingly, the relatively short length of the amoA amplicon (450 bp) generated by the most used PCR primer pair (Rotthauwe et al., 1997) and its highly conserved
Ammonia-Oxidizing Community and Anammox to Pollution
41
sequence may generate less resolution than the 16S rRNA gene sequences (Purkhold et al., 2003); however, the high specificity provided by the fact that the amoA gene is restricted to aerobic ammonia oxidizers may overcome this shortcoming for environmental studies. Ammonia-oxidizing archaea are monophyletic and form a separate clade delineated from the Crenarchaeota (Spang et al., 2010); therefore, the primer sets originally used for their detection (targeting the 16S rRNA gene of group “MGI” of the Crenarchaeota) will generate too much sequence noise. As for AOB and anammox bacteria mentioned above, the use of specific 16S rRNA gene primers is also not a promising approach for detailed molecular ecological studies of AOA and several primer sets have been developed to amplify archaeal amoA genes from diverse environments (Francis et al., 2005; Ko¨nneke et al., 2005; Park et al., 2008; Tourna et al., 2008; Treusch et al., 2005; Urakawa et al., 2008). A comparison of diversity studies based on the 16S rRNA and archaeal amoA genes indicates a substantial congruence in the phylogeny of crenarchaeal ribosomal and amo genes (Prosser and Nicol, 2008) even though the detected diversity as defined by 16S rRNA gene diversity is significantly greater than the diversity associated with amoA gene detection (Nicol and Schleper, 2006; Prosser and Nicol, 2008). Still, the number of archaeal amoA sequences submitted to GenBank is increasing quickly indicating that the archaeal amoA gene remains the most preferred genetic biomarker. Other potential genetic markers are those genes that encode dissimilatory NO-forming nitrite reductase (copper-NirK, cytochrome cd1-NirS). nirK nitrite reductase genes associated with AOB and AOA have been successfully retrieved from many environments and could serve as an alternative genetic biomarker to define the community structure of ammonia-oxidizing microorganisms; however, the nirK gene was subjected to numerous horizontal gene transfers (Bartossek et al., 2010; Cantera and Stein, 2007). A key function of the nirK gene in ammonia catabolism of AOA has been proposed only recently (Schleper and Nicol, 2010). The hydrazine oxidoreductase (hzo) gene has been used with high specificity for the detection of anammox bacteria from the environment (Schmid et al., 2008). Interestingly, the distribution of hzo gene sequences recovered from sediment anammox bacteria correlated with identified environmental pollution along a pollution gradient from a coastal mangrove to the pristine South China Sea (Li et al., 2010b). Other recent studies identified the hcd (encoding putative 4-hydroxybutyrate-CoA dehydratase) gene as an additional potential genetic marker (Offre et al., 2010; Zhang et al., 2010). Hence, it can be expected that the combined simultaneous use of multiple genetic markers may provide solid and more convincing information about the abundance and distribution as well as changes in the community structure of microbes responsible for initial nitrogen transformations in the environment.
42
Huiluo Cao et al.
3.2. Extraction methods of total genomic DNA and clone library constructions The method of extracting genomic DNA from sediment and water samples has fundamental impact on the gene amplification process and concomitantly the results of the molecular ecological analysis. Molecular characterization of environmental microbial populations is generally based on the assumption that the extraction of DNA from different samples and environmental matrices is equally efficient or unbiased; however, this assumption is not necessarily justified (Urakawa et al., 2010). Available commercial kits for extracting genomic DNA (especially from sediment samples) are significantly variable due to varying efficiency of extraction and selectivity associated with each commercial product. Genomic DNA from biological replicates with nonsignificant site heterogeneity may be pooled together so as to decrease the variability from the different methods of extraction and inherited sample errors, but such approach may also have subsequently statistical implication (Prosser, 2010). Total genomic DNA may be extracted from 0.5 g of fresh sediments using FastDNA spin kit for soil (Qbiogene) according to the manufacturer’s instructions or other kits, such as the Power SoilTM DNA kit (Mo Bio Laboratories, Solana Beach, CA, USA), which is effective at removing PCR inhibitors from even the most difficult soil types. Known local water and sediment chemistries may justify modifications to the application of these kits (Abell et al., 2010). For instance, the application of purification kits (such as the GeneClean Spin Kit by Qbiogene) is helpful to eliminate polymerase inhibitors and improve the efficiency of PCR. Following several independent extractions of DNA from each sediment sample (biological replicates), the DNA samples from each site may be pooled together or processed individually for further molecular analysis. Community DNA concentrations can be measured by spectrophotometrically. When compared with other approaches, the Nanodrop (Thermo Fisher Scientific Inc., Wilmington, DE, USA) has the advantageous ability to measure highly concentrated samples without dilution. Determination of DNA concentration in all samples will allow adjustment and amplification from nearly equally concentrated DNA samples. Great care is needed to avoid contamination by exogenous DNA. Pooling of DNA template, concentrating PCR products, and using nested PCR protocols may increase the sensitivity, particularly if the target DNAs are suspected to be rare in the environment. Moreover, the use of the degenerate primers may reduce stochastic PCR biases and also improve the detection of rare templates in environmental samples. The success of the amplification process (length and intensity of amplicons) can be verified quickly by agarose gel electrophoresis. The addition of certain reagents such as bovine serum albumin will increase the specificity of reaction by eliminating polymerase inhibitors. The PCR amplification product may be used directly or after purification using dedicated purification kits for cloning into linearized
Ammonia-Oxidizing Community and Anammox to Pollution
43
plasmids with TA-overhangs at the 50 and 30 ends (e.g., Takara or Invitrogen TA cloning kits). The plasmids in transformed hosts such as Escherichia coli DH5a will usually be screened for insert residence by colony PCR or bluewhite screening on agar plate surfaces, isolated when insert positive and subsequently sequenced.
3.3. The abundance of aerobic and anaerobic ammonia/ ammonium-oxidizing microbes as determined by real-time fluorescent PCR (qPCR) The abundance of AOA and Beta-AOB as well as the ratio of their abundances is likely specific to individual environments, and local and seasonal changes might be a response to environmental changes indicating that abundance and abundance ratios are informative bioindicators of the extent of environmental change (Cao et al., 2011; Dang et al., 2010b; Li et al., 2011a,b; Mosier and Francis, 2008; Santoro et al., 2008). Presently, two types of qPCR protocols are in use, the SYBR green and the Taqman protocols, of which the SYBR green protocol is much more popular for quantification of ammonia oxidizer abundance, which is likely due to the higher specificity of primers used. This chapter will discuss the application of the qPCR assay based on SYBR green. Beta-AOB amoA genes can be detected using the general primers amoA-1F and amoA-2R (Mosier and Francis, 2008; Rotthauwe et al., 1997; Santoro et al., 2008), but other primers have been designed to quantify individual lineages with higher specificity such as the amoA genes of sediment Nitrosomonads (e.g., P128r and P365r in Dang et al., 2010b). Because of the still limited information on the molecular diversity of AOA, the 16S rRNA gene is the predominant target in environmental studies, even though detected crenarchaeal 16S rRNA gene abundance only roughly correlates with the abundance of the amoA gene from AOA (Park et al., 2008). Further, present crenarchaeal 16S rRNA gene targeting primer sets (Wuchter et al., 2006) are not specific for all AOA and most primers used for detection of crenarchaeal amoA genes have high specificity in quantification. Primers Arch-amoAF and Arch-amoAR (Francis et al., 2005; Mosier and Francis, 2008; Santoro et al., 2008) can be used for quantification of archaeal amoA genes associated with phylotype group MGI using the SYBR green qPCR method. Additional modified amoA gene primers such as primer CrenAmoAQ-F (Mincer et al., 2007; Moin et al., 2009) have been used to quantify and target new archaeal amoA genes recovered from estuaries and salt marshes, and primers CG I.1b-amoAF and CG I.1b-amoAR were suited to target amoA genes residing in phylotype group CG I.1b (Park et al., 2008). Forward primers Arch-amoAFA and Arch-amoAFB specifically target two AOA groups in the Gulf of California (Beman et al., 2008). For the determination of anammox bacterial abundance, both the 16S rRNA and hzo genes are suitable targets for quantification by qPCR (Dang et al., 2010a;
44
Huiluo Cao et al.
Li et al., 2010b), and the PCR primers and reaction conditions for such analyses have been summarized in several previous studies (Kartal et al., 2011; Li et al., 2010b; Penton et al., 2006; Schmid et al., 2005, 2008). Information about reaction volumes can be found in the manuals affiliated with the SYBR green mixture kit. Addition of BSA to the PCR assay improves the efficiency of reactions significantly. Plasmids containing 16S rRNA, amoA, or hzo gene amplicons as inserts can be extracted with the Miniprep Spin Kit (Qiagen) for generation of amplicon concentration standard curves. The standard curves are obtained using serial dilutions of plasmids carrying the target genes. In all experiments, negative controls containing insertless plasmids and no template DNA should be included and subjected to the same qPCR procedures as sample DNA to detect and exclude any possible contamination or carryover. Agarose gel electrophoresis and melting curve analysis should be routinely employed to confirm the specificity of the qPCR primers. The specificity of the primers should be confirmed by sequence analysis of amplicons generated with the qPCR primers for both the respective functional and the16S rRNA gene. Different Beta-AOB contain different copy numbers of amo gene clusters (Norton et al., 2002); however, a general assignment of gene copy number to individual lineages among the Beta-AOB needs more genome sequence information. However, all Beta-AOB so far investigated contain only one copy of the ribosomal RNA gene cluster. This permits a rough estimate of Beta-AOB cell numbers and the finding that the abundance ratios of 16S rRNA genes (number of cells) and of amoA genes are affected by environmental changes (Beman and Francis, 2006; Dang et al., 2010b; Mosier and Francis, 2008; Sahan and Muyzer, 2008; Santoro et al., 2008). For instance, the copy numbers of the sediment Beta-AOB amoA genes showed a different abundance in different areas, and the eastern and northern areas showed higher amoA gene abundance than the western and bay mouth areas in Jiaozhou Bay of China (Dang et al., 2010b). Quantitative analyses by qPCR of Beta-AOB amoA genes indicated that continental input from the nearby WWTPs and polluted rivers has significant impact on the abundance of the sediment Beta-AOB assemblages in Jiaozhou Bay, China (Dang et al., 2010b). For anammox bacteria, hzo gene abundances also showed a significant correlation with anthropogenic pollution at both of these two sites (Dang et al., 2010a; Li et al., 2010b, 2011c).
4. Community Structure Analyses 4.1. The diversity and richness of microbial community Microbial species diversity and richness can be represented by indices such as the Shannon-Wiener H and Simpson D indices and two nonparametric richness estimators, the abundance-based coverage estimator and the bias-corrected
Ammonia-Oxidizing Community and Anammox to Pollution
45
index Chao 1 (SChao1). Before calculating diversity and richness of a microbial community, it is critical to evaluate the size of the ammonia-oxidizing microbial community in the environment. One component of this evaluation is to determine whether the isolated/amplified clone number is adequate to reflect the natural community. This coverage can be calculated. Library coverage is normally calculated by the formula C ¼ [1 (n1/N )] 100, where n1 is the number of unique operational taxonomic units (OTUs) and N represents the total number of clones in a library (Mullins et al., 1995). Changes in diversity and richness can be calculated using respective software such as DOTUR (Schloss and Handelsman, 2005). Indices of diversity and richness are calculated for each library. Generally, 5% for amoA gene sequence and 3% for 16S rRNA gene (Schloss and Handelsman, 2005) are deemed acceptable cutoff distances (which is the genetic distance between two sequences based on nucleic acid sequence) for the calculation of amoA diversity AOA or AOB. A genetic distance cutoff of 5% has been widely used in most studies based on the amoA gene nucleic acid sequence (Beman and Francis, 2006; Dang et al., 2008c, 2009a, 2010b; Mosier and Francis, 2008; Sahan and Muyzer, 2008; Santoro et al., 2008) except for a few studies in which the deduced AmoA protein sequences have been employed to conduct this analysis. In contrast, a 3% or less than 3% cutoff for 16S rRNA and hzo genes have been used in a number of previous studies on anammox bacteria (Dang et al., 2010a; Li et al., 2010a,b, 2011c). The following procedure may be followed for diversity and richness analyses using DOTUR: (1) Produce an gene sequence alignment and create and export a distance matrix file using alignment software such as ARB (Ludwig et al., 2004) and PHYLIP (Felsenstein, 1989). (2) Import the distance matrix file and execute it using the pertinent command in DOTUR. (3) Generate the desired outfiles, most useful one with the number of the sequences (*.otu) and one with their identities (*.list) for each OTU as a function of distance. The rarefaction curve outfile is needed for plotting the curves. In general, the rarefaction analyses should also provide some information about whether or not enough clones have been selected for the analysis. The number of OTU should be saturated if adequate clones have been selected and the OTUs will not increase again with the clone numbers increasing, which reflects itself in the saturation profile of the rarefaction curves. Simultaneously, other richness estimates and diversity index may also be obtained. These parameters will represent different aspects of the analysis and indicate whether the current data reflect the natural community. In addition to above rarefaction analysis, calculation of two nonparametric richness estimators, the abundance-based coverage estimator (Shannon-Weiner H and Simpson D)
46
Huiluo Cao et al.
and the bias-corrected Chao1, can provide additional information about the studied community. A comparison between these estimators calculated for the community in each sample could indicate that the community structure variation could be followed along a gradient of pollution or other stressors. Above analyses have been employed to show that the dynamics in communities of ammonia-oxidizing microorganisms correlate with changes in their environments (Dang et al., 2010b; Moin et al., 2009; Mosier and Francis, 2008). For instance, two study sites (A3 and Dx) exhibited the least diversity in Beta-AOB amoA gene sequences with regard to the majority of the calculated indices when compared with other sites in the unevenly hypernutrified quadrants of Jiaozhou Bay of China (Dang et al., 2010b).
4.2. Phylogenetic lineages The phylogenetic lineages retrieved from environmental samples can provide important information about the nature of resident microbial communities. Phylogenetic analysis of experimental sequences in context with related sequences retrieved from GenBank allows a comparison of the resident microbial community with communities of similar cohorts in other environments. Generally, phylogenetic trees constructed after subjecting alignments of related sequences to inference of phylogeny using suitable object functions (maximum parsimony, maximum likelihood, etc.) and analysis software such as ARB (Ludwig et al., 2004), MEGA 4.0 (Tamura et al., 2007), Phylip (Felsenstein, 1989), or MrBayes (Ronquist and Huelsenbeck, 2003). In particular, relevant and related sequences can be obtained from the GenBank using the BLAST program (Altschul et al., 1997) and imported together with the experimental data set into software programs useful for alignment such as Clustal X (Larkin et al., 2007). The aligned sequences can be exported in the corresponding format readable by phylogeny inference software programs such as Phylip, MEGA, or MrBayes. The output of these phylogenetic inferences will produce the information necessary to construct majority consensus trees qualified by resampling confidence values (bootstrap values) or posterior probability value, which support the clade structure of the tree. The overall tree structure is helpful for comparing the experimental sequences with one another or with those from other studies. For instance, based on the 16S rRNA gene phylogenetic tree, Beta-AOB group into approximately 10 clusters (Purkhold et al., 2000) congruent with corresponding amoA gene lineages (Avrahami et al., 2002, 2003; Freitag and Prosser, 2003; Stephen et al., 1996). For AOA, two larger clades, namely water column/sediment and soil/sediment clades, have been defined (Francis et al., 2005; Park et al., 2006; Treusch et al., 2005) and these clusters provide the basis for the comparison of experimental results with those from other studies. Some lineages separated from others in the phylogenetic trees may
Ammonia-Oxidizing Community and Anammox to Pollution
47
also be present only in some environments with specific habitat characteristics. For example, in the research of Jiaozhou Bay in China, some sequences were commonly present at every sampling site in the surveyed area (10 of the 43 OTUs) or they represented a unique cluster such as OTU A5-a-16, which was unique to only one sampling site and the sequence represented a novel single sequence clade at a basal position in phylogenetic tree (Dang et al., 2010b). This phylogenetic information collectively describes the differential distribution of Beta-AOB in the studied research area and, together with diversity and richness information, provides the opportunity to distinguish different microenvironments (Dang et al., 2010b).
4.3. Community classification A fundamental goal of ecological studies is to compare microbial communities from different environments or in response to different treatments. Various statistical tools are available for this type of analysis (Ramette, 2007; Schloss, 2008). Because the majority of environmental nitrifying archaea and bacteria have not yet been cultured, ecology studies of nitrifying microorganisms are mostly carried out using molecular approaches that include statistical tools developed to evaluate nucleic acid sequence data. The UniFrac statistical software package was specifically designed for this purpose (Lozupone and Knight, 2005; Lozupone et al., 2006, 2007). Due to its easy access (online), ease of use (intuitive, user-friendly interface, online tutorial and help, graphical presentation and output), and high performance (parallel computing), UniFrac is gaining more and more popularity in the field of microbial ecology. Originally, this statistical program was successfully applied to microbial community classification based on 16S rRNA gene sequences. Recently, it has also been applied in community classification of marine N cycling microbiota (Dang et al., 2009b,c), including nitrifying archaea and bacteria (Cao et al., 2011; Dang et al., 2008c, 2009a, 2010b,c) and anammox bacteria (Dang et al., 2010a; Li et al., 2010a) based on functional gene sequence data. With its expansion to a new version of Fast UniFrac (Hamady et al., 2010), more features and computing power were added to this valuable statistical tool. The basic procedure for microbial community analyses using UniFrac is outlined below. 4.3.1. Preparation of the input files Before starting the UniFrac analyses, input files to UniFrac have to be prepared. The UniFrac program requires two input files, a rooted phylogenetic tree file and an environment file (Lozupone et al., 2006). The tree file can be in either Nexus or Newick format and can be built based on alignments of gene sequences subjected to phylogenetic inference with programs such as Phylip or MrBayes. It has been shown that the UniFrac results are not sensitive to the method used to infer phylogeny, thus most of the phylogenetic analysis
48
Huiluo Cao et al.
programs can be used for producing the phylogenetic tree input file (Lozupone et al., 2007). The environment file contains a list of entries, each of which contains a sequence name, an environment name, and optionally the number of times the sequence was observed in each environment. 4.3.2. Log on to UniFrac UniFrac was developed by Rob Knight and colleagues from the University of Colorado (Lozupone and Knight, 2005; Lozupone et al., 2006, 2007). The internet Web site for online UniFrac is http://128.138.212.43/unifrac/ index.psp. This Web site also contains a suite of tutorials, help, and FAQ facilities that are very valuable for learning and working on UniFrac analyses. New users of UniFrac need to register and log in to fully take advantage of the features of this statistical program. 4.3.3. Check data accuracy within UniFrac The UniFrac interface includes an option termed “environment counts,” with which the accuracy of the input data can be checked before carrying our various analyses. 4.3.4. Microbial community classification using UniFrac Two multivariate statistical tools, Jackknife environment clustering and principal coordinates analysis (PCoA), are provided within UniFrac for microbial community classification using gene sequence data. Both statistics can work on qualitative data (unweighted, sequences alone) and quantitative data (weighted with sequence abundance) (Lozupone et al., 2007). It has been demonstrated that the qualitative analyses may detect the microbial community long-term evolution or adaptation with strong genetic background, while the quantitative analyses may detect the microbial community adaptation to transient characteristics of the environment (Lozupone et al., 2007). Thus, the unweighted and weighted UniFrac analyses may give different results about the microbial community classification, depending on the specific environmental condition and/or environmental history. 4.3.5. Explanation of UniFrac statistical results Figures 2.1 and 2.2 show example UniFrac Jackknife environment clustering and PCoA analysis results using the molecular data of Beta-AOB collected from the coastal sediments of Jiaozhou Bay (Dang et al., 2010b). Both figures show that the deduced AmoA protein sequences clearly distinguished two groups of the sediment Beta-AOB assemblages in Jiaozhou Bay. The assemblages of stations A3, A5, C4, and Y1 at the Eastern and Northern areas of Jiaozhou Bay constituted Class 1, whereas those of stations B2, D1, D5, and Dx at the Western and bay mouth areas constituted Class 2. This clustering pattern of the Beta-AOB microbial assemblages correlated with the classification of the Jiaozhou Bay environments (Dang et al., 2010b): the Eastern
49
Ammonia-Oxidizing Community and Anammox to Pollution
A5 100
C4
84
Y1 50
A3 B2
72
D1
100
D5
78
Dx 0.13
0.10
0.05 Distance in UniFrac unit
0.00
Figure 2.1 Dendrogram of the hierarchical clustering analysis of the Jiaozhou Bay sedimentary AmoA genotype assemblages using the UniFrac normalized and weighted Jackknife environment clusters statistical method. The percentage supports of the classification tested with sequence jackknifing resamplings are shown near the corresponding nodes (modified from Dang et al., 2010b).
P2—percent variation explained 4.18%
0.06
0.04
C4
0.02
B2
D1
Y1
A3
0.00 Dx –0.02
D5 –0.04 A5
–0.06 –0.20 –0.15 –0.10 –0.05 0.00 0.05 0.10 0.15 P1—percent variation explained 90.16%
0.20
Figure 2.2 Ordination diagram of the UniFrac weighted and normalized PCoA analysis of the sediment Beta-AOB communities using the AmoA sequences recovered from the Jiaozhou Bay. Shown are the plot of the first two principal coordinate axes (P1 and P2) of PCoA and the distribution of the AmoA genotype assemblages (designated with the sampling station names) in response to these axes (modified from Dang et al., 2010b).
50
Huiluo Cao et al.
and Northern areas are usually the most polluted and eutrophied areas of Jiaozhou Bay (Dang et al., 2008a,b,c, 2009c; Liu et al., 2005). Figures 2.3 and 2.4 also show that anammox bacteria from three marine environments clearly distinguished from each other following a strong gradient of known anthropogenic pollution in South China (Li et al., 2010b).
5. Relationship Between the Community Structure and Physicochemical Parameters Canonical correspondence analysis (CCA) is a simple yet powerful statistical tool that is often used to detect the relationship between microbial community structure and environmental variables. CCA is based on unimodal species–environment relationships to model microbial community response to the environmental variation. This model is thought to be robust even when some unimodal species–environment relationships are not PCA-P1 versus P2 0.06 South China Sea sediments
P2—percent variation explained 2.55%
0.04
0.02
0.00 Long-term aquaculture zone sediments
–0.02
–0.04 Mai Po Nature Reserve sediments
–0.06 –0.3
–0.2
–0.1 0.0 0.1 0.2 0.3 0.4 P1—percent variation explained 97.45%
0.5
Figure 2.3 Principal coordinate plot by UniFrac analyses of the 16S rRNA gene sequences from three marine environmental sediments with a known gradient of anthropogenic pollution. Aquaculture: Hong Kong Deep Bay aquaculture sediment; Mai Po: Hong Kong Mai Po Nature Reserve coastal sediment; SCS: the South China Sea sediment (modified from Li et al., 2010b).
51
Ammonia-Oxidizing Community and Anammox to Pollution
PCA-P1 versus P2 0.5
P2—percent variation explained 25.60%
0.4 Long-term
aquaculture zone sediments
0.3 0.2 0.1
South China Sea sediments
0.0 –0.1 –0.2 –0.3
Mai Po Nature Reserve sediments
–0.4 –0.4
–0.2 0.0 0.2 0.4 0.6 P1—percent variation explained 74.40%
0.8
Figure 2.4 Principal coordinate plot by UniFrac analyses of the Hzo protein sequences from three marine environmental sediments with a known gradient of anthropogenic pollution. Aquaculture: Hong Kong Deep Bay aquaculture sediment; Mai Po: Hong Kong Mai Po Nature Reserve coastal sediment; SCS: the South China Sea sediment (modified from Li et al., 2010b).
satisfied (Ramette, 2007; ter Braak and Smilauer, 2002). CCA is suitable for sparse community data with a large proportion of zero entries in the species or OTU data matrix (Lepsˇ and Sˇmilauer, 2003). CCA statistics may detect specific species or OTUs that respond to specific environmental variables, helping identify candidate indicator species or OTUs (Ramette, 2007). Thus, CCA is gaining its popularity in modern microbial ecology studies. Canoco is an implementation of CCA that is widely used in ecological studies (ter Braak and Smilauer, 2002). The basic procedure for microbial community-environment CCA analyses using Canoco is outlined below.
5.1. Preparation of the input files To remove the influence of the difference in scales and units for environmental variables, data standardization is necessary for CCA analyses. Usually, the z-score transformation is adequate for this purpose (Ramette, 2007). For analysis of sequence data, the relative abundance (percentage) of
52
Huiluo Cao et al.
each OTU is often used. The WCanoImp program in the Canoco software package is used for formatting the input species (or OTU) and environment files from spreadsheets (Lepsˇ and Sˇmilauer, 2003).
5.2. CCA analysis In the Canoco software package, the Canoco for Windows 4.5 software module is used for running CCA, along with several other statistical tools. Because CCA is used to explain OTU (species) data in the context of environmental data, both the input files of the OTU data (the primary data) and environment data (the explanatory data) are needed for a CCA analysis. The Canoco for Windows program has a user-friendly interface and “help” facility, making its use for statistical analyses simpler than the console implementation. The user can follow the submenus to select desired options to carry out data processing and statistical analyses. CCA in Canoco uses the Monte Carlo permutation test for the evaluation of significance. Resulting P-values and F-ratios for the most significant variables are stored in the Log file. The data for intermediate steps and results are also stored in this Log file. Colinearity is tested and can be checked from the weighted correlation matrix stored in the Log file. Graphical presentations of the ordination diagrams (OTU-environment-sample correlation) can be viewed from the CanoDraw subprogram in Canoco for Windows.
5.3. Explanation of CCA statistical results Figure 2.5 shows example CCA analysis results using the molecular data of Beta-AOB collected from the coastal sediments of Jiaozhou Bay (Dang et al., 2010b). Figure 2.5A shows that the environmental variables in the first two CCA dimensions (CCA1 and CCA2) explained almost half (46.9%) of the total variance in the Beta-AOB (represented by the AmoA OTUs) composition and 48.7% of the cumulative variance of the BetaAOB-environment relationship. Two classes of Beta-AOB assemblages could be distinguished by CCA1, with the assemblages in Class 1 comprising sampling sites A3, A5, C4, and Y1, and the assemblages in Class 2 comprising sampling sites B2, D1, D5, and Dx. This classification pattern is highly consistent with the UniFrac community classification results (Figs. 2.1 and 2.2) (Dang et al., 2010b). The CCA analysis result also indicates that only the sediment pore water NO2–N concentration contributed significantly (P ¼ 0.028, 1000 Monte Carlo permutations) to the Beta-AOB–environment relationship, and this factor alone provided 22.5% of the total CCA explanatory power. Although the contribution of all other environmental factors was not statistically significant (P > 0.150), the combination of these variables provided additionally 73.0% of the total CCA explanatory power (Dang et al., 2010b). This CCA result indicates that the
53
Ammonia-Oxidizing Community and Anammox to Pollution
A
1.0 Sampling station
D1
CCA2—percent variation explained 22.4 %
Environmental factor
B2
Sand
Dx
A3 OrgC/OrgN Sort Salinity Y1 C4
N/P
D5 NO2-N A5
–1.0 –1.0
1.0 CCA1—percent variation explained 26.3 %
B
1.0
A5-16 A5
CCA2—percent variation explained 21.6 %
Sampling station AmoA cluster
NO3-N
Environmental factor
Nm-O
Dx D1
Nm143
C15
D5 N/P
C13
A3 Y1
B2
Nm-M
NO2-N
Salinity
Sort
C14 C4
Sand
–1.0 –1.0
1.0 CCA1—percent variation explained 64.5 %
Figure 2.5 CCA ordination plots for the first two principal dimensions of the relationship between the distribution of AmoA OTUs (A) or clusters (B) and the sediment and pore water environmental parameters in Jiaozhou Bay. Abbreviation: Nm143, Cluster 143; Nm-O, Cluster 6a; Nm-M, Cluster 6b; C13, Cluster 13; C14, Cluster 14; C15, Cluster 15 (modified from Dang et al., 2010b).
54
Huiluo Cao et al.
Jiaozhou Bay sediment Beta-AOB composition and spatial distribution may be influenced by or related to a variety of environmental factors, and the sediment pore water NO2–N concentration may be the most important environmental variable. Figure 2.5B shows the CCA correlation of the sediment Beta-AOB clusters with environmental variables in Jiaozhou Bay (Dang et al., 2010b). The first two CCA axes (CCA1 and CCA2) explained 84.7% of the total variance in Beta-AOB cluster composition and 86.1% of the cumulative variance of the Beta-AOB cluster–environment relationship. CCA1 also clearly distinguished the Beta-AOB assemblages of Class 1 from Class 2, as depicted in Fig. 2.3A. Both sediment pore water NO2–N concentration (P ¼ 0.001, 1000 Monte Carlo permutations) and sediment sand content (P ¼ 0.028, 1000 Monte Carlo permutations) contributed significantly to the Beta-AOB cluster–environment relationship, and they provided 69.6% of the total CCA explanatory power (Dang et al., 2010b). It appears that a direct link between a single sedimentological parameter and the composition and distribution of the sediment Beta-AOB community may exist in Jiaozhou Bay. The correlation of the sediment Beta-AOB assemblages with sediment pore water NO2–N (Fig. 2.5) indicates that the sediment BetaAOB may contribute to active nitrification in Jiaozhou Bay (Dang et al., 2010b). This example also demonstrates the power and flexibility of the CCA statistics that can target at different taxonomic levels (or different sequence evolutionary distances) of microbial functional group to present a more complete ecological explanation. Similar examples using CCA to analyze anammox bacterial communities could also be found in other reports (Dang et al., 2010a; Li et al., 2010a).
6. Relationships Between the Community Change and the Environments By combining all of the data and analyses mentioned above, it is possible to comprehensively explain the relationships between the community structure of aerobic and anaerobic ammonia/ammonium oxidizers and select environmental parameters. The richness, diversity of the genetic markers, the abundance of ammonia/ammonium oxidizers, and the phylogenetic lineages unique to the sampling sites may have a strong relationship with the environments. For example, the individual components of the study of Beta-AOB in Jiaozhou Bay simultaneously support that the Nitrosomonas amoA gene in the sediments of four class 1 stations was higher than that of the four class 2 stations indicating a differential distribution of BetaAOB amoA genes in different environments (Dang et al., 2010b). The community classification of ammonia oxidizers also shows both common
Ammonia-Oxidizing Community and Anammox to Pollution
55
and unique features of some sampling sites. Further, the correlation analysis indicates the potential relationships between the microbial community composition and environmental factors. As sedimentological conditions could be related to the hydrological regime such as the currents, tides, waves, upwelling, lateral transport, water mixing, and the intensity and dynamics of these activities, these factors could shed light on why the community of ammonia oxidizers differed at the different sites. Moreover, the hydrological activities affected sediment source, composition, organic matter content, pore water redox, nutrient composition and concentration, and other physicochemical, sedimentological, or geochemical factors, which could in turn affect the relationships between community structure of aerobic ammonia oxidizer and environmental parameters. In addition, other environmental features, especially the input of freshwater or some wastewater from the nearby WWTP, could also be responsible for the observed relationships. For example, the shift in the sediment Beta-AOB community structure in the Jiaozhou Bay of China might be the result of exogenous input of microorganisms and nutrients from the surrounding rivers and WWTPs (Dang et al., 2010b). Similarly, amplicons of 16S rRNA and hzo genes from the pristine South China Sea floor sediments show clearly differences between the areas affected by mariculture and polluted coastal mangrove (Li et al., 2010b), indicating that land, pollution, and wastewater-associated species of microorganisms key to nitrogen transformation processes may be important indicators for evaluating environmental health and its history. The study of all sites produced identical clusters of ammonia oxidizer genetic marker genes along a gradient of pollution from anthropogenically polluted coastal areas to the pristine South China Sea (Figs. 2.3 and 2.4). In addition, the described approach may provide also forensic evidence of past pollution even though the current chemical analysis of the sites may indicate that present environmental conditions are acceptable.
7. Conclusions Through decoding the community structure of aerobic and anaerobic ammonia/ammonium oxidizers including AOA, Beta-AOB, and anammox bacteria via constructing clone libraries of genetic markers, calculating microbial richness and diversity analysis using DOTUR, relationships between the community structure and the environmental parameters can be analyzed using the Canoco. Available information sheds light on the relationship between changes in community profiles of aerobic and anaerobic ammonia/ammonium oxidizers and the health of coastal marine environments, especially anthropogenic pollution. It may prove feasible that
56
Huiluo Cao et al.
community and composition information of aerobic and anaerobic ammonia/ammonium oxidizers are a useful bioindicator for environmental health and forensic analysis of prior pollution history.
ACKNOWLEDGMENTS This work was supported in part by grants from Agriculture, Fisheries and Conservation Department of the Hong Kong SAR Government (J.-D. G), a PhD studentship from the University of Hong Kong to Huiluo Cao and Meng Li; China National Natural Science Foundation grants 91028011, 41076091, and 40576069, China Ocean Mineral Resources R&D Association grants DYXM-115-02-2-20 and DYXM-115-02-2-6, Hi-Tech Research and Development Program of China grant 2007AA091903, Fundamental Research Funds for the Central Universities of China grant 09CX05005A, the National Qingdao Economic and Technological Development Area Science and Technology Development Project grant (2009-2-34), and Foundation of the State Key Laboratory of Heavy Oil Processing, China University of Petroleum grant SKL2010-02 to Hongyue Dang. We would like to thank Martin G. Klotz for his vision, patience, and guidance throughout this project.
REFERENCES Abell, G. C., Revill, A. T., Smith, C., Bissett, A. P., Volkman, J. K., and Robert, S. S. (2010). Archaeal ammonia oxidizers and nirS-type denitrifiers dominate sediment nitrifying and denitrifying populations in a subtropical macrotidal estuary. ISME J. 4, 286–300. Altschul, S. F., Madden, T. L., Schaffer, A. A., Zhang, J., Zhang, Z., Miller, W., and Lipman, D. J. (1997). Gapped BLAST and PSI-BLAST: A new generation of protein database search programs. Nucleic Acids Res. 25, 3389–3402. Amano, T., Yoshinaga, I., Okada, K., Yamagishi, T., Ueda, S., Obuchi, A., Sako, Y., and Suwa, Y. (2007). Detection of anammox activity and diversity of anammox bacteriarelated 16S rRNA genes in coastal marine sediment in Japan. Microbes Environ. 22, 232–242. Amano, T., Yoshinaga, I., Yamagishi, T., Thuoc, C. V., Thu, P. T., Ueda, S., Kato, K., Sako, Y., and Suwa, Y. (2011). Contribution of anammox bacterial to benthic nitrogen cycling in a mangrove forest and shrimp ponds, Haiphong, Vietnam. Microbes Environ. 26, 1–6. Arp, D. J., Chain, P. S., and Klotz, M. G. (2007). The impact of genome analyses on our understanding of ammonia-oxidizing bacteria. Annu. Rev. Microbiol. 61, 503–528. Avrahami, S., Conrad, R., and Braker, G. (2002). Effect of soil ammonium concentration on N2O release and on the community structure of ammonia oxidizers and denitrifiers. Appl. Environ. Microbiol. 68, 5685–5692. Avrahami, S., Liesack, W., and Conrad, R. (2003). Effects of temperature and fertilizer on activity and community structure of soil ammonia oxidizers. Environ. Microbiol. 5, 691–705. Bartossek, R., Nicol, G. W., Lanzen, A., Klenk, H. P., and Schleper, C. (2010). Homologues of nitrite reductases in ammonia-oxidizing archaea: Diversity and genomic context. Environ. Microbiol. 12, 1075–1088. Beman, J. M., and Francis, C. A. (2006). Diversity of ammonia-oxidizing archaea and bacteria in the sediments of a hypernutrified subtropical estuary: Bahia del Tobari. Mexico. Appl. Environ. Microbiol. 72, 7767–7777.
Ammonia-Oxidizing Community and Anammox to Pollution
57
Beman, J. M., Popp, B. N., and Francis, C. A. (2008). Molecular and biogeochemical evidence for ammonia oxidation by marine Crenarchaeota in the Gulf of California. ISME J. 2, 429–441. Cantera, J. J., and Stein, L. Y. (2007). Molecular diversity of nitrite reductase genes (nirK) in nitrifying bacteria. Environ. Microbiol. 9, 765–776. Cao, H., Li, M., Hong, Y.-G. and Gu, J.-D. (2011). Diversity and abundance of ammoniaoxidizing archaea (AOA) and bacteria (AOB) in polluted mangrove sediment. Syst. Appl. Microbiol. (accepted). Chain, P., Lamerdin, J., Larimer, F., Regala, W., Lao, V., Land, M., Hauser, L., Hooper, A., Klotz, M., Norton, J., Sayavedra-Soto, L., Arciero, D., et al. (2003). Complete genome sequence of the ammonia-oxidizing bacterium and obligate chemolithoautotroph Nitrosomonas europaea. J. Bacteriol. 185, 2759–2773. Dale, O. R., Tobias, C. R., and Song, B. (2009). Biogeographical distribution of diverse anaerobic ammonium oxidizing (anammox) bacteria in Cape Fear River Estuary. Environ. Microbiol. 11, 1194–1207. Dang, H., Ren, J., Song, L., Song, S., and An, L. (2008a). Dominant chloramphenicolresistant bacteria and resistance genes in coastal marine waters of Jiaozhou Bay, China. World J. Microbiol. Biotechnol. 24, 209–217. Dang, H., Ren, J., Song, L., Sun, S., and An, L. (2008b). Diverse tetracycline resistant bacteria and resistance genes from coastal waters of Jiaozhou Bay. Microb. Ecol. 55, 237–246. Dang, H., Zhang, X., Sun, J., Li, T., Zhang, Z., and Yang, G. (2008c). Diversity and spatial distribution of sediment ammonia-oxidizing crenarchaeota in response to estuarine and environmental gradients in the Changjiang Estuary and East China Sea. Microbiology 154, 2084–2095. Dang, H., Li, J., Zhang, X., Li, T., Tian, F., and Jin, W. (2009a). Diversity and spatial distribution of amoA-encoding archaea in the deep-sea sediments of the tropical West Pacific Continental Margin. J. Appl. Microbiol. 106, 1482–1493. Dang, H., Luan, X., Zhao, J., and Li, J. (2009b). Diverse and novel nifH and nifH-like gene sequences in the deep-sea methane seep sediments of the Okhotsk Sea. Appl. Environ. Microbiol. 75, 2238–2245. Dang, H., Wang, C., Li, J., Li, T., Tian, F., Jin, W., Ding, Y., and Zhang, Z. (2009c). Diversity and distribution of sediment nirS-encoding bacterial assemblages in response to environmental gradients in the eutrophied Jiaozhou Bay, China. Microb. Ecol. 58, 161–169. Dang, H., Chen, R., Wang, L., Guo, L., Chen, P., Tang, Z., Tian, F., Li, S., and Klotz, M. G. (2010a). Environmental factors shape sediment anammox bacterial communities in hypernutrified Jiaozhou Bay, China. Appl. Environ. Microbiol. 76, 7036–7047. Dang, H., Li, J., Chen, R., Wang, L., Guo, L., Zhang, Z., and Klotz, M. G. (2010b). Diversity, abundance and spatial distribution of sediment ammonia-oxidizing Betaproteobacteria in response to environmental gradients and coastal eutrophication in Jiaozhou Bay, China. Appl. Environ. Microbiol. 76, 4691–4702. Dang, H., Luan, X. W., Chen, R., Zhang, X., Guo, L., and Klotz, M. G. (2010c). Diversity, abundance and distribution of amoA-encoding archaea in deep-sea methane seep sediments of the Okhotsk Sea. FEMS Microbiol. Ecol. 72, 370–385. Erguder, T. H., Boon, N., Wittebolle, L., Marzorati, M., and Verstraete, W. (2009). Environmental factors shaping the ecological niches of ammonia-oxidizing archaea. FEMS Microbiol. Rev. 33, 855–869. Felsenstein, J. (1989). PHYLIP-Phylogeny Inference Package (version 3.2). Cladistics 5, 164–166. Francis, C. A., Roberts, K. J., Beman, J. M., Santoro, A. E., and Oakley, B. B. (2005). Ubiquity and diversity of ammonia-oxidizing archaea in water columns and sediments of the ocean. Proc. Natl. Acad. Sci. USA 102, 14683–14688.
58
Huiluo Cao et al.
Freitag, T. E., and Prosser, J. I. (2003). Community structure of ammonia-oxidizing bacteria within anoxic marine sediments. Appl. Environ. Microbiol. 69, 1359–1371. Hamady, M., Lozupone, C., and Knight, R. (2010). Fast UniFrac: Facilitating highthroughput phylogenetic analyses of microbial communities including analysis of pyrosequencing and PhyloChip data. ISME J. 4, 17–27. Head, I. M., Hiorns, W. D., Embley, T. M., McCarthy, A. J., and Saunders, J. R. (1993). The phylogeny of autotrophic ammonia-oxidizing bacteria as determined by analysis of 16S ribosomal RNA gene sequences. J. Gen. Microbiol. 139, 1147–1153. Hoshino, T., Noda, N., Tsuneda, S., Hirata, A., and Inamori, Y. (2001). Direct detection by in situ PCR of the amoA gene in biofilm resulting from a nitrogen removal process. Appl. Environ. Microbiol. 67, 5261–5266. Jetten, M. S., Niftrik, L., Strous, M., Kartal, B., Keltjens, J. T., and Op den Camp, H. J. (2009). Biochemistry and molecular biology of anammox bacteria. Crit. Rev. Biochem. Mol. Biol. 44, 65–84. Junier, P., Kim, O. S., Molina, V., Limburg, P., Junier, T., Imhoff, J. F., and Witzel, K. P. (2008). Comparative in silico analysis of PCR primers suited for diagnostics and cloning of ammonia monooxygenase genes from ammonia-oxidizing bacteria. FEMS Microbiol. Ecol. 64, 141–152. Junier, P., Molina, V., Dorador, C., Hadas, O., Kim, O. S., Junier, T., Witzel, J. P., and Imhoff, J. F. (2010). Phylogenetic and functional marker genes to study ammoniaoxidizing microorganisms (AOM) in the environment. Appl. Microbiol. Biotechnol. 85, 425–440. Juretschko, S., Timmermann, G., Schmid, M., Schleifer, K. H., Pommerening-Roser, A., Koops, H. P., and Wagner, M. (1998). Combined molecular and conventional analyses of nitrifying bacterium diversity in activated sludge: Nitrosococcus mobilis and Nitrospiralike bacteria as dominant populations. Appl. Environ. Microbiol. 64, 3042–3051. Kartal, B., Geerts, W., and Jetten, M. S. (2011). Cultivation, detection, and ecophysiology of anaerobic ammonium-oxidizing bacteria. In “Methods in Enzymology, Vol. 486, Part A,” (M. G. Klotz, ed.), pp. 89–108. Academic Press (Elsevier Inc.), Oxford. Klotz, M. G., and Norton, J. M. (1995). Sequence of an ammonia monooxygenase subunit A-encoding gene from Nitrosospira sp. NpAV. Gene 163, 159–160. Ko¨nneke, M., Bernhard, A. E., de la Torre, J. R., Walker, C. B., Waterbury, J. B., and Stahl, D. A. (2005). Isolation of an autotrophic ammonia-oxidizing marine archaeon. Nature 437, 543–546. Kowalchuk, G. A., and Stephen, J. R. (2001). Ammonia-oxidizing bacteria: A model for molecular microbial ecology. Annu. Rev. Microbiol. 55, 485–529. Larkin, M. A., Blackshields, G., Brown, N. P., Chenna, R., McGettigan, P. A., McWilliam, H., Valentin, F., Wallace, I. M., Wilm, A., Lopez, R., Thompson, J. D., Gibson, T. J., et al. (2007). Clustal W and Clustal X version 2.0. Bioinformatics 23, 2947–2948. Lepsˇ, J., and Sˇmilauer, P. (2003). Multivariate Analysis of Ecological Data using CANOCO. Cambridge University Press, New York. Li, H., Chen, S., Mu, B.-Z., and Gu, J.-D. (2010a). Molecular detection of anaerobic ammonium-oxidizing (anammox) bacteria in high temperature petroleum reservoirs. Microb. Ecol. 60, 771–783. Li, M., Hong, Y., Klotz, M. G., and Gu, J.-D. (2010b). A comparison of primer sets for detecting 16S rRNA and hydrazine oxidoreductase genes of anaerobic ammoniumoxidizing bacteria in marine sediments. Appl. Microbiol. Biotechnol. 86, 781–790. Li, H., Mu, B.-Z., Jiang, Y., and Gu, J.-D. (2011a). Production processes affected prokaryotic amoA gene abundance and distribution in high-temperature petroleum reservoirs. Geomicrobiol. J. (in press).
Ammonia-Oxidizing Community and Anammox to Pollution
59
Li, M., Cao, H., Hong, Y.-G., and Gu, J.-D. (2011b). Spatial distribution and abundance of ammonia-oxidizing archaea (AOA) and ammonia-oxidizing bacteria (AOB) in mangrove sediments. Appl. Microbiol. Biotechnol. 98, 1243–1254. Li, M., Cao, H., Hong, Y.-G., and Gu, J.-D. (2011c). Seasonal dynamics of anammox bacteria in estuarial sediments of Mai Po Nature Reserve revealed by 16S rRNA and hzo genes analysis. Microbes Environ. 26, 15–22. Liu, S., Zhang, J., Chen, H., and Zhang, G. (2005). Factors influencing nutrient dynamics in the eutrophic Jiaozhou Bay, North China. Prog. Oceanogr. 66, 66–85. Lozupone, C., and Knight, R. (2005). UniFrac: A new phylogenetic method for comparing microbial communities. Appl. Environ. Microbiol. 71, 8228–8235. Lozupone, C., Hamady, M., and Knight, R. (2006). UniFrac—An online tool for comparing microbial community diversity in a phylogenetic context. BMC Bioinform. 7, 371. Lozupone, C. A., Hamady, M., Kelley, S. T., and Knight, R. (2007). Quantitative and qualitative beta diversity measures lead to different insights into factors that structure microbial communities. Appl. Environ. Microbiol. 73, 1576–1585. Ludwig, W., Strunk, O., Westram, R., Richter, L., Meier, H., Yadhukumar, Buchner, A., Lai, T., Steppi, S., Jobb, G., Forster, W., Brettske, I., et al. (2004). ARB: A software environment for sequence data. Nucleic Acids Res. 32, 1363–1371. McTavish, H., LaQuier, F., Aciero, D., Logan, M., Mundfrom, G., Fuchs, J. A., and Hooper, A. B. (1993). Multiple copies of genes coding for electron transport proteins in the bacterium Nitrosomonas europaea. J. Bacteriol. 175, 2445–2447. Mincer, T. J., Church, M. J., Taylor, L. T., Preston, C., Karl, D. M., and DeLong, E. F. (2007). Quantitative distribution of presumptive archaeal and bacterial nitrifiers in Monterey Bay and the North Pacific Subtropical Gyre. Environ. Microbiol. 9, 1162–1175. Moin, N. S., Nelson, K. A., Bush, A., and Bernhard, A. E. (2009). Distribution and diversity of archaeal and bacterial ammonia oxidizers in salt marsh sediments. Appl. Environ. Microbiol. 75, 7461–7468. Mosier, A. C., and Francis, C. A. (2008). Relative abundance and diversity of ammoniaoxidizing archaea and bacteria in the San Francisco Bay estuary. Environ. Microbiol. 10, 3002–3016. Mullins, T. D., Britschgi, T. B., Krest, R. L., and Giovannoni, S. J. (1995). Genetic comparisons reveal the same unknown bacterial lineages in Atlantic and Pacific bacterioplankton communities. Limnol. Oceanogr. 40, 148–158. Nakajima, J., Sakka, M., Kimura, T., and Sakka, K. (2008). Detection of anaerobic ammoniumoxidizing bacteria in Ago Bay sediments. Biosci. Biotechnol. Biochem. 72, 2195–2198. Nicol, G. W., and Schleper, C. (2006). Ammonia-oxidising Crenarchaeota: Important players in the nitrogen cycle? Trends Microbiol. 14, 207–212. Nicolaisen, M. H., and Ramsing, N. B. (2002). Denaturing gradient gel electrophoresis (DGGE) approaches to study the diversity of ammonia-oxidizing bacteria. J. Microbiol. Methods 50, 189–203. Nold, S. C., Zhou, J., Devol, A. H., and Tiedje, J. M. (2000). Pacific Northwest marine sediments contain ammonia-oxidizing bacteria in the beta subdivision of the Proteobacteria. Appl. Environ. Microbiol. 66, 4532–4535. Norton, J. M. (2011). The diversity and environmental distribution of ammonia-oxidizing bacteria. In “Nitrification,” (B. B. Ward, M. G. Klotz, and D. J. Arp, eds.), pp. 27–55. ASM Press, Washington, DC. Norton, J. M., Low, J. M., and Klotz, M. G. (1996). The gene encoding ammonia monooxygenase subunit A exists in three nearly identical copies in Nitrosospira sp. NpAV. FEMS Microbiol. Lett. 139, 181–188. Norton, J. M., Alzerreca, J. J., Suwa, Y., and Klotz, M. G. (2002). Diversity of ammonia monooxygenase operon in autotrophic ammonia-oxidizing bacteria. Arch. Microbiol. 177, 139–149.
60
Huiluo Cao et al.
Norton, J. M., Klotz, M. G., Stein, L. Y., Arp, D. J., Bottomley, P. J., Chain, P. S., Hauser, L. J., Land, M. L., Larimer, F. W., Shin, M. W., and Starkenburg, S. R. (2008). Complete genome sequence of Nitrosospira multiformis, an ammonia-oxidizing bacterium from the soil environment. Appl. Environ. Microbiol. 74, 3559–3572. Offre, P., Nicol, G. W., and Prosser, J. I. (2010). Community profiling and quantification of putative autotrophic thaumarchaeal communities in environmental samples. Environ. Microbiol. Reports 10.1111/j.1758-2229.2010.00217.x. Okano, Y., Hristova, K. R., Leutenegger, C. M., Jackson, L. E., Denison, R. F., Gebreyesus, B., Lebauer, D., and Scow, K. M. (2004). Application of real-time PCR to study effects of ammonium on population size of ammonia-oxidizing bacteria in soil. Appl. Environ. Microbiol. 70, 1008–1016. Park, H. D., Wells, G. F., Bae, H., Criddle, C. S., and Francis, C. A. (2006). Occurrence of ammonia-oxidizing archaea in wastewater treatment plant bioreactors. Appl. Environ. Microbiol. 72, 5643–5647. Park, S. J., Park, B. J., and Rhee, S. K. (2008). Comparative analysis of archaeal 16S rRNA and amoA genes to estimate the abundance and diversity of ammonia-oxidizing archaea in marine sediments. Extremophiles 12, 605–615. Penton, C. R., Devol, A. H., and Tiedje, J. M. (2006). Molecular evidence for the broad distribution of anaerobic ammonium-oxidizing bacteria in freshwater and marine sediments. Appl. Environ. Microbiol. 72, 6829–6832. Prosser, J. (2010). Replicate or lie. Environ. Microbiol. 12, 1806–1810. Prosser, J. I., and Nicol, G. W. (2008). Relative contributions of archaea and bacteria to aerobic ammonia oxidation in the environment. Environ. Microbiol. 10, 2931–2941. Purkhold, U., Pommerening-Roser, A., Juretschko, S., Schmid, M. C., Koops, H. P., and Wagner, M. (2000). Phylogeny of all recognized species of ammonia oxidizers based on comparative 16S rRNA and amoA sequence analysis: Implications for molecular diversity surveys. Appl. Environ. Microbiol. 66, 5368–5382. Purkhold, U., Wagner, M., Timmermann, G., Pommerening-Roser, A., and Koops, H. P. (2003). 16S rRNA and amoA-based phylogeny of 12 novel betaproteobacterial ammonia-oxidizing isolates: Extension of the dataset and proposal of a new lineage within the nitrosomonads. Int. J. Syst. Evol. Microbiol. 53, 1485–1494. Ramette, A. (2007). Multivariate analyses in microbial ecology. FEMS Microbiol. Ecol. 62, 142–160. Ronquist, F., and Huelsenbeck, J. P. (2003). MrBayes 3: Bayesian phylogenetic inference under mixed models. Bioinformatics 19, 1572–1574. Rotthauwe, J. H., Witzel, K. P., and Liesack, W. (1997). The ammonia monooxygenase structural gene amoA as a functional marker: Molecular fine-scale analysis of natural ammonia-oxidizing populations. Appl. Environ. Microbiol. 63, 4704–4712. Sahan, E., and Muyzer, G. (2008). Diversity and spatio-temporal distribution of ammoniaoxidizing Archaea and Bacteria in sediments of the Westerschelde estuary. FEMS Microbiol. Ecol. 64, 175–186. Santoro, A. E., Francis, C. A., de Sieyes, N. R., and Boehm, A. B. (2008). Shifts in the relative abundance of ammonia-oxidizing bacteria and archaea across physicochemical gradients in a subterranean estuary. Environ. Microbiol. 10, 1068–1079. Satoh, H., Nakamura, Y., and Okabe, S. (2007). Influences of infaunal burrows on the community structure and activity of ammonia-oxidizing bacteria in intertidal sediments. Appl. Environ. Microbiol. 73, 1341–1348. Schleper, C., and Nicol, G. W. (2010). Ammonia oxidizing archaea—Genomes, physiology and ecology. In “Advances in Microbial Physiology, Vol. 57,” (R. K. Poole, ed.), pp. 1–41. Academic Press, Oxford. Schloss, P. D. (2008). Evaluating different approaches that test whether microbial communities have the same structure. ISME J. 2, 265–275.
Ammonia-Oxidizing Community and Anammox to Pollution
61
Schloss, P. D., and Handelsman, J. (2005). Introducing DOTUR, a computer program for defining operational taxonomic units and estimating species richness. Appl. Environ. Microbiol. 71, 1501–1506. Schmid, M. C., Maas, B., Dapena, A., van de Pas-Schoonen, K., van de Vossenberg, J., Kartal, B., van Niftrik, L., Schmidt, I., Cirpus, I., Kuenen, J. G., Wagner, M., Sinninghe Damste, J. S., et al. (2005). Biomarkers for in situ detection of anaerobic ammoniumoxidizing (anammox) bacteria. Appl. Environ. Microbiol. 71, 1677–1684. Schmid, M. C., Risgaard-Petersen, N., van de Vossenberg, J., Kuypers, M. M., Lavik, G., Petersen, J., Hulth, S., Thamdrup, B., Canfield, D., Dalsgaard, T., Rysgaard, S., Sejr, M. K., et al. (2007). Anaerobic ammonium-oxidizing bacteria in marine environments: Widespread occurrence but low diversity. Environ. Microbiol. 9, 1476–1484. Schmid, M. C., Hooper, A. B., Klotz, M. G., Pommerening-Roeser, A., op den Camp, H. J. M., and Jetten, M. S. M. (2008). Environmental detection of the octaheme cyctochrome c hydroxylamine/hydrazine oxidoreductase genes of aerobic and anaerobic ammonium-oxidizing bacteria. Environ. Microbiol. 10, 3140–3149. Sekido, T., Bodelier, P. L. E., Shoji, T., Suwa, Y., and Laanbroek, H. J. (2008). Limitations of the use of group-specific primers in real-time PCR as appear from quantitative analyses of closely related ammonia-oxidising species. Water Res. 42, 1093–1101. Spang, A., Hatzenpichler, R., Brochier-Armanet, C., Rattei, T., Tischler, P., Spieck, E., Streit, W., Stahl, D. A., Wagner, M., and Schleper, C. (2010). Distinct gene set in two different lineages of ammonia-oxidizing archaea supports the phylum Thaumarchaeota. Trends Microbiol. 18, 331–340. Stein, L. Y., Arp, D. J., Berube, P. M., Chain, P. S., Hauser, L., Jetten, M. S., Klotz, M. G., Larimer, F. W., Norton, J. M., Op den Camp, H. J., Shin, M., and Wei, X. (2007). Whole-genome analysis of the ammonia-oxidizing bacterium, Nitrosomonas eutropha C91: Implications for niche adaptation. Environ. Microbiol. 9, 2993–3007. Stephen, J. R., McCaig, A. E., Smith, Z., Prosser, J. I., and Embley, T. M. (1996). Molecular diversity of soil and marine 16S rRNA gene sequences related to betasubgroup ammonia-oxidizing bacteria. Appl. Environ. Microbiol. 62, 4147–4154. Strous, M., Fuerst, J. A., Kramer, E. H., Logemann, S., Muyzer, G., van de PasSchoonen, K. T., Webb, R., Kuenen, J. G., and Jetten, M. S. (1999). Missing lithotroph identified as new planctomycete. Nature 400, 446–449. Tamura, K., Dudley, J., Nei, M., and Kumar, S. (2007). MEGA4: Molecular Evolutionary Genetics Analysis (MEGA) software version 4.0. Mol. Biol. Evol. 24, 1596–1599. ter Braak, C. J. F., and Smilauer, P. (2002). CANOCO Reference Manual and CanoDraw for Windows User’s Guide: Software for Canonical Community Ordination (Version 4.5) Microcomputer Power, Ithaca, NY, USA. Tourna, M., Freitag, T. E., Nicol, G. W., and Prosser, J. I. (2008). Growth, activity and temperature responses of ammonia-oxidizing archaea and bacteria in soil microcosms. Environ. Microbiol. 10, 1357–1364. Treusch, A. H., Leininger, S., Kletzin, A., Schuster, S. C., Klenk, H. P., and Schleper, C. (2005). Novel genes for nitrite reductase and Amo-related proteins indicate a role of uncultivated mesophilic crenarchaeota in nitrogen cycling. Environ. Microbiol. 7, 1985–1995. Urakawa, H., Tajima, Y., Numata, Y., and Tsuneda, S. (2008). Low temperature decreases the phylogenetic diversity of ammonia-oxidizing archaea and bacteria in aquarium biofiltration systems. Appl. Environ. Microbiol. 74, 894–900. Urakawa, H., Martens-Habbena, W., and Stahl, D. A. (2010). High abundance of ammoniaoxidizing Archaea in coastal waters, determined using a modified DNA extraction method. Appl. Environ. Microbiol. 76, 2129–2135.
62
Huiluo Cao et al.
van de Graaf, A. A., Mulder, A., de Bruijn, P., Jetten, M. S., Robertson, L. A., and Kuenen, J. G. (1995). Anaerobic oxidation of ammonium is a biologically mediated process. Appl. Environ. Microbiol. 61, 1246–1251. Venter, J. C., Remington, K., Heidelberg, J. F., Halpern, A. L., Rusch, D., Eisen, J. A., Wu, D., Paulsen, I., Nelson, K. E., Nelson, W., Fouts, D. E., Levy, S., et al. (2004). Environmental genome shotgun sequencing of the Sargasso Sea. Science 304, 66–74. Ward, B. B. (2005). Molecular approaches to marine microbial ecology and the marine nitrogen cycle. Annu. Rev. Earth Planet. Sci. 33, 301–333. Webster, G., Embley, T. M., and Prosser, J. I. (2002). Grassland management regimens reduce small-scale heterogeneity and species diversity of beta-proteobacterial ammonia oxidizer populations. Appl. Environ. Microbiol. 68, 20–30. Woebken, D., Lam, P., Kuypers, M. M., Naqvi, S. W., Kartal, B., Strous, M., Jetten, M. S. M., Fuchs, B. M., and Amann, R. (2008). A microdiversity study of anammox bacteria reveals a novel Candidatus Scalindua phylotype in marine oxygen minimum zones. Environ. Microbiol. 10, 3106–3119. Wuchter, C., Abbas, B., Coolen, M. J., Herfort, L., van Bleijswijk, J., Timmers, P., Strous, M., Teira, E., Herndl, G. J., Middelburg, J. J., Schouten, S., and Sinninghe Damste, J. S. (2006). Archaeal nitrification in the ocean. Proc. Natl. Acad. Sci. USA 103, 12317–12322. Zhang, Y., Ruan, X. H., Op den Camp, H. J., Smits, T. J., Jetten, M. S. M., and Schmid, M. C. (2007). Diversity and abundance of aerobic and anaerobic ammoniumoxidizing bacteria in freshwater sediments of the Xinyi River (China). Environ. Microbiol. 9, 2375–2382. Zhang, L.-M., Offre, P. R., He, J.-Z., Verhamme, D. T., Nicol, G. W., and Prosser, J. I. (2010). Autotrophic ammonia oxidation by soil thaumarchaea. Proc. Natl. Acad. Sci. USA 107, 17240–17245.
C H A P T E R
T H R E E
Molecular and Stable Isotope Methods to Detect and Measure Anaerobic Ammonium Oxidation (Anammox) in Aquatic Ecosystems Bongkeun Song* and Craig R. Tobias† Contents 1. Introduction 2. Molecular Methods to Detect and Quantify Anammox Bacteria in Environmental Samples 2.1. PCR protocols of 16S rRNA gene detection 2.2. PCR protocol of hzo gene detection 2.3. Quantitative PCR of anammox bacteria 3. Stable Isotope Methods to Measure Anammox Rates in Environmental Samples 3.1. Sediment slurries and whole water incubations 3.2. Working toward in situ rates—Whole cores and ambient O2 Acknowledgments References
64 66 68 71 74 77 78 82 84 84
Abstract Numerous microbial processes transform nitrogen (N) but three anaerobic respiratory pathways remove fixed N from the environment: denitrification (nitrate conversion to N2), anaerobic ammonium oxidation (anammox; ammonium plus nitrite conversion to N2), and nitrite dependent methane oxidation (nitrite conversion to N2). Nitrification becomes a part of N removal processes as a supplier of nitrite (NO2) and nitrate (NO3) to anammox and denitrifying bacteria in anoxic water and sediments. It is important to detect and measure anammox and denitrification to understand biogeochemical N cycle and to estimate N removal potential in aquatic ecosystems. Denitrification has been extensively studied in many ecosystems to examine diversity and spatial and temporal dynamics of denitrifying communities as well as to understand its * Department of Biology and Marine Biology, University of North Carolina Wilmington, North Carolina, USA Department of Marine Sciences, University of Connecticut, Groton, Connecticut, USA
{
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00003-8
#
2011 Elsevier Inc. All rights reserved.
63
64
Bongkeun Song and Craig R. Tobias
importance in regional and global N cycles. Nitrite dependent methane oxidation was recently discovered as a new pathway of removing fixed N and just started to examine its importance in different ecosystems. Anammox has undergone limited examination, although the number of studies is continuously increasing. There are many questions remaining in order to understand the factors controlling activities and community structures of anammox bacteria in different ecosystems. This chapter reviews both molecular and stable isotope methods to detect and measure anammox in anoxic sediments and water.
1. Introduction Microbial processes obviously have a great impact on biogeochemical N cycling in aquatic ecosystems. Organic N is decomposed by microbes to NH4þ (ammonification), which can be taken up by primary producers or converted to NO2 and then NO3 by nitrification. Nitrate can be assimilated or dissimilated in denitrification, anammox, and dissimilatory NO3 reduction to NH4þ (DNRA) depending on the prevailing conditions (Fig. 3.1). Recently, denitrifying anaerobic methane oxidation (DAMO) was discovered as a new pathway of converting NO2 to N2 (Ettwig et al., 2010). Among these processes, only denitrification, anammox, and DAMO remove fixed N from the environment. Denitrification typically removes fixed N by reducing NO3 to N2 or N2O while consuming available organic carbon. These N gases produced during denitrification are emitted
Atmosphere N2 / N2O River input ON, NO3–, NH+ 4
To coastal Ocean
NH4+
ON
NH4+
Mineralization
NO3– ANAMMOX Denitrification NO2–
flux
flux
Water
NO–3
Nitrification Sediment
Figure 3.1 Biogeochemical N cycle in rivers and estuaries.
Molecular and Stable Isotope Analysis of ANAMMOX
65
to the atmosphere (Fig. 3.1). Denitrification rates are influenced by labile organic carbon and nitrate availability, both of which can vary spatially within an estuary and/or through the sediment profile (Cornwell et al., 1999; Tobias et al., 2001). Direct denitrification (fueled by water column NO3) and “coupled denitrification” (fueled by NO3 produced by nitrification) constitute major pathways for N removal. High rates of coupled denitrification often accompany high mineralization rates, if sufficient oxygen is available for nitrification (Seitzinger, 1994; Seitzinger and Giblin, 1996). Increased NO3 loading to estuaries (i.e., increased NO3 concentration) influences total denitrification (direct plus coupled) rates, and the partitioning between direct and coupled pathways responds primarily to changes in water column NO3 concentrations (Nedwell et al., 1999; Seitzinger et al., 2006). Changing patterns of salinity can also exert influences on denitrification through nitrification as well as by sulfide inhibition through direct impacts on the denitrifying community composition (Srenson, 1987). High salinities are coincident with decreased diversity in denitrifying communities (Yoshie et al., 2004). Abundance of denitrifiers decreased along the salinity gradient at the Colne River estuary and had a significant correlation with denitrification rates (Dong et al., 2009). Denitrifying bacteria have been extensively studied to understand the correlation between structures and functions of the communities under various environmental perturbations. Anammox bacteria, however, have not been examined to determine these types of correlations in these environments even though they have a significant role in the global N cycle. In addition, DAMO was recently discovered as a new pathway in N cycle and just started to explore in freshwater ecosystems (Ettwig et al., 2009, 2010; Hu et al., 2009; Raghoebarsing et al., 2006). Anammox is a recently identified microbial process involved in N removal by producing N2 while oxidizing NH4þ coupled to NO2 reduction under anoxic conditions (van de Graaf et al., 1995; Fig. 3.1). It has been shown to be an important N remover in marine environments (e.g., Dale et al., 2009; Engstro¨m et al., 2005; Hietanen and Kuparinen, 2008; Rich et al., 2008; Risgaard-Petersen et al., 2004a; Thamdrup and Dalsgaard, 2002). Anammox contribution to total N2 production is varied depending on the ecosystem. Trimmer and Nicholls (2009) reported 33–65% of N2 produced by anammox in the continental shelf and slope sediments in the North Atlantic. Although it is not yet a clear controlling factor of anammox in sediments, increased water depth offshore related to organic carbon availability is one factor that supports higher anammox contribution to total N2 production as denitrification becomes limited (Dalsgaard et al., 2005; Engstro¨m et al., 2005; Thamdrup and Dalsgaard, 2002). Meyer et al. (2005) reported strong correlations between anammox rates and the production of NO2 by nitrification and denitrification in the Logan and Albert River sediments. Ammonia oxidation and dissimilatory nitrate
66
Bongkeun Song and Craig R. Tobias
reduction were proposed to provide NO2 to anammox in the Peruvian oxygen minimum zone where denitrification was not detectable (Lam et al., 2009). The microbial interactions among anammox, denitrification, and nitrification appear to be either mutualistic or competitive. In addition, the reduction of manganese (Mn) and iron (Fe) oxides by oxidizing organic matters and high amounts of H2S are considered to create favorable conditions for anammox because both metal reduction and sulfide toxicity limit denitrification (Engstro¨m et al., 2005; Hanning et al., 2007). Thus, the environmental parameters such as the availabilities of DOC, NH4þ, NO2, Fe, and Mn are considered to have impacts on anammox rates in anoxic sediments. Since microbial N removal processes are the combined result of microbial interactions among anammox and denitrifying bacteria, it is important to measure the rates of each process as well as to detect and quantify bacteria responsible for each pathway to understand biogeochemical N cycle and the fate of N in aquatic ecosystems. Anammox bacteria and their activities without cultivation can be examined using 15N stable isotope technique, fluorescent in situ hybridization (FISH), ladderane lipid detection, and 16S rRNA or functional gene targeted polymerase chain reaction (PCR) studies. This chapter focuses on the methods of PCR and stable isotope techniques to detect and measure anammox in anoxic sediments and water.
2. Molecular Methods to Detect and Quantify Anammox Bacteria in Environmental Samples The anammox process is mediated by bacteria belonging to the new family Brocadiaceae of the phylum Planctomycetes. The first anammox bacteria were cultured as an enrichment from an effluent of a fluidized bed methanogenic reactor (Mulder et al., 1995) and named as “Candidatus Brocadia anammoxidans” (Strous et al., 1998). Additional bacteria have since been discovered from wastewater treatment systems and named “Ca. Kuenenia stuttgartiensis” (Schmid et al., 2000), “Ca. Scalindua brodae,” “Ca. Scalindua wagneri,” (Schmid et al., 2003) “Ca. Brocadia fulgida” (Kartal et al., 2008), “Ca. Anammoxoglobus propionicus” (Kartal et al., 2007b) and “Ca. Jettenia asiatica” (Quan et al., 2008). Kuypers et al. (2003) first reported marine anammox bacteria, “Ca. Scalindua sorokinii,” from the Black Sea. Since then, “Ca. Scalindua spp.” were detected from various aquatic ecosystems including marine sediments (Amano et al., 2007; Dale et al., 2009; Dang et al., 2010; Li et al., 2010b; Penton et al., 2006; Rich et al., 2008; Risgaard-Petersen et al., 2004a; Schmid et al., 2007) and anoxic water (Gala´n et al., 2009; Hamersley et al., 2007, 2009; Hanning et al., 2007; Kirkpatrick et al., 2006; Kuypers et al., 2003, 2005; Lam et al., 2007; Li et al., 2010a,b; Schubert et al., 2006; Ward et al., 2009; Woebken et al., 2007).
Molecular and Stable Isotope Analysis of ANAMMOX
67
Detection of anammox bacteria in various ecosystems showed two common features of anammox bacterial diversity and distribution. First, all the anammox bacteria are affiliated within 85% sequence similarity of 16S rRNA genes in the new family Brocadiaceae. Second, the bacteria assigned to the genera “Ca. Brocadia” and “Ca. Kuenenia” were mostly found in wastewater treatment systems and terrestrial environments while “Ca. Scalindua spp.” were mostly present in marine ecosystems (Dale et al., 2009; Humbert et al., 2010; Penton et al., 2006; Schmid et al., 2007). Detection and identification of anammox bacteria have been commonly conducted using two different molecular techniques; fluorescent in situ hybridization (FISH) and PCR amplification of anammox bacterial 16S rRNA genes. FISH is one of the standard molecular methods to detect and quantify anammox bacteria. Based on 16S rRNA sequences obtained from anammox bacteria (“Anammoxoglobus, Brocadia, Jettenia, Kuenenia, and Scalindua”), fluorescent oligo-nucleotide probes were developed with different levels of specificities (genus and species) to detect and quantify anammox bacteria in environmental samples (Pavlekovic et al., 2009; Schmid et al., 2005). PCR amplification of anammox bacterial 16S rRNA genes is an alternative molecular detection method. Several PCR methods with various primer combinations were used to detect anammox bacteria in environmental samples (e.g., Amano et al., 2007; Dale et al., 2009; Dang et al., 2010; Humbert et al., 2010; Kirkpatrick et al., 2006; Li et al., 2010b; Penton et al., 2006; Rich et al., 2008; Schmid et al., 2000, 2005; Schubert et al., 2006). PCR methods enhanced the capability of detecting anammox bacteria and examining their diversity based on the 16S rRNA gene sequences. However, the amplified PCR products must be verified with subsequent cloning and sequence analyses since non-anammox bacterial 16S rRNA genes were also amplified with the current PCR protocols. In order to overcome this limitation, the functional genes involved in anammox pathway have started to use for the detection and quantification of anammox bacteria in environmental samples. Putative cytochrome cd1-contating nitrite reductase gene (nirS) was initially targeted to detect and quantify Scalindua like organisms in the Peruvian oxygen minimum zone (Lam et al., 2009). Since the nirS genes are present in both anammox and denitrifying bacteria, it may become ambiguous to differentiate the nirS sequences of anammox bacteria from denitrifiers. Alternatively, the gene encoding hydrazine oxidation (hzo), the key step for gaining energy in the anammox pathway, was targeted to develop PCR primers and protocols for the detection of anammox (Hirsch et al., 2011; Li et al., 2010a,b; Quan et al., 2008; Schmid et al., 2008). Diversity of anammox bacteria has been examined in various environmental samples using the developed primers and protocols of hzo genes (Dang et al., 2010; Hirsch et al., 2010; Li et al., 2010a,b). Further, quantitative PCR (Q-PCR) method for the hzo gene was recently reported by Dang et al. (2010).
68
Bongkeun Song and Craig R. Tobias
2.1. PCR protocols of 16S rRNA gene detection PCR of 16S rRNA genes has widely used to detect anammox bacteria with many different combinations of primers. We selected the most specific primers and PCR conditions (Tables 3.1 and 3.2) for the detection of anammox 16S rRNA genes although sequence analysis of the amplicons is still required for verification. Direct PCR of anammox bacterial 16S rRNA genes can be conducted by following the protocols of Amx16S1 and Amx16S2 (Table 3.2). The Amx16S1 protocol with the primer combinations of Amx368F and Amx820R or Amx368F and BS820R primers was successfully used to examine anammox communities in Yodo River estuarine sediments (Amano et al., 2007). The Amx820R primer is specific for “Ca. Brocadia” and “Ca. Kuenenia” while the BS820R is for “Ca. Scalindua.” However, PCR of either primer combined with the Amx368F detected all the 16S rRNA sequences closely related to those in known 5 genera of anammox bacteria (Amano et al., 2007; Dale et al., 2009; Li et al., 2010a). Penton et al. (2006) designed the Brod541F and Brod1260R primers specific for “Ca. Scalindua” (Table 3.1) and found the presence of anammox bacteria in various freshwater and marine sediments and permafrost soils using the Amx16S2 PCR protocol (Table 3.2). This protocol was also used to examine diversity of anammox bacteria in coastal marine sediments of China (Dang et al., 2010; Li et al., 2010b). The primers and PCR conditions specific for the Planctomyctes (Tables 3.1 and 3.2) were used for anammox bacterial detection. The Pla16S1 PCR protocol utilizing the Planctomycetes specific primer Pla46F and eubaterial universal primer (1037R) targeting 23S rRNA genes was used to examine anammox communities in the oxygen minimum zones off Namibia, Peru, and in the Arabian Sea (Woebken et al., 2008). This protocol yielded partial sequences of 16S and 23S rRNA genes as well as complete sequences of the 16S–23S rRNA internal transcribed spacer (ITS), which can be used to examine microdiversity of closely related anammox bacterial phylotypes. However, specificity and sensitivity of 16S rRNA gene detection are highly dependent on the abundance of anammox bacteria in environmental samples. Among the amplicons of the Pla16S1 PCR, 0.2–48% of sequenced clones were closely related to “Ca. Scalindua” (Woebken et al., 2008). Li et al. (2010b) also showed 77% of detection specificity of anammox bacterial 16S rRNA genes using the Amx16S PCR2 protocol with costal wetland sediment. Although detection specificity of the Amx16S PCR1 protocol is not reported, this method sometimes does not yield the expected amplicons due to low abundance of anammox bacteria in environmental samples. In order to overcome these limitations, nested PCR protocols were developed by Dale et al. (2009) and Humbert et al. (2010). The Pla16S2 protocol was used for the initial PCR (Schmid et al., 2000) and the second PCR was conducted following the Amx16S1 protocol with a
Table 3.1 PCR primers for anammox bacterial 16S rRNA gene detection and quantification Primer name
Pla46F 1390R 1037R Amx368F
Target organism and gene
Planctomycetes 16S rRNA Eubacteria 16S rRNA Eubacteria 23S rRNA Anammox bacteria 16S rRNA Amx820R “Ca. Brocadia” and “Ca. Kuenenia” 16S rRNA BS820R “Ca. Scalinuda wagneri” 16S rRNA Brod541F “Ca. Scalinuda brodae” 16S rRNA Brod1260R “Ca. Scalinuda brodae” 16S rRNA AMX-808-F “Ca. Scalinuda” 16S rRNA AMX-1040-R “Ca. Scalinuda” 16S rRNA AMX-931 “Ca. Scalinuda” 16S rRNA
Orientation Sequence (50 –30 )
Reference
Forward Reverse Reverse Forward
GACTTGCATGCCTAATCC GACCGGCGGTGTGTACAA CGACAAGGAATTTCGCTAC TTCGCAATGCCCGAAAGG
Neef et al. (1998) Olsen et al. (1986) Ludwig et al. (1992) Schmid et al. (2005)
Reverse
AAAACCCCTCTACTTAGTGCCC
Schmid et al. (2005)
Reverse
TAATCCTCTATTAGT
Schmid et al. (2005)
Forward
50 -GAGCACGTAGGTGGGTTTGT-30
Penton et al. (2006)
Reverse
50 -ARCYGTAAACGATGGGCACTAA-30
Penton et al. (2006)
Forward
50 -CAGCCATGCAAACACCTGTRATA-30
Hamersley et al. (2007)
Reverse
50 -TCGCACAAGCGGTGGAGCATGTGGCTT-30 Hamersley et al. (2007)
Forward
50 -TCGCACAAGCGGTGGAGCATGTGGCTT-30 Hamersley et al. (2007)
70
Bongkeun Song and Craig R. Tobias
Table 3.2 PCR protocols for anammox bacterial 16S rRNA gene detection
Protocol
Primer combination
PCR condition
Amx16S1 Amx368F and (94 C/30 s ! 56 C/ Amx820R/ 30 s ! 72 C/ BS820R 1 min) 30 Amx16S2 Brod541F and (95 C/30 s ! 60 C/ Brod1260R 1 min ! 72 C/ 1 min) 30 Pla16S1 Pla46F and (94 C/45 s ! 58 C/ 1037R 50 s ! 72 C/ 3 min) 30 Pla16S2 Pla46F and (94 C/45 s ! 62 C/ 1390R 50 s ! 72 C/1 min 22 s) 30
PCR product length (bp) Reference
450
Amano et al. (2007)
720
Penton et al. (2006)
> 3300
Schmid et al. (2001)
1344
Schmid et al. (2000)
modification of reannealing temperature to 62 C (Humbert et al., 2010). Although this nested PCR method enhances the detection of 16S rRNA genes, specificity of anammox bacterial detection is still low. Dale et al. (2009) combined the Pla16S1 and Amx16S1 protocols to detect anammox bacteria in estuarine sediments. The initial PCR amplification was performed following the Pla16S1 PCR and the second PCR was conducted with the Amx368F and Amx820R using the Amx16S1 PCR protocol. This nested PCR method enhances both detection sensitivity and specificity of anammox 16S rRNA genes as 100% of cloned sequences were found to be closely related to the known anammox bacterial genera. This protocol was also successfully used to examine anammox communities in subterranean oil reservoirs (Li et al., 2010a) and various sediments collected from estuary, river, and deep sea (Hirsch et al., 2011). This PCR protocol was based on a distinct genomic structure of anammox bacteria from other groups in Planctomycetales (Schmid et al., 2001). Anammox bacteria possess linked 16S and 23S rRNA genes by an ITS of 450 bp. The initial PCR with the primers Pla46F and 1037R selected the bacteria carrying the linked rRNA operon, and the nested PCR reaction amplified the 16S rRNA genes from anammox bacteria. The requirement of the nested PCR reaction might be related to the abundance of anammox bacteria, the complexity of the overall microbial assemblage in the sediments, or possible reduction of PCR amplification efficiency from inhibitory substances in sediment extracts. The nested PCR method provided higher specificity and sensitivity for the detection of anammox bacteria and can be thus used for a simple and rapid detection of anammox in the environments.
Molecular and Stable Isotope Analysis of ANAMMOX
71
2.2. PCR protocol of hzo gene detection The metagenome study of “Ca. Kuenenia stuttgartiensis” enrichment cultures inferred a putative anammox pathway that has four enzymes and genes; dissimilatory nitrite reductases (NirS), hydrazine hydrolase (Hh), and hydroxylamine oxidoreductase (Hao)/hydrazine oxidase (Hzo) (Strous et al., 2006). Nitrite is reduced to nitric oxide (NO) by NirS which then reacts with NH4þ to convert hydrazine (N2H4) by Hh. Finally, hydrazine is oxidized to N2 by either Hao or Hzo (Shimamura et al., 2007). The hydroxylamine oxidoreductase (Hao) has similar enzymatic activities to the Hao found in the aerobic ammonia oxidizing bacterium Nitrosomonas europaea. Both Hao enzymes are capable of oxidizing hydroxylamine and hydrazine (Schalk et al., 2000). The sequence comparison of the hao genes between anammox bacteria and N. europaea showed very low similarity, however. At least eight genes encoding Hao-like proteins were found and proposed for hydrazine oxidation in “Ca. Kuenenia stuttgartiensis” (Strous et al., 2006). Shimamura et al. (2007) purified hydrazine oxidase (Hzo) from the anammox enrichment culture KSU-1 and showed that the enzyme catalyzed the oxidation of hydrazine but not hydroxylamine. Two copies of nearly identical genes (hzoA and hzoB) coding for Hzo were detected in the genome of KSU-1. The hzoA and hzoB genes share 77% of nucleotide sequence similarities with two putative hao genes in the genome of “Ca. Kuenenia stuttgartiensis” (GenBank accession numbers: CT573073 and CT573072). Klotz et al. (2008) reannotated eight putative hao genes to hzo genes in “Ca. Kuenenia stuttgartiensis” and differentiated them into three different clusters (hzo clusters 1–3) based on phylogenetic relationships and biochemical characteristics. The hzoA and hzoB genes in KSU-1 and two homologous genes (CT573073 and CT573072) in “Ca. Kuenenia stuttgartiensis” were grouped within hzo cluster 1 (Klotz et al., 2008; Schmid et al., 2008). In addition, several putative hzo genes associated with hzo cluster 1 are detected from bioreactors enriched with “Ca. Jettenia asiatica” (Quan et al., 2008) and “Ca. Kuenenia sp.” (Li et al., 2009). Detection of hzo genes in environmental samples was initially accomplished with many degenerate PCR primers and various PCR conditions (Schmid et al., 2008). Although the hzo genes in cluster 1 (hereafter hzo1) were detected only in anammox enrichment cultures and landfill leachate, the hzo1 genes were suggested as a proper genetic marker of anammox bacterial detection due to the ubiquitous presence in all the examined anammox bacterial enrichment cultures (Schmid et al., 2008). Li et al. (2010b) recently compared different degenerate primers (Table 3.3) and three PCR conditions (hzocl1, Ana-hzo, and hzoFR in Table 3.4) for hzo1 gene detection. The hzocl1 PCR protocol was reported to have the highest efficiency of detecting hzo1 genes. This method was successfully used to detect hzo1 genes in groundwater samples collected from subterranean oil
Table 3.3
PCR primers for hzo1 gene detection and quantification
Forward primer
hzoAB1F
Sequence 0
5 -GAAGCNAAGGCNGTAGAAAT TATCAC-30 0 hzoAB4F 5 -TTGARTGTGCATGGTCTAW TGAAAG-30 Hzocl1F1 50 -TGYAAGACYTGYCAYTGG-3’ Ana-hzo1F 50 -TGTGCATGGTCAATTGAAAG-30 hzoF1 50 -TGTGCATGGTCAATTGAAAG-30
Reverse primer
hzoAB1R hzoAB4R
Sequence 0
5 -CTCTTCNGCAGGTGCA TGATG-30 0 5 -GCTGACCTGACCARTCAGG-30
References
Hirsch et al. (2011) Hirsch et al. (2011)
hzocllR2 50 -ACTCCAGATRTGCTGACC-30 Schmid et al. (2008) Ana-hzo2R 50 -ACCTCTTCWGCAGGTGCAT-30 Quan et al. (2008) hzoR1 50 -CAACCTCTTCWGCAGG Li et al. (2010b) TGCATG-30
Table 3.4 PCR protocols for hzo1 gene detection
PCR setup
Primers
Template
PCR condition
hzocl1
hzocl1F1 and hzocl1R2
DNA
Ana-hzo
DNA
hzoFR
Ana-hzo 1 F and Ana-hzo2R hzo1F and hzo 2R
hzoAB1
hzo AB1F and hzo AB1R
DNA
nested hzoAB4
hzoAB4F and hzoAB4R
hzoAB1P reaction
(94 C/1 min ! 50 C/1 min 72 C/1 min 30 s) 30 (95 C/1 min ! 53 C/1 min 72 C/2 min 30 s) 30 (95 C/1 min ! 53 C/1 min 72 C/2 min 30 s) 30 (94 C/1 min ! 53 C/1 min 72 C/2 min) 35 (94 C/1 min ! 53 C/1 min 72 C/1 min) 30
DNA
PCR product length (bp) Reference
!
470
Schmid et al. (2008)
!
1033
Quan et al. (2008)
!
1034
Li et al. (2010b)
!
1550
Hirsch et al. (2011)
!
600
Hirsch et al. (2011)
74
Bongkeun Song and Craig R. Tobias
reservoirs in China (Li et al., 2010a). Hirsch et al. (2011) also evaluated different primers (Table 3.3) and PCR conditions of hzo1 gene detection in various environmental samples (Table 3.4). The hzocl1 PCR protocol with the primers hzocl1F1 and hzocl1R2 generated the expected size fragments (450 bp) with multiple amplicons of different sizes. The PCR protocol Anahzo and hzoFR (Table 3.4) yielded the expected amplicons with 1000 bp in most of environmental samples. However, the hzo1 genes in some environmental samples were not amplified, although the presence of anammox bacteria was confirmed based on 16S rRNA gene analysis (Hirsch et al., 2011). In order to enhance the hzo1 gene detection, two different sets of primers and nested PCR protocols (Tables 3.3 and 3.4) were developed by Hirsch et al. (2011). Specific amino acid sequence regions of hzo1 genes targeted by the primers in Table 3.3 are illustrated in Fig. 3.2. The hzoAB4F primer targets a region 150 bp upstream from the hzocl1F1 primer, and has a 17 bp overlap with the Ana-hzo1F primer. The hzoAB4R primer has an 8 bp overlap with the hzocl1R2 primer while hzoAB1R primer has 16 bp overlapping with Ana-hzo2R and hzoR1 primers (Fig. 3.2). The nested hzoAB4 PCR generated a single amplicon with 600 bp from all the environmental DNA samples. Cloning and sequence analysis of the amplicons confirmed 100% detection specificity of the hzo1 gene as expected. The nested PCR approach increases the sensitivity of hzo1 gene detection in different environmental samples. Conventional PCR with different primers did not amplify hzo1 genes from some of environmental samples, probably due to lower abundance of anammox bacteria than other sites. Thus, the nested PCR of hzo1 genes can increase the detection limit of anammox bacteria in variety of environments.
2.3. Quantitative PCR of anammox bacteria Quantification of anammox bacteria was mostly conducted with the FISH method as described above; however, it is limited when enumerating anammox cells in aggregates and sediments. Q-PCR of 16S rRNA genes was alternatively used to enumerate anammox bacteria in anoxic water and sediments (Table 3.5). Hamersley et al. (2007) developed a Taqman probe and primers to quantify anammox bacterial abundance in the Peruvian oxygen minimum zone. This Q-PCR method (Q-amx16S4 in Table 3.5) was used to measure anammox bacterial abundance in estuarine sediments (Dale et al., 2009). The primers were also used for SYBR green assay (Q-amx16S3 in Table 3.5) to measure anammox populations in petroleum reservoirs (Li et al., 2010b). The Amx16S1 PCR protocol was modified for SYBR green assay (Q-amx16S1 in Table 3.5) to quantify anammox cells in the Arabian oxygen minimum zone (Ward et al., 2009). The Amx16S2 protocol was also modified for Q-PCR assay (Q-amx16S2 in Table 3.5) of anammox bacteria in coastal marine sediments (Dang et al., 2010).
Molecular and Stable Isotope Analysis of ANAMMOX
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70
75
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
hzoAB1F GAMGAASSLMLKEAKAVEIITHWVPHEVYGQIGEPDNNGKVFFSGLGAKY GAMGAASSLMLKEAKAVEIITHWVPHEVYGQIGEPDNNGKVFFSGLGAKY GVIGTVSSLMVKEAKAVEIITHWVPHEVYGMPGEPDNSGKVFFSGLKAKY GVIGTVSSLMVKEAKAVEIITHWVPHEVYGMPGEPDNSGKVFFSGLKAKY KHAPVVKEDMADTHPKDARTIQQIISELTGEKIGPDNSGDVYHLGLTATY
66 66 140 66 150
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
MGYPKHENPPPYPGKYSKFWRTLPAYRYYIPDFMYNRDEVRPSNPIKGTF MGYPKHENPPPYPGKYSKFWRTLPAYRYYIPDFMYNRDEVRPSNPIKGTF MGYPKDAQRSPYPGKYSKFWKTLPAYRYYIPDYMYNRDEVRPSNPIKGTF MGYPKDAQRSPYPGKYSKFWKTLPAYRYYIPDYMYNRDEVRPSNPIKGTF T-PPKE--LLPGEGKFGKLFSFLPLMRWYDPDHYYT-----PNQAIGGEF
116 116 190 116 192
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
QLEQCIACHSVMTPGIVRDYKKSAHSRAEPNPTGCDTCHGNNHQKLTMPS QLEQCIACHSVMTPGIVRDYKKSAHSRAEPNPTGCDTCHGNNHQKLTMPS KLEQCVACHSVMTPGIVRDYNKSAHSKAEPAPTGCDTCHGNNHQKLTMPS KLEQCVACHSVMTPGIVRDYNKSAHSKAEPAPTGCDTCHGNNHQKLTMPS THGECLMCHTIQTPGIVAQWKKSKHAAVEQ-VVGCDKCHGNNHQQLYMPS
166 166 240 166 241
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
hzoAB4F/Ana-hzo1F SKACGTSECHETQYSEQGQGGIGSHASCSSFAQIECAWSIERPPGDTAGC 216 SKACGTSECHETQYSEQGQGGIGSHASCSSFAQIECAWSIERPPGDTAGC 216 SKACGTAECHETQYNEQGQGGIGSHASCSSFAQVECAWSIERPPGDTAGC 290 SKACGTAECHETQYNEQGQGGIGSHASCSSFAQVECAWSIERPPGDTAGC 216 WQHCG--ECHPEQKEGHRGGAMASHTYAFHVSTIEAPWQIAKPAAEVTAC 289
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
hzocl1F1 TFCHTSSEERCSTCHQRHQFDPKVARRAEQCKTCHWGKDHRDWEAYDIGL TFCHTSSEERCSTCHQRHQFDPKVARRAEQCKTCHWGKDHRDWEAYDIGL TFCHTSPEERCSTCHQRHQFDPAVARRSEQCKTCHWGKDHRDWEAYDIGL TFCHTSPEERCSTCHQRHQFDPAVARRSEQCKTCHWGKDHRDWEAYDIGL ATCHGIAENRCDGCHTRHDFSLAEARKPNNCGICHTGLDHYEYEMYRESY
266 266 340 266 339
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
HGVVYQVNKWDPKQFDWDKKLADADYVGPTCQYCHMRGGHHNVQRFSTVY HGVVYQVNKWDPKQFDWDKKLADADYVGPTCQYCHMRGGHHNVQRFSTVY HGTVYQVNKWDTEQFDFSKKLSDADYVGPTCQYCHMRGGHHNVQRASIVY HGTVYQVNKWDTEQFDFSKKLSDADYVGPTCQYCHMRGGHHNVQRASIVY HGMIYES---EQHTWDWTKPMKPENYKTPTCAYCHMRDGEHNAQKFSTVN
316 316 390 316 386
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
TSMGMSMADRGAPIWKEKRDRWASVCDDCHSPRFAKENLQALDESVKDAG TSMGMSMADRGAPIWKEKRDRWASVCDDCHSPRFAKENLQALDESVKDAG TSMGMSMADRGAPLWKEKRDRWVSICDDCHSPRFARENLQAMDESVKDAS TSMGMSMADRGAPLWKEKRDRWVSICDDCHSPRFARENLQAMDESVKDAS SHMGTSLVDRGAPKYKEARQSWINTCKGCHSPRFAADQLEAMDEAIKVSF
366 366 440 366 436
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
hzoAB4R/hzocl1R2 LKYRETFKVAEDLLKDGVADPMPKDLAPDWSGQHIWSLKIGAYHDGPEYG LKYRETFKVAEDLLKDGVADPMPKDLAPDWSGQHIWSLKIGAYHDGPEYG LKYRETFKVAEDLLIDGVLDPMPKDLCPDWSGQHIWSLKIGAYHDGEAYG LKYRETFKVAEDLLIDGVLDPMPKDLCPDWSGQHIWSLKIGAYHDGEAYG TKWREAMKIVVDLYNDGMLDPMPKDLAPDYAGHYTFSL-IG---------
416 416 490 416 476
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
GKTGESGEFRMSNCSDIERLCFESVGYFQTYIYKGMAHGSWNDATYSDGS GKTGESGEFRMSNCSDIERLCFESVGYFQTYIYKGMAHGSWNDATYSDGS GTTGESGEFRMSNCTDVERLCFESVGYFQTYIYKGMAHGSWNDATYSDGS GKTGESGEFRMSNVTDVERLCFESVGYFQTYIYKGMAHGSWNDATYSDGS ------GEGRMYNVSDIERTAFEMLVYITNAVYKAMAHGAMYGATYGKGA
466 466 540 466 520
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
FGMDRWLVNVKQNASQARRLAALEKKVGISWVPESFWKTGEWLDQLTGPY FGMDRWLVNVKQNASQARRLAALEKKVGISWVPESFWKTGEWLDQLTGPY FGMDRWLVNVKQNASRARRLAALEKKVGISWQPEQFWKTGEWLDQLTGPY FGMDRWLVNVKQNASRARRLAALEKKVGISWQPEQFWKTGEWLDQLTGPY FLQDRWLIQVKAEASKLRRIRALEERVGIKHKAYDFWKHGEYTDLLLG--
516 516 590 516 568
HZO_cluster_1_BAF98481 HZO_cluster_1_BAF36963 HZO_cluster_1_CAJ71439 HZO_cluster_1_CAJ72085 HZO_cluster_2_CAJ70788
hzoAB1R/Ana-hzo2R/hzoR1 IVKNHPGKTIFDLCPDPGWLDTHHAPAEEVEYINRKLEELGMRHESHGSA IVKNHPGKTIFDLCPDPGWLDTHHAPAEEVEYINRKLEELGMRHESHGSA IVKNHPGKTIFDLCPDPGWLDTHHAPAEEVEYIERKLKELGITAGSHSAH IVKNHPGKTIFDLCPDPGWLDTHHAPAEEVEYIERKLKELGMEAGTHDVK -WKRKPGD-----------VDKAACKHEGADCLVE---------------
566 566 640 566 591
Figure 3.2 Primers targeting specific amino acid sequence regions of hzo1 genes. The primer sequences are listed in Table 3.3.
The number of anammox bacteria measured with these Q-PCR assays is a cautious estimate since non-anammox 16S rRNA genes can be amplified and counted. The primers used in the four Q-PCR protocols of 16S rRNA genes (Table 3.5) amplified not only anammox bacteria but also detected
Table 3.5
Quantitative PCR protocols for 16S rRNA and hzo1 genes
Protocol
Fluorescent Target gene dye
Q-amx16S1 16S rRNA
SYBR
Q-amx16S2 16S rRNA
SYBR
Q-amx16S3 16S rRNA
SYBR
Q-amx16S4 16S rRNA
Taqman
Q-hzoFR
hzo1 gene
SYBR
Primer combination
Probe
Amx368F and None Amx 820R Brod541F and None Brod1260R AMX-808-F and AMX1040-R AMX-808-F and AMX1040-R hzo1F and hzo2R
None
PCR condition
(94 C/15 s ! 62 C/ 1 min) 40 (95 C/5 s ! 61 C/ 20 s ! 72 C/54 s) 40 (95 C/30 s ! 55 C/ 30 s ! 72 C/ 30 s) 45 (95 C/15 s ! 60 C/ 2 min) 50
[6-FAM]AMX-931[TAMURA] None (95 C/5 s ! 56 C/ 20 s ! 72 C/ 60 s) 40
Fluorescent read temperature ( C)
PCR product length (bp) Reference
62
450
Ward et al. (2009)
72
720
Dang et al. (2010)
55
232
Li et al. (2010a)
60
232
Hamersley et al. (2007)
80
1034
Dang et al. (2010)
Molecular and Stable Isotope Analysis of ANAMMOX
77
non-anammox bacterial 16S rRNA genes, as confirmed by cloning and sequence analysis. Therefore, the Q-PCR of 16S rRNA genes may overestimate anammox bacterial abundance due to non-specific detection of both anammox and other bacteria in environmental samples. The amplified products should be cloned and sequenced to verify the detection of anammox 16S rRNA genes. In order to circumvent the issues of detection specificity, two functional genes (nirS and hzo1) were targeted to develop Q-PCR protocols. Lam et al. (2009) developed Q-PCR method of the nirS genes based on the genome sequences of “Ca. Scalindua sp. T23” and examined abundance and expression of the putative Scalindua-nirS genes in the Peruvian oxygen minimum zone. The nirS gene PCR method was tested with the DNA samples extracted from various marine sediments where “Ca. Scalindua spp.” were detected previously (Hirsch et al., 2011). But we were not able to detect the putative Scalindua-nirS genes from the tested samples. This might show some limitation of this method to detect and quantify the Scalindua-nirS genes in environmental samples. Q-PCR protocol to quantify the hzo1 genes (Q-hzoFR in Table 3.5) were recently developed by modifying the hzoFR method (Dang et al., 2010). Although this method enhances the specificity of anammox bacterial detection, the estimation of anammox cell number in sediments is still questionable. There are at least two copies of hzo1 genes found in anammox bacterial cultures, which hinder proper estimation of anammox bacterial cells in environmental samples. Dang et al. (2010) compared the 16S rRNA gene and hzo1 gene numbers measured in the same samples, but the ratio of hzo1 over 16S rRNA genes ranged from 3.7 to 45.4. This showed some issues of anammox bacterial quantification using both Q-PCR assays. Further development of Q-PCR assays targeting hzo1 gene should be conducted. In addition, the gene encoding hydrazine hydrolase (hh) can be use as an alternative genetic marker for anammox bacteria since it is a unique gene found in the genome of “Ca. Kuenenia stuttgartiensis” and Plancktomycetes KSU-1 (Shimamura et al., 2007; Strous et al., 2006).
3. Stable Isotope Methods to Measure Anammox Rates in Environmental Samples The in situ distribution of anammox substrates and products (DIN and N2) in select marine and groundwater environments in conjunction with the natural abundance d15N distribution of those fractions has been used to infer the presence of anammox (Clark et al., 2008; Fuchsman et al., 2008; Konovalov et al., 2008; Propenko et al., 2006). However, the coutilization/ production of NH4þ and NO2 in other N cycling reactions and currently insufficient information regarding isotopic fractionation factors unique to
78
Bongkeun Song and Craig R. Tobias
anammox preclude in situ estimates of actual anammox rates. Anammox rates are determined in the laboratory using 15N tracers.
3.1. Sediment slurries and whole water incubations The overwhelming majority of anammox rates reported in the literature to date are based on anaerobic incubations of water or sediment slurries spiked with 15N tracer (Table 3.6). The incubation conditions and substrate availability may deviate from in situ conditions, so the approach does not necessarily yield in situ rates. Rates using this approach should be considered “potentials” in some cases; a measure of metabolic readiness for activity under favorable conditions. Samples collected from environments that possess dissolved O2 < 10 mM but ample NH4þ and NO3/NO2 (e.g., waters or sediments collected from redox boundaries) will be most similar to the incubation conditions such that laboratory-derived rates more closely approximate in situ rates. The labeled substrate can either be 15NO3, 15NO2, or 15NH4þ. Depending on site characteristics, the labeled substrate is either added solely or in conjunction with unlabelled (14N) complimentary substrate for anammox (e.g., 15NO3 or 15NO2 þ 14NH4þ; 14NO3 or 14NO2 þ 15 NH4þ). The majority of published anammox rates have been based on the application of this tracer methodology as outlined in Thamdrup and Dalsgaard (2002) using 15NO3 tracer and in Trimmer et al. (2003) using 15 NH4þ tracer. Regardless of the choice of 15N tracer, the incubation setup is identical. Sediments or water is collected in containers and stored with zero headspace. The zone of nitrate reduction is targeted for collections or alternatively, the zone of anammox can be largely captured by retaining the top 2–3 cm of the sediment profile. In the laboratory, sediment slurries or water is transferred to a sealed incubation vessel (e.g., Exetainers, Hungate tubes, serum bottles) in an O2-free glove bag. The headspace of the incubation vessel is flushed with ultra high purity helium. In the case of soils or large amounts of sediment, the incubation vessels are evacuated prior to helium flushing. The 15N-labeled substrate is injected and the headspace is either repeatedly sampled in the single incubation vessel or more commonly, sampled over a time series in replicate incubation vessels. The N2 evolved is isotopically analyzed using an isotope ratio mass spectrometer (IRMS) or a quadrupole mass spectrometer if enrichments are sufficiently high, for the distribution of 29N2 and 30N2, depending on the labeled substrate used. 15 NO3 or 15NO2 (15NOx) labeling: Either 15NO3 or 15NO2 þ 14 NH4þ is added to the incubation vessel as a small-volume concentrated stock solution to attain post injection concentrations ranging from <25 to 200 mM. Anammox rates can be dependent on the substrate concentrations used, and parallel incubations can be done at a range of labeled substrate
79
Molecular and Stable Isotope Analysis of ANAMMOX
Table 3.6 Compilation of studies using either 15NOx or 15NH4þ as the tracer source for anammox rate estimates in sediment slurries or whole waters
System
Sediment/ water
Coastal Coastal Coastal Coastal Estuary
Water Sediments Sediments Sediments Sediments
Estuary Estuary Estuary Estuary Estuary
Sediments Sediments Sediments Sediments Sediment
Wetland Wetland
Sediments Sediments
Lake OMZ OMZ OMZ OMZ OMZ Deep Sea Hydrothermal Vent
Water Water Water Water Water Water Sediments Water
NOx
Reference
15
Hannig et al. (2007) Engstro¨m et al. (2005) Dalsgaard et al. (2005)* Schmid et al. (2007) Nicholls and Trimmer (2009) Dale et al. (2009) Rich et al. (2008) Trimmer et al. (2005) Trimmer et al. (2003) Risgaard-Petersen et al. (2004a,b) Erler et al. (2008) Koop-Jakobsen and Giblin (2009) Hamersley et al. (2009) Thamdrup et al. (2006) ward et al. (2009) Hamersley et al. (2007) Kuypers et al. (2005) Schmid et al. (2007) Engstro¨m et al. (2009) Byrne et al. (2009)
0 þ t
NH4þ
15
0
t
þ
þ þ
t
0t
0
0
0t
þ 0
0t
þ þ t
0t
0 0
OMZ, ocean oxygen minimum zone. When multiple types of 15N substrate were used, (þ) or () denotes the larger or smaller rate estimates, respectively. (0) denotes roughly equivalent, or variable but codominant rate estimates using either t tracer. ( ) denotes which single tracer application was used. Blanks indicate unreported. þ 15 The NH4 only incubation is done to verify that coupled nitrification denitrification shut off in the incubation. * Mini-review of sediment anammox rates prior to 2005.
concentrations to extrapolate to ambient in situ concentrations. The use of 15 NO3 or 15NO2 as the 15N source under anaerobic conditions simultaneously provides estimates of anammox and denitrification from the production of 29N2 and 30N2 and the effective isotopic enrichment of the 15 NO3 or 15NO2 (FN). The anammox rate is calculated according to ð3:1Þ Anammox ¼ FN1 P29 þ 2 1 FN1 P30
80
Bongkeun Song and Craig R. Tobias
where P29 is the production rate of 29N2 (15N14N), and P30 is the production rate of 30N2 (15N15N). The 29N2 and 30N2 are measured directly with IRMS from the incubation vessel headspace, or on aliquots of sediment/ water equilibrations in an ultra high purity helium headspace. FN is either measured directly following introduction of the tracer using various isotopic methods (Sigman et al., 1997, 2001; Thamdrup and Dalsgaard, 2002). Alternatively, FN can be estimated based on the known enrichment and mass of the 15NO3 or 15NO2 spike (typically 95 at.%) and a measurement of ambient NO3þNO2 in the sample prior to and after the isotope spike: FN ¼ FNspike Mass NO3 spike = Mass NO3 ambient þ Mass NO3 spike ð3:2Þ The anammox rate calculation is highly sensitive to the value of FN. Interpretation of the P29 and P30 are greatly simplified when FN is very high (> 0.95), that is, when there is negligible ambient NO3þNO2 in the incubating sample relative to the amount of the 15N spike. Preincubating sediments under anaerobic conditions for 4–24 h prior to adding the 15 NO3 tracer can be effective in lowering or completely removing residual NOx in sediments that contain ample electron donor (Dale et al., 2009; Nicholls and Trimmer, 2009; Rich et al., 2008). In organic poor sediments, however, or soils with very high NO3, the preincubation step is largely ineffective at reducing the NOx inventory. This residual NO3 isotopically dilutes the added 15NO3 or 15NO2 spike. Unless sediments are highly organic rich, it should not be assumed that preincubation will remove ambient NOx to a level where FN can be assumed to be equivalent to FN-spike. A secondary issue of using 15NO3 as the tracer source is the dependence of initial NO3 reduction to NO2 used in anammox. Although anammox bacteria are capable of NO3 reduction to NO2 (Kartal et al., 2007a,b), there is likely a strong dependence of NO2 supply for anammox from denitrification (Trimmer et al., 2003) under the imposed incubation conditions. This dependence on denitrification may contribute to observed covariance between anammox and denitrification rates measured using 15NO3 additions (Fig. 3.3). With all substrate amendment techniques there is potential for enhancement (or inhibition) of rates. Trimmer et al. (2005) reports no substrate concentration effect on anammox rates with NO2 at concentrations above 10 mM. Nevertheless, when using 15 NO3 spikes, we have found it necessary to either match in situ NO3 concentrations or conduct parallel incubations at several substrate concentrations that can be used to derive and extrapolate ambient DIN concentrations. Anammox rates expressed as relative anammox importance (ra) to total N2 production (i.e., % anammox) is a metric that is less sensitive to the incubation substrate concentration than are the absolute rates.
81
Molecular and Stable Isotope Analysis of ANAMMOX
1.8 1.6
Anammox
1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0
0
2
4
6
8 10 12 Denitrification
14
16
18
Figure 3.3 Correlation between denitrification and anammox rates in the sediments of the Cape Fear River Estuary determined in anaerobic slurries spiked with 15NO3 þ 14 NH4þ.
NH4þ labeling: Tracer additions to sediments under anaerobic conditions (Koop-Jakobsen and Giblin, 2009; Trimmer et al., 2003) can also be used to estimate anammox rates, although this approach does not yield estimates of denitrification. The use of 15NH4þ may be supplemented with 14NO3 or 14NO2 if sufficiently high residual NOx does not exist. It is the tracer of choice in sediments with high NOx and low NH4þ, although it can also be used in NH4þ-rich environments provided some measure of the effective 15NH4þ enrichment (FA) is done. The anammox rate (in units of N per time) is derived from the production of 29N2 according to 15
dN =dt ¼ 2d29 N2 =dtFA 1
ð3:3Þ
where dN/dt is the anammox rate, FA is the fractional effective 15N enrichment of the ammonium pool over the duration of the incubation. If not directly measured using various isotopic techniques (e.g., Holmes et al., 1997; Risgaard-Petersen et al., 1995), FA is calculated from known amounts of added tracer and ambient NH4þ. These can be derived from Eq. (3.2) by substituting NH4þ for the NO3 terms. An additional consideration is the mineralization of organic nitrogen to NH4þ during the incubation, particularly in organic rich samples. This may lead to a large source of isotopic dilution that should be accounted for by postincubation measurements of the soluble and/or extractable NH4þ pool. The mechanics of setting up and executing the incubations are the same as that described for the 15NO3 or 15NO2 tracer experiments.
82
Bongkeun Song and Craig R. Tobias
Rates calculated from 15NH4þ to 29N2 under anaerobic conditions should provide a more direct measurement of anammox. Theoretically, using either 15NOx or 15NH4þ approaches should yield similar rates, however, comparability is mixed among studies (Table 3.6). For some studies where rates and substrate concentrations are high, there is good agreement between the approaches (Trimmer et al., 2003). In other instances, the use of 15 NH4þ yielded lower or nondetectable rates relative to the use of 15NOx (Dale et al., 2009; Nicholls and Trimmer, 2009; Rich et al., 2008; Thamdrup and Dalsgaard, 2002). Lower and/or nondetectable rates using 15NH4þ may be attributable to unaccounted for isotopic dilution of the added 15NH4þ tracer with soluble and extractable ambient NH4þ pools. Regardless of the labeled substrate choice used in the incubations, the shutdown of coupled nitrification/denitrification should be verified, otherwise anammox will be overestimated. For sediments that are NOx free or can be made NOx free through preincubation, parallel anaerobic incubations using only 15NH4þ can be done to detect 29N2 production not attributable to anammox (Dale et al., 2009; Engstro¨m et al., 2005, 2009; Rich et al., 2008; Thamdrup and Dalsgaard, 2002).
3.2. Working toward in situ rates—Whole cores and ambient O2 The potential rate measurements described above using sediment slurries are constrained by: (1) the destruction of natural redox gradients during the slurry preparation; (2) the need to maintain anaerobic conditions which may decouple anammox from oxidative sources of substrate. Attempts to simultaneously derive anammox and denitrification (as well as nitrification) in sediment slurry incubations using parallel incubations of 15NH4þ and 15 NO3 additions are described in Minjeaud et al. (2008). This approach addresses potential oxidative sources of anammox substrate with sediment slurries. Recent approaches (Risgaard-Petersen et al., 2003, 2004a; Trimmer and Nicholls, 2009; Trimmer et al., 2006) to measuring anammox under quasi in situ conditions using an 15N tracer in intact sediment cores with aerated overlying water represent advancements toward generating anammox rate estimates that are closer to in situ rates. This “revised isotope pairing” (r-IPT) approach uses the addition of 15NO3 labeled substrate to the aerated overlying water of intact cores incubated in the dark. The anammox rate is calculated from the production of 29N2 and 30N2 (P29 and P30, respectively), and the ratio between 14NO3 and 15NO3 in the NOx reduction zone (r14) according to Anammox ¼ 2r14 ðP29 2r14 P30 Þ The value of r14 can be estimated in one of three ways.
ð3:4Þ
Molecular and Stable Isotope Analysis of ANAMMOX
83
(1) If parallel 15NO3 or 15NO2 slurry incubations are performed and the relative contribution of anammox to total N2 production (ra) and the P29 and P30 are known, r14 is estimated from:
r14 ¼
ð1 ra ÞðP29 =P30 Þ ra ð2 ra Þ
ð3:5Þ
This approach, of course, shares some of the constraints associated with the potential rate measurements described in the previous section. (2) A second approach to derive an estimate of r14 requires two sets of 15 NO3-labeled core incubations (Eqs. (3.1) and (3.2)) that use different 15NO3 concentrations. P29ð1Þ VP29ð2Þ r14 ð1Þ ¼ 2 P30ð1Þ V 2 P30ð2Þ
ð3:6Þ
V is the ratio between the 15NO3 concentrations in incubation (Eqs. (3.1) and (3.2)). It can be measured directly or estimated from the P29 and P30 in the two incubations: V ¼
P29ð1Þ þ 2P30ð1Þ P29ð2Þ þ 2P30ð2Þ
ð3:7Þ
Derivations of the equations for approaches 1 and 2 to estimate r14 are presented in Risgaard-Petersen et al. (2003, 2004a,b). (3) The third approach found in Trimmer et al. (2006) and Trimmer and Nicholls (2009) does not require additional incubations and is based on the isotopic analysis of N2O following the addition of 15NO3 tracer. It is assumed that the distribution of 15N and 14N in N2O (produced by denitrification) is a reasonable proxy for the 15N and 14N distribution in the NO3 pool in the NOx reduction zone that contains both anammox and denitrification. This assumption may be complicated in cases where there is a substantial N2O contribution from nitrification. The value of r14 is calculated from the production rate of 15N14N2O (P45) and 15N15N2O (P46). r14 ¼
P45 2P46
ð3:8Þ
84
Bongkeun Song and Craig R. Tobias
Collection/analysis of N2O samples from the incubations for isotopic analysis of N2O is described in Trimmer et al. (2006, 2009). Recent analytical methods for N2O isotope analysis using IRMS are detailed in McIlvin and Casciotti (2010). Quadrupole mass spectrometry methods for isotope N2O analysis can be found in Minjeaud et al. (2008). Relatively few anammox measurements have been performed to date using the r-IPT approach. Results so far suggest that r-IPT yields somewhat higher anammox rates relative to slurry incubations in environments where the ra is one-third or more of the total N2.
ACKNOWLEDGMENTS The data presented in this chapter were from the research projects supported by NC Sea Grant and NSF (OCE-0851435). We acknowledge Matthew D. Hirsch for his contribution of anammox and denitrification measurements presented in Fig. 3.3.
REFERENCES Amano, T., Yoshinaga, I., Okada, K., Yamagishi, T., Ueda, S., Obuchi, A., Sako, Y., and Suwa, Y. (2007). Detection of anammox activity and diversity of anammox bacteriarelated 16S rRNA genes in coastal marine sediment in Japan. Microbes Environ. 22, 232–242. Byrne, N., Strous, M., Crepeau, V., Kartal, B., Birrien, J. L., Schmid, M., Lesongeur, F., Schlouten, S., Jaeschke, A., Jetten, M., Prieur, D., and Godfroy, A. (2009). Presence and activity of anaerobic ammonium-oxidizing bacteria at deep-sea hydrothermal vents. ISME J. 3, 117–123. Clark, I., Timlin, R., Bourbonnais, A., Jones, K., Lafleur, D., and Wickens, K. (2008). Origin and fate of industrial ammonium in anoxic groundwater—15N evidence for anaerobic oxidation (Anammox). Ground Water Monit. Rem. 28, 73–82. Cornwell, J. C., Kemp, W. M., and Kana, T. M. (1999). Denitrification in coastal ecosystems: Methods, environmental controls, and ecosystem level controls, a review. Aquat. Ecol. 33, 41–54. Dale, O. R., Tobias, C., and Song, B. (2009). Biogeographical distribution of diverse anaerobic ammonium oxidizing (ANAMMOX) bacteria in Cape Fear River Estuary. Environ. Microbiol. 11, 1194–1207. Dalsgaard, T., Thamdrup, B., and Canfield, D. E. (2005). Mini-review: Anaerobic ammonium oxidation (anammox) in the marine environment. Res. Microbiol. 156, 457–464. Dang, H., Chen, R., Wang, L., Guo, L., Chen, P., Tang, Z., Tian, F., Li, S., and Klotz, M. G. (2010). Environmental factors shape sediment anammox bacterial communities in hypernutrified Jiaozhou Bay, China. Appl. Environ. Microbiol. 76, 7036–7047. Dong, L. F., Smith, C. J., Papaspyrou, S., Stott, A., Osborn, A. M., and Nedwell, D. B. (2009). Changes in benthic denitrification, nitrate ammonification, and anammox process rates and nitrate and nitrite reductase gene abundances along an estuarine nutrient gradient (the Coline Estuary, United Kingdom). Appl. Environ. Microbiol. 75, 3171–3179. Engstro¨m, P., Dalsgaard, T., Hulth, S., and Aller, R. C. (2005). Anaerobic ammonium oxidation by nitrite (anammox): Implications for N2 production in coastal marine sediments. Geochim. Cosmochim. Acta 69, 2057–2065.
Molecular and Stable Isotope Analysis of ANAMMOX
85
Engstro¨m, P., Penton, C. R., and Devol, A. H. (2009). Anaerobic ammonium oxidation in deep-sea sediments off the Washington margin. Limnol. Oceanogr. 54, 1643–1652. Erler, D. V., Eyre, B. D., and Davison, L. (2008). The contribution of anammox and denitrification to sediment N2 production in a surface flow constructed wetland. Environ. Sci. Technol. 42, 9144–9150. Ettwig, K. F., van Alen, T., van de Pas-Schoonen, K. T., Jetten, M. S. M., and Strous, M. (2009). Enrichment and molecular detection of denitrifying methanotrophic bacteria in the NC10 phylum. Appl. Environ. Microbiol. 75, 3656–3662. Ettwig, K. F., Butler, M. K., Le Paslier, D., Pelletier, E., Mangenot, S., Kuypers, M. M. M., Schreiber, F., Dutilh, B., Zedelius, J., de Beer, D., Gloerich, J., Wessels, H. J. C. T., et al. (2010). Nitrite-driven anaerobic methane oxidation by oxygenic bacteria. Nature 464, 543–548. Fuchsman, C. A., Murray, J. W., and Konovalov, S. K. (2008). Concentration and natural stable isotope profiles of nitrogen species in the Black Sea. Mar. Chem. 111, 90–105. Gala´n, A., Molina, V., Thamdrup, B., Woebken, D., Lavik, G., Kuypers, M. M. M., and Ulloa, O. (2009). Anammox bacteria and the anaerobic oxidation of ammonium in the oxygen minimum zone off northern Chile. Deep-Sea Res. II 56, 1021–1031. Hamersley, M. R., Lavik, G., Woebken, D., Rattray, J. E., Lam, P., Hopmans, E. C., Sinninghe Damste´, J. S., Kru¨ger, S., Graco, M., Gutie´rrez, D., and Kuypers, M. M. M. (2007). Anaerobic ammonium oxidation in the Peruvian oxygen minimum zone. Limnol. Oceanogr. 53, 923–933. Hamersley, M. R., Woebken, D., Boehrer, B., Schultze, M., Lavik, G., and Kuypers, M. M. M. (2009). Water column anammox and denitrification in a temperate permanently stratified lake (Lake Rassnitzer, Germany). Syst. Appl. Microbiol. 32, 571–582. Hanning, M., Lavik, G., Kuypers, M. M. M., Woebken, D., Martens-Habbena, W., and Jurgens, K. (2007). Shift from denitrification to anammox after inflow events in the central Baltic Sea. Limnol. Oceanogr. 52, 1336–1345. Hietanen, S., and Kuparinen, J. (2008). Seasonal and short-term variation in denitrification and anammox at a coastal station on the Gulf of Finland, Baltic Sea. Hydrobiology 596, 67–77. Hirsch, M. D., Long, Z. T., and Song, B. (2011). Anammox bacterial diversity in various aquatic ecosystems based on the detection of hydrazine oxidase genes (hzoA/hzoB). Microb. Ecol. 61, 264–276. Holmes, R. M., McClelland, J. W., Sigman, D. M., Fry, B., and Peterson, B. J. (1997). Measuring 15NH4þ in marine, estuarine, and fresh waters: An adaptation of the ammonia diffusion method for samples with low ammonium concentrations. Mar. Chem. 60, 235–243. Hu, S., Zeng, R. J., Burow, L. C., Lant, P., Keller, J., and Yuan, Z. (2009). Enrichment of denitrifying anaerobic methane oxidizing microorganisms. Environ. Microbiol. Rep. 1, 377–384. Humbert, S., Tarnawski, S., Fromin, N., Mallet, M.-P., Aragno, M., and Zopfi, J. (2010). Molecular detection of anammox bacteria in terrestrial ecosystems: Distribution and diversity. ISME J. 4, 450–454. Kartal, B., Kuypers, M. M., Lavik, G., Schalk, J., Op den Camp, H. J. M., Jetten, M. S. M., and Strous, M. (2007a). Anammox bacteria disguised as denitrifiers: Nitrate reduction to dinitrogen gas via nitrite and ammonium. Environ. Microbiol. 9, 635–642. Kartal, B., Rattray, J., van Niftrik, L. A., van de Vossenberg, J., Schmid, M. C., Webb, R. I., Shouten, S., Fuerst, J. A., Sinninghe Damste´, J., Jetten, M. S. M., and Strous, M. (2007b). Candidatus “Anammoxoglobus propionicus” a new propionate oxidizing species of anaerobic ammonium oxidizing bacteria. Syst. Appl. Microbiol. 30, 39–49.
86
Bongkeun Song and Craig R. Tobias
Kartal, B., van Niftrik, L., Rattray, J., van de Vossenberg, J. L. C. M., Schmid, M. C., Damste´, J. S., Jetten, M. S. M., and Strous, M. (2008). Candidatus ‘Brocadia fulgida’: An autofluorescent anaerobic ammonium oxidizing bacterium. FEMS Microbiol. Ecol. 63, 46–55. Kirkpatrick, J., Oakley, B., Fuchsman, C., Srinivasan, S., Staley, J. T., and Murray, J. W. (2006). Diversity and distribution of Planctomycetes and related bacteria in the suboxic zone of the Black Sea. Appl. Environ. Microbiol. 72, 3079–3083. Klotz, M. G., Schmid, M. C., Strous, M., op den Camp, H. J. M., Jetten, M. S. M., and Hooper, A. B. (2008). Evolution of an octahaem cytochrome c protein family that is key to aerobic and anaerobic ammonia oxidation by bacteria. Environ. Microbiol. 10, 3150–3163. Konovalov, S. K., Fuchsman, C. A., Belokopitov, V., and Murray, J. W. (2008). Modeling the distribution of nitrogen species and isotopes in the water column of the Black Sea. Mar. Chem. 111, 106–124. Koop-Jakobsen, K., and Giblin, A. E. (2009). Anammox in tidal marsh sediments: The role of salinity, nitrogen loading, and marsh vegetation. Estuaries Coasts 32, 238–245. Kuypers, M. M. M., Sliekers, A. O., Lavik, G., Schmid, M., Jrgensen, B. B., Kuenen, J. G., Sinninghe Damste´, J., Strous, M., and Jetten, M. S. M. (2003). Anaerobic ammonium oxidation by anammox bacteria in the Black Sea. Nature 422, 608–611. Kuypers, M. M. M., Lavik, G., Woebken, D., Schmid, M. C., Fuchs, B. M., Amann, R., Jrgensen, B. B., and Jetten, M. S. M. (2005). Massive nitrogen loss from the Benguela upwelling system through anaerobic ammonium oxidation. PNAS 102, 6478–6483. Lam, P., Jensen, M. M., Lavil, G., McGinnis, D. F., Mu¨ller, B., Schubert, C. J., Amann, R., Thamdrup, B., and Kuypers, M. M. M. (2007). Linking crenarchaeal and bacterial nitrification to anammox in the Black Sea. PNAS 104, 7104–7109. Lam, P., Lavik, G., Jensen, M. M., van de Vossenberg, J., Schmid, M., Woebken, D., Gutie´rrez, D., Amann, R., Jetten, M. S. M., and Kuypers, M. M. M. (2009). Revising the nitrogen cycle in the Peruvian oxygen minimum zone. PNAS 106, 4752–4757. Li, X.-R., Du, B., Fu, H.-X., Wang, R.-F., Shi, J.-H., Wang, Y., Jetten, M. S. M., and Quan, Z.-X. (2009). The bacterial diversity in an anaerobic ammonium-oxidizing (anammox) reactor community. Syst. Appl. Microbiol. 32, 278–289. Li, H., Chen, S., Mu, B.-Z., and Gu, J.-D. (2010a). Molecular detection of anaerobic ammonium-oxidizing (anammox) bacteria in high-temperature petroleum reservoirs. Microb. Ecol. 60, 771–783. Li, M., Hong, Y., Klotz, M. G., and Gu, J.-D. (2010b). A comparison of primer sets for detecting 16S rRNA and hydrazine oxidoreductase genes of anaerobic ammoniumoxidizing bacteria in marine sediments. Appl. Microbiol. Biotechnol. 86, 781–790. Ludwing, W., Kirchof, G., Klugbauer, N., Weizenegger, M., Betzl, D., Ehrmann, M., Hertel, C., Jilg, S., Tatzel, R., Zitzelsberger, H., Lerbl, S., Hochberger, J., et al. (1992). Complete 23S ribosomal RNA sequences of gram-positive bacteria with a low G + C content. Syst. Appl. Microbiol. 15, 487–501. McIlvin, M., and Casciotti, K. L. (2010). Fully automated system for stable isotopic analysis of dissolved nitrous oxide at natural abundance levels. Limnol. Oceanogr. Methods 8, 54–66. Meyer, R. L., Rigaard-Petersen, N., and Allen, D. E. (2005). Correlation between anammox activity and microscale distribution of nitrite in subtrophical mangrove sediment. Appl. Environ. Microbiol. 71, 6142–6149. Minjeaud, L., Bonin, P. C., and Michotey, V. D. (2008). Nitrogen fluxes from marine sediments:quantification of the associated co-occurring bacterial processes. Biogeochemistry 90, 141–157.
Molecular and Stable Isotope Analysis of ANAMMOX
87
Mulder, A., van de Graaf, A. A., Robertson, L. A., and Kuenen, J. G. (1995). Anaerobic ammonium oxidation discovered in a denitrifying fluidized bed reactor. FEMS Microbiol. Ecol. 16, 177–184. Neef, A., Amann, R. I., Schlesner, H., and Schleifer, K.-H. (1998). Monitoring a widespread bacterial group: in situ detection of Planctomycetes with 16S rRNA-targeted probes. Microbiol. 144, 3257–3266. Nedwell, D. B., Jickells, T. D., Trimmer, M., and Sanders, R. (1999). Nutrients in estuaries. In “Estuaries, Advances in Ecological Research, Vol. 29,” (D. B. Nedwell and D. G. Raffaelli, eds.), pp. 43–92. Academic Press, London. Nicholls, J. C., and Trimmer, M. (2009). Widespread occurrence of the anammox reaction in estuarine sediments. Aquat. Microb. Ecol. 55, 105–113. Olsen, G. J., Lane, D. J., Giovannoni, S. J., Pace, N. R., and Stahl, D. A. (1986). Microbial Ecology and Evolution: A Ribosomal Approach. Annual Rev. Microbiol. 40, 337–365. Pavlekovic, M., Schmid, M. C., Schmider-Poignee, N., Spring, S., Philhofer, M., Gaul, T., Fiandaca, M., Lo¨ffler, F. E., Jetten, M., Schleifer, K.-H., and Lee, N. M. (2009). Optimization of three FISH procedures for in situ detection of anaerobic ammonium oxidizing bacteria in biological wastewater treatment. J. Microbiol. Methods 78, 119–126. Penton, C. R., Devol, A. H., and Tiedje, J. M. (2006). Molecular evidence for the broad distribution of anaerobic ammonium-oxidizing bacteria in freshwater and marine sediments. Appl. Environ. Microbiol. 72, 6829–6832. Propenko, M. G., Hammond, D. E., Berelson, W. M., Bernhard, J. M., Stott, L., and Douglas, R. (2006). Nitrogen cycling in the sediments of Santa Barabara basin and Eastern Subtropical North Pacific: Nitrogen isotopes, diagenesis, and possible chemosymbiosis between two lithotrophs (Thioploca and Anammox)—“ riding on a glider” Earth Planet. Sci. Lett. 242, 186–204. Quan, Z.-X., Rhee, S.-K., Zuo, J.-E., Yang, Y., Bae, J.-W., Park, J. R., Lee, S.-T., and Park, Y.-H. (2008). Diversity of ammonium-oxidizing bacteria in a granular sludge anaerobic ammonium-oxidizing (anammox) reactor. Environ. Microbiol. 10, 3130–3139. Raghoebarsing, A. A., Pol, A., van de Pas-Schoonen, K. T., Smolders, A. J. P., Ettwig, K. F., Rijpstra, I. C., Schouten, S., Damste´, J. S. S., Op den Camp, H. J. M., Jetten, M. S. M., and Strous, M. (2006). A microbial consortium couples anaerobic methane oxidation to denitrification. Nature 440, 918–921. Rich, J. J., Dale, O. R., Song, B., and Ward, B. B. (2008). Anaerobic ammonium oxidation (anammox) in Chesapeake Bay sediments. Microb. Ecol. 53, 311–320. Risgaard-Petersen, N. S., Rysgaard, S., and Revsbech, N. P. (1995). Combined microdiffusion-hypobromite oxidation method for determining nitrogen-15 isotope in ammonium. Soil Sci. Soc. Am. J. 59, 1077–1080. Risgaard-Petersen, N., Nielsen, L. P., Rysgaard, S., Dalsgaard, T., and Meyer, R. L. (2003). Application of the isotope pairing technique in sediments where anammox and denitrification co-exist. Limnol. Oceanogr. Methods 1, 63–73. Risgaard-Petersen, N., Meyer, R. L., Schmid, M., Jetten, M. S. M., Enrich-Prast, A., Rysgaard, S., and Revsbech, N. P. (2004a). Anaerobic ammonium oxidation in an estuarine sediment. Aquat. Microb. Ecol. 36, 293–304. Risgaard-Petersen, N., Nielsen, L. P., Rysgaard, S., Dalsgaard, T., and Meyer, R. L. (2004b). Erratum: Application of the isotope pairing technique in sediments where anammox and denitrification co-exist. Limnol. Oceanogr. Methods 2, 315. Schalk, J., de Vries, S., Kuenen, G., and Jetten, M. S. M. (2000). Involvement of a novel hydroxylamine oxidoreductase in anaerobic ammonium oxidation. Biochemistry 39, 5405–5412. Schmid, M. C., Twachtmann, U., Klein, M., Strous, M., Juretschko, S., Jetten, M. S. M., Metzger, J. W., Schleifer, K. H., and Wagner, M. (2000). Molecular evidence for genus
88
Bongkeun Song and Craig R. Tobias
level diversity of bacteria capable of catalyzing anaerobic ammonium oxidation. Syst. Appl. Microbiol. 23, 93–106. Schmid, M. C., Schmitz-Esser, S., Jetten, M. S. M., and Wagner, M. (2001). 16S-23S rDNA intergenic spacer and 23S rDNA of anaerobic ammonium oxidizers: Implications for phylogeny and in situ detection. Environ. Microbiol. 3, 450–459. Schmid, M. C., Walsh, K., Webb, R., Rijpstra, W. I., van de Pas-Schoonen, K., Verbruggen, M. J., Hill, T., Moffett, B., Fuerst, J., Schouten, S., Damste´, J. S., Harris, J., et al. (2003). Candidatus “Scalindua brodae”, sp. Nov., Candidatus “Scalindua wagneri”, sp. Nov., two new species of anaerobic ammonium oxidizing bacteria. Syst. Appl. Microbiol. 26, 529–538. Schmid, M. C., Maas, B., Dapena, A., van de Pas-Schoonen, K., van de Vossenberg, J., Kartal, B., van Niftrik, L., Schmidt, I., Cirpus, I., Kuenen, J. G., Wagner, M., Sinninghe Damste´, J. S., et al. (2005). Biomarkers for in situ detection of anaerobic ammoniumoxidizing (anammox) bacteria. Appl. Environ. Microbiol. 71, 1677–1684. Schmid, M. C., Risgaard-Petersen, N., van de Vossenberg, J., Kuypers, M. M. M., Lavik, G., Petersen, J., Hulth, S., Thamdrup, B., Canfield, D., Dalsgaard, T., Rysgaard, S., Sejr, M. K., et al. (2007). Anaerobic ammonium-oxidizing bacteria in marine environments: Widespread occurrence but low diversity. Environ. Microbiol. 9, 1476–1484. Schmid, M. C., Hooper, A. B., Klotz, M. G., Woebken, D., Lam, P., Kuypers, M. M. M., Pommerening-Roeser, A., op den Camp, H. J. M., and Jetten, M. S. M. (2008). Environmental detection of octahaem cytochrome c hydroxylamine/hydrazine oxidoreductase genes of aerobic and anaerobic ammonium-oxidizing bacteria. Environ. Microbiol. 10, 3140–3149. Schubert, C. J., Durisch-Kaiser, E., Wehrli, B., Thamdrup, B., Lam, P., and Kuypers, M. M. M. (2006). Anaerobic ammonium oxidation in a tropical freshwater system (Lake Tanganyika). Environ. Microbiol. 10, 1857–1863. Seitzinger, S. P. (1994). Linkages between organic matter mineralization and denitrification in eight riparian wetlands. Biogeochemistry 25, 19–39. Seitzinger, S. P., and Giblin, A. (1996). Estimating denitrification in North Atlantic continental shelf sediments. Biogeochemistry 35, 235–260. Seitzinger, S. P., Harrison, J. A., Bo¨hlke, J. K., Bouwman, A. F., Lowrance, R., Peterson, B., Tobias, C., and Van Drecht, G. (2006). Denitrification across landscapes and waterscapes: A synthesis. Ecol. Applic. 16, 2064–2090. Shimamura, M., Nishiyama, T., Shigetomo, H., Toyomoto, T., Kawahara, Y., Furukawa, K., and Takao, F. (2007). Isolation of a multiheme protein with features of a hydrazine-oxidizing enzyme from an anaerobic ammonium-oxidizing enrichment culture. Appl. Environ. Microbiol. 73, 1065–1072. Sigman, D. M., Altabet, M. A., Michener, R., McCorkle, D. C., Fry, B., and Holmes, R. M. (1997). Natural abundance-level measurement of the nitrogen isotopic composition of oceanic nitrate: An adaptation of the ammonium diffusion method. Mar. Chem. 57, 227–242. Sigman, D. M., Casciotti, K. L., Andreani, M., Barford, C., Galanter, M., and Bo˝hlke, J. K. (2001). A bacterial method for the nitrogen isotopic analysis of nitrate in seawater and freshwater. Anal. Chem. 73, 4145–4153. Srenson, J. (1987). Nitrate reduction in marine sediment: Pathways and interactions with iron and sulfur cycling. Geomicrobiol. J. 5, 401–422. Strous, M., Heijen, J. J., Kuenen, J. G., and Jetten, M. S. M. (1998). The sequencing batch reactor as a powerful tool for the study of slowly growing anaerobic ammoniumoxidizing microorganisms. Appl. Microbiol. Biotechnol. 50, 589–596. Strous, M., Pelletier, E., Magenot, S., Rattei, T., Lehner, A., Taylor, M. W., Horn, M., Daims, H., Bartol-Marvel, D., Wincker, P., Barbe, V., Fonknechten, N., et al. (2006).
Molecular and Stable Isotope Analysis of ANAMMOX
89
Deciphering the evolution and metabolism of an anammox bacterium from a community genome. Nature 440, 790–794. Thamdrup, B., and Dalsgaard, T. (2002). Production of N2 through anaerobic ammonium oxidation coupled to nitrate reduction in marine sediments. Appl. Environ. Microbiol. 68, 1312–1318. Thamdrup, B., Dalsgaard, T., Jensen, M. S. M., Ulloa, O., Farias, L., and Escribano, R. (2006). Anaerobic ammonium oxidation in the oxygen-deficient waters off northern Chile. Limnol. Oceanogr. 51, 2145–2156. Tobias, C. R., Macko, S. A., Anderson, I. C., Canuel, E. A., and Harvey, J. W. (2001). Tracking the fate of a high concentration groundwater nitrate plume through a fringing marsh: A combined groundwater tracer and in situ isotope enrichment study. Limnol. Oceanogr. 46, 1977–1989. Trimmer, M., and Nicholls, J. C. (2009). Production of nitrogen gas via anammox and denitrification in intact sediment cores along a continental shelf to slope transect in the North Atlantic. Limnol. Oceanogr. 54, 577–589. Trimmer, M., Nicholls, J. C., and Deflandre, B. (2003). Anaerobic ammonium oxidation measured in sediments along the Thames Estuary, United Kingdom. Appl. Environ. Microbiol. 69, 6447–6454. Trimmer, M., Nicholls, J. C., Morely, C., Davies, C. A., and Aldrigde, J. (2005). Biphasic behavior of anammox regulated by nitrite and nitrate in an estuarine sediment. Appl. Environ. Microbiol. 71, 1923–1930. Trimmer, M., Risgaard-Petersen, Nicholls, and Engstro¨m, P. (2006). Direct measurement of anaerobic ammonium oxidation (anammox) and denitrification in intact sediment cores. Mar. Ecol. Prog. Ser. 326, 37–47. van de Graaf, A. A., Mulder, A., de Bruijn, P., Jetten, M. S. M., Robertson, L. A., and Kuenen, J. G. (1995). Anaerobic oxidation of ammonium is a biologically mediated process. Appl. Environ. Microbiol. 61, 1246–1251. Ward, B. B., Devol, A. H., Rich, J. J., Chang, B. X., Bulow, S. E., Naik, H., Pratihary, A., and Jayakumar, A. (2009). Denitrification as the dominant nitrogen loss process in the Arabian Sea. Nature 461, 78–81. Woebken, D., Lam, P., Kuypers, M. M. M., Naqvi, S. W. A., Kartal, B., Strous, M., Jetten, M. S. M., Fuchs, B. M., and Amann, R. (2008). A microdiversity study of anammox bacteria reveals a novel Candidatus Scalindua phylotype in marine oxygen minimum zones. Environ. Microbiol. 10, 3106–3119. Yoshie, S., Noda, N., Tsuneda, S., Hirata, A., and Inamori, Y. (2004). Salinity decreases nitrate reductase gene diversity in denitrifying bacteria of wastewater treatment systems. Appl. Environ. Microbiol. 70, 3152–3157.
C H A P T E R
F O U R
Nitrogen Mineralization and Assimilation at Millimeter Scales David D. Myrold,* Jennifer Pett-Ridge,† and Peter J. Bottomley*,‡ Contents 92 92 93 93 94 94 95 96 101 109 109
1. Introduction 2. Microbial Habitats in Soil 2.1. Rhizosphere 2.2. Plant detritus 2.3. Soil aggregates 3. Methodological Approaches 3.1. General isotope pool dilution principles and procedures 3.2. Applications of IRMS analysis to soil microhabitats 3.3. Applications of SIMS analysis to soil microhabitats 4. Conclusions References
Abstract The assimilation (uptake or immobilization) of inorganic nitrogen (N) and the production of ammonium (NH4þ) from organic N compounds are universal functions of microorganisms, and the balance between these two processes is tightly regulated by the relative demands of microbes for N and carbon (C). In a heterogeneous environment, such as soils, bulk measurements of N mineralization or immobilization do not reflect the variation of these two processes in different microhabitats (1 mm–1 mm). Our purpose is to review the approaches that can be applied to measure N mineralization and immobilization within soil microhabitats, at scales of millimeter (using adaptations of 15N isotope pool dilution and IRMS—isotope ratio mass spectrometry) to micrometer (using SIMS—secondary ion mass spectrometry).
* Department of Crop and Soil Science, Oregon State University, Corvallis, Oregon, USA Chemical Sciences Division, Lawrence Livermore National Laboratory, California, USA Department of Microbiology, Oregon State University, Corvallis, Oregon, USA
{ {
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00004-X
#
2011 Elsevier Inc. All rights reserved.
91
92
David D. Myrold et al.
1. Introduction Microorganisms need nitrogen (N) to carry out cellular functions and to grow. Ammonium (NH4þ) is generally acknowledged as their preferred source of inorganic N; however, microorganisms may also use organic N compounds, such as amino acids, or nitrate (NO3). When microorganisms encounter organic N in excess of the growth needs for N, they engage in a combination of enzymatic processes that depolymerize and deaminate organic forms of N into NH4þ. This process is commonly termed N mineralization or ammonification. Through nitrification, NH4þ can be oxidized to NO3. The opposing, anabolic process is the transformation of NH4þ or NO3 into organic N compounds for assimilation into cellular constituents, a process also known as N immobilization. In soil microbiology, it is conventional to think of mineralization of organic N occurring under carbon (C)-limited conditions and assimilation of inorganic N occurring under C-sufficient (i.e., N-limited) conditions. In the environment, N mineralization and immobilization can occur simultaneously, but at a given time the two processes are likely to be spatially partitioned into different microhabitats (Chen and Stark, 2000; Myrold and Bottomley, 2008; Schimel and Bennett, 2004). To gain a more sophisticated understanding of the factors that control the balance between N mineralizing and immobilizing activities, there is a need to move beyond bulk measurements that average across microhabitats to measuring N mineralization and assimilation at scales relevant to microorganisms. In this chapter, we review methods that can be used to measure N mineralization and assimilation at several spatial scales. In doing so, we will focus primarily on soils because of their variability over a wide range of spatial scales.
2. Microbial Habitats in Soil Soil is a complex, spatially and temporally heterogeneous, threedimensional habitat in which microorganisms function to process C, N, and other nutrients. Consequently, soil can be considered a mosaic of niches, or microhabitats, with unique characteristics that structure their associated microbial communities and their functions (Dechesne et al., 2007; Jastrow and Miller, 1998; Nunan et al., 2007). In soil science, these microhabitats have commonly been classified and named based on their sphere of influence (Beare et al., 1995; Fig. 4.1). The rhizosphere, decaying plant material, and soil aggregates are soil microhabitats that have been examined for sub-centimeter scale measurements of N mineralization and immobilization.
93
Nitrogen Cycling at Millimeter Scales
Mycorrhizal hyphae
Clay microstructures
Plant root
Pore space Microbial debris
Macroaggregates
Microaggregate
Detritus with saprotrophic fungi
Figure 4.1 Examples of microhabitats found in soil. Nitrogen mineralization and immobilization have been investigated in soil associated with roots and mycorrhizal hyphae (rhizosphere), plant detritus, and aggregates of various sizes. Adapted from Jastrow and Miller (1998).
2.1. Rhizosphere Plants alter the physical and chemical environment around their roots, generating the microhabitat known as the rhizosphere (e.g., Dessaux et al., 2010), thereby influencing the microorganisms living there and their function (Hawkes et al., 2007; Philippot et al., 2009). Most directly, this is through symbiotic relationships of plant roots with mycorrhizal fungi or with root-nodulating, N2-fixing bacteria. Indeed, the ubiquity and influence of mycorrhizae has led to finer microhabitat distinctions (e.g., “mycorrhizosphere” or “hyphosphere”). More generally plants put substantial amounts of C into the soil through root exudation ( Jones et al., 2009), alter soil water and gas relationships (Philippot et al., 2009), and compete with rhizosphere microorganisms for nutrients (Inselsbacher et al., 2010; Kaye and Hart, 1997; Ma˚nsson et al., 2009). Although N mineralization and immobilization are elevated in rhizosphere compared to bulk soil (Breland and Bakken, 1991; Herman et al., 2006; Norton and Firestone, 1996), within the rhizosphere there is also likely to be significant heterogeneity and the development of smaller microhabitats (Philippot et al., 2009).
2.2. Plant detritus Dead plant parts are diverse, ranging from succulent, fresh leaves or fine roots to highly lignified, coarse woody materials. Whether incorporated into soil through agricultural activities or entering through natural litter fall
94
David D. Myrold et al.
or root turnover, plant detritus represents a major input of C, N, and other nutrients into soil systems and is a hot spot for microbial activity. In general, the tipping point between N mineralization and immobilization is a function of the quality of the residue (e.g., its C:N ratio, lignin content) and the composition and physiology of the microbial community (Myrold and Bottomley, 2008). Microbial communities directly associated with decaying residue are known to be different than bulk soil (McMahon et al., 2005) and vary with residue characteristics (Baumann et al., 2009; Rousk and Ba˚a˚th, 2007; Williams et al., 2007). As decomposition proceeds, the chemical composition of the residue changes (e.g., C:N ratio narrows, percentage of lignin increases); these changes are accompanied by shifts in the relative magnitudes of N immobilization and mineralization (Gaillard et al., 1999; Magid et al., 2006) and sometimes by concomitant shifts in the microbial community (Baumann et al., 2009; Williams et al., 2007). It is not clear if this is a cause or an effect of the latter.
2.3. Soil aggregates The structure of the soil—soil aggregation—imparts many of the key properties to soil in terms of the transport of water, solutes, and gases, and it shapes the habitats available to soil microorganisms (Or et al., 2007). Soil aggregates vary in size and are dynamic in terms of their formation and disintegration; these characteristics are partly a function of microbial activities, such as the production of extracellular polymeric materials that help stabilize aggregates (Six et al., 1999; Tisdall and Oades, 1982). Consequently, microbial communities and their activities can vary among different sizes of soil aggregates (Mendes et al., 1999; Muruganandam et al., 2009). For example, microbial N mineralization and immobilization were greatest in intermediate to larger water-stable soil aggregates (Angers et al., 1997; Muruganandam et al., 2010). Variation in microbial processes can also occur within individual soil aggregates. For example, the interplay between oxygen diffusion and microbial respiration results in a gradient of oxygen concentrations within a soil aggregate, which in turn influence denitrification (Sexstone et al., 1985). Gradients of nutrients and C are also likely to exist within aggregates, and thereby have the potential to influence the balance between N mineralization and immobilization processes.
3. Methodological Approaches Measurements of N mineralization and immobilization in soils are typically made on bulk samples, such as undisturbed cores ( 10–1000 cm3) or sieved soils (10 g–1 kg), and most often changes in the pool sizes of NH4þ
95
Nitrogen Cycling at Millimeter Scales
and/or NO3 are measured at two or more times to determine a net rate of N mineralization (or immobilization if a decrease in inorganic N is observed). In order to separate N mineralization from N immobilization, it is most common to use compounds labeled with the stable isotope 15N as part of the isotope pool dilution technique (Hart and Myrold, 1996; Hart et al., 1994; Murphy et al., 2003). Assimilation of N can also be measured by the incorporation of an 15 N label directly into the microbial biomass (Hatch et al., 2000; Ledgard et al., 1998; Myrold and Tiedje, 1986) or by determination of residual 15N in soils after removal of the added tracer (Andersen and Jensen, 2001; Mary et al., 1998; Recous et al., 1999). Because the processes occur simultaneously, the use of 15N is necessary when measuring N mineralization or immobilization at small spatial scales, regardless of the approach used.
3.1. General isotope pool dilution principles and procedures
NH4+ p
5
14N
5
15N
Initial time
NH4+ c
p
8
14N
2
15N
Final time
c
NH4+ 15N fraction
The conceptual model of isotope dilution and its associated mathematical calculations were developed by Kirkham and Bartholomew (1954). In brief, an 15N-labeled compound is added to a soil pool (15NH4þ in the case of gross N mineralization or immobilization) and as unlabeled organic N is mineralized to NH4þ, the 15N abundance of the NH4þ is diluted and decreases exponentially (Fig. 4.2). By measuring the size and 15N abundance of the NH4þ pool at two (or more) times, the rates of NH4þ production (gross N mineralization) and consumption (the sum of NH4þ assimilation and nitrification) can be calculated using the equations derived by Kirkham and Bartholomew (1954) or more recent modeling approaches (Mary et al., 1998; Mu¨ller et al., 2007; Myrold and Tiedje, 1986). The isotope dilution model has several assumptions, including: (i) no isotopic discrimination, (ii) uniform distribution of label, (iii) equilibrium
0.5 0.4 0.3 0.2 0.1 0.0 Initial
Final Time
Figure 4.2 The principle of 15N isotope dilution as applied to the production (p, gross N mineralization) and consumption (c) of NH4þ. 15N-labeled NH4þ is added to a soil (in this case, in equal amounts to the unlabeled, native soil NH4þ) and measured shortly thereafter (initial time). The sample is incubated (often for 1–2 days) and measured again (final time). At the right is the expected change in the 15N abundance of the NH4þ pool through time as it is diluted with unlabeled NH4þ produced from organic N through mineralization.
96
David D. Myrold et al.
between added label and indigenous, unlabeled pools, and (iv) no remineralization of the label, although this can be taken into account (Kirkham and Bartholomew, 1955; Mary et al., 1998; Mu¨ller et al., 2007; Myrold and Tiedje, 1986). The assumptions of homogeneity of labeling and equilibrium are influenced by spatial heterogeneity of indigenous soil inorganic N, as well as the spatial distribution of the soil microbial community, and can result in inaccurate calculations of gross rates of N mineralization and immobilization (Davidson et al., 1991; Manzoni et al., 2008). Consequently, there has been interest in scaling down the 15N isotope dilution approach to study N mineralization and immobilization in soil microhabitats. In principle, 15N isotope dilution can be applied to soil microhabitats by specifically labeling particular microhabitats (often experimentally isolated with physical barriers), by labeling the whole soil and later separating the desired fraction, or with a combination of these two approaches. The most significant practical challenge when working with microhabitats is whether the sample is large enough so that the concentration and 15N abundance of the pool of interest (e.g., NH4þ) can be measured with existing analytical instruments. For example, it is difficult to accurately measure the 15N abundance of a sample with < 10 mg of N using modern isotope ratio mass spectrometers (IRMS; Barrie and Prosser, 1996). To use isotope dilution at the scale of a single soil aggregate, an aggregate with a 1 cm3 volume would need to have an NH4þ concentration of 10 mg N kg 1 soil, which is several-fold higher than typical soil NH4þ concentrations (Fig. 4.3). The volume of soil can be reduced when highly enriched 15N solutions are added if a “spike” of NH4þ of known mass and 15N abundance is added; however, this reduces the sensitivity and precision of the measurement. In general, sensitivity declines in proportion to the amount of spike added relative to amount of N from the sample. Thus, if the size of the spike was 100-fold, the sensitivity would decline by a factor of 100.
3.2. Applications of IRMS analysis to soil microhabitats Applying 15N-labeling methods to soil microhabitats requires samples large enough (>10 mg or >10 mm3; Fig. 4.3) to be analyzed by IRMS techniques. In general, the methods can be placed into two categories based on the order of isolating the microhabitat of interest and adding the label. 3.2.1. Physical separation followed by labeling The primary requisite for isolating a microhabitat is that doing so will not compromise its ability to function in its natural state. This is unlikely to be the case for rhizosphere soil because by definition it is dependent upon the functions of living roots, and this dependency is disrupted once the roots are removed. Physical fractionation methods are more appropriate to isolating detritusphere (e.g., particulate organic matter, light fraction) or water-stable
97
Nitrogen Cycling at Millimeter Scales
NanoSIMS ToF-SIMS MALDI-ToF 15
N isotope dilution + spike 15
N isotope dilution 10–12 10–11 10–10 10–9 10–8 10–7 10–6 10–5 10–4 10–3 10–2 10–1 100 101
Mass (g) 0.001
0.010 0.100 1.000 Linear dimension (mm)
10.000
Figure 4.3 Recommended method for measuring nitrogen (N) assimilation (gray bar) as a function of sample size. Linear dimensions based on cubic geometry and a soil bulk density of 1.25 g cm 3. Nitrogen assimilation assumes a microbial biomass of 40 mg N kg 1 soil. Isotope dilution measurements of N mineralization (white bar) require samples 10 times larger, and are based on a pool size of 2 mg N kg 1 soil following label addition. Note that there is an intermediate range in which N assimilation cannot be conveniently measured by existing methods. SIMS—secondary ion mass spectrometry; ToF—time-of-flight; MALDI—matrix-assisted laser desorption/ionization.
aggregates, although the separation methods used have the potential to alter subsequent microbial activity. An example of this approach is the study of gross N-cycling rates in soil aggregates of different sizes by Muruganandam et al. (2010). They chose three size classes (2–4, 0.5–1.0, and <0.25 mm diameter) of water-stable soil aggregates that were isolated from a soil that had been subjected to three different tillage regimes for 22 years. Special features of the experimental design included: Soil was air dried at 4 C for 4–5 days to achieve 10% gravimetric water content. The air-dried soil was separated into aggregate size classes by sieving through screens of different mesh sizes. The choice of aggregate sizes used for experimentation was based upon the fact they possessed different biological and chemical properties (Muruganandam et al., 2009). 15N-labeled NH4þ or NO3 was added in combination with the respective unlabeled ionic partner, for example, 15NH4þ 14NO3 or 14 NH4þ 15NO3 at 30 atom% 15N. Inorganic N was added at concentrations of 2 mg NH4þ–N and 8 mg NO3–N g 1 soil because the background soil NO3–N level was 2.5fold greater than that of NH4þ–N. Replicate samples (10 g) of each aggregate size class were incubated for a week with periodic destructive sampling at 0, 2, 4, and 7 days. This amount of soil allowed them to use standard IRMS methods (e.g., Hart et al., 1994).
98
David D. Myrold et al.
Label was added in a prescribed amount of water sufficient to raise the soil water content to 60% of water holding capacity.
It should be remembered that relatively large shifts in the water content of soil during label addition might change conditions sufficient to influence the gross rates (Herron et al., 2009; Murphy et al., 1997). Each replicate sample provided enough mass for standard extraction, diffusion, and IRMS analysis procedures (Stark and Hart, 1996). Muruganandam et al. (2010) used the FLUAZ model (Mary et al., 1998) to calculate gross rates of N mineralization, N immobilization, and nitrification. In general, gross rates of all processes increased with decreasing tillage intensity and were positively correlated with soil C and microbial biomass. No effect of aggregate size on any of the gross rates was observed in the most intensively tilled soil; however, differences in gross rates across aggregate sizes were more pronounced as tillage intensity decreased, often peaking in the 0.5–1.0 mm size class. For example, gross N mineralization varied from 0.9 to 1.1 mg N kg 1 aggregates d 1 across the three size classes for soils subjected to moldboard plowing, whereas the rate for the no-till soil were 1.9 (< 0.25 mm), 3.8 (0.5–1.0 mm), and 2.6 (2.0–4.0 mm) mg N kg 1 aggregates d 1. It should be noted, however, that all aggregates were crushed and mixed prior to label addition to enhance uniformity of labeling, which may have had the unintended effect of stimulating activity in the presumably more stable, larger aggregates found in less disturbed soils (Elliot, 1986). Further, it is possible that crushing and mixing might upset the spatial separation essential for maintaining the balance between mineralization and immobilization of N. 3.2.2. Labeling followed by physical dissection More commonly, soil systems are labeled with 15N-containing substrates, incubated for a period of time, and then the desired fractions are isolated. This approach has been used to study the rhizosphere, detritusphere, and soil aggregates. Studies of N cycling in the rhizosphere often use microcosms in which roots are physically constrained by membrane barriers with a mesh size that prevents root penetration (Luster et al., 2009). This results in distinct compartments of rhizosphere and bulk soil that can be easily separated for analysis. When the root compartment becomes highly colonized, a gradient of rhizosphere influence can become established in the adjacent bulk soil compartment. This rhizosphere gradient can then be subsampled to examine the finer-scale spatial influence of plant roots on microbial activity. An example of this is the study of Schenk zu Schweinsberg-Mickan et al. (2010), where 15N-labeled rhizodeposits were traced into microbial biomass at five distances between 1.0 and 4.2 mm from the root surface. They collected 10 g of soil from each distance, and performed chloroform
99
Nitrogen Cycling at Millimeter Scales
fumigation–extraction (a method to measure microbial biomass; Brookes et al., 1985) to obtain fractions for IRMS analysis. As expected, the 15N assimilated into microbial biomass decreased exponentially with distance from the root surface, but was still above unlabeled control levels at 4.2 mm away from the roots. The 15N isotope dilution approach has also been applied to study the influence of the rhizosphere on microbial N cycling. Herman et al. (2006) grew Avena barbata plants in microcosms designed so that individual roots could be isolated in a thin layer of soil (Fig. 4.4A). This set-up facilitated the addition of 15NH4þ or 15NO3 as well as fine-scale sampling of rhizosphere soil associated with different longitudinal regions of the roots and of bulk soil. Special features of this experimental design included:
Addition of high concentrations of NH4þ–N (14 mg N kg 1 soil) and harvesting sufficient rhizosphere soil (3 g) for analyses by standard IRMS methods.
A Divider Main chamber Slot
20mm C
D
et
rit
us
B
Soil
Soil 10 mm
2 mm 2 mm
Figure 4.4 Examples of using physical separation or dissection of soil microhabitats: (A) Rhizobox design that allows isolation of roots for labeling with 15N-labeled solutions (adapted from Herman et al., 2006; photo by Dr. Jennifer Pett-Ridge); (B) a detritus sandwich, adapted from Wang and Bakken (1997); (C) dissecting a soil aggregate, adapted from Dechesne et al. (2003).
100
David D. Myrold et al.
A rather nontraditional, short labeling incubation time of 2–3 h. A preliminary experiment had shown that label distribution in rhizosphere soil became heterogeneous after only 7 h presumably due to differential rates of N assimilation along the root length. Further, the experiment performed with 15NO3 was done over a different time interval (6 h), and larger root sections (8 cm) were harvested, presumably because of different behavior of NO3 in the rhizosphere and to get sufficient NO3 for IRMS analysis. Herman et al. (2006) found that gross N mineralization was lowest in the bulk soil and increased 7- to 13-fold in the rhizosphere, suggesting that while the microbial population was being stimulated by rhizosphere C availability, it was accessing soil N by increasing N mineralization rates. In addition, nitrification was found to change along the root away from the root tip. The gross rate of nitrification was identical to that of gross NH4þ consumption in the zone nearest the root tip (0–8 cm), whereas in the 8–16 cm zone, a much higher rate of NH4þ consumption far exceeded that of gross nitrification and probably represented enhanced root uptake of NH4þ in this zone rather than microbial assimilation, because the rate was more than 10-fold greater than the size of the pool of microbial biomass N. In an analogous fashion, the influence of decomposing plant materials on microbial activity has been explored by constructing microcosms with defined layers of plant residue sandwiched between layers of soil (Gaillard et al., 1999; Wang and Bakken, 1997). To date, this approach has most often been used to determine the effect of heterogeneous distribution of plant N uptake, so N mineralization has been assessed only indirectly (Magid et al., 2006; Wang and Bakken, 1997). Gaillard et al. (1999) did use the “detritus sandwich” approach (Fig. 4.4B) to follow the transfer and incorporation of 13 C- and 15N-labeled wheat straw into the detritusphere. Similar to rhizosphere studies, the label reached about 5 mm into the soil from the detritus– soil interface, probably reflecting similar diffusional constraints on the movement of soluble organic compounds. The fate of plant C and N into soil aggregates has also been traced by incubating 13C- and 15N-labeled wheat straw, and subsequently separating out aggregate size fractions (Angers et al., 1997). Although assimilation of N into microbial biomass was not measured directly, their data showed that greater proportions of N (and C) were found in larger aggregates (0.24–1.0 and >1.0 mm diameter) than in smaller aggregates, at least during the first 200 days of incubation. The greater N immobilization activity is consistent with gross N immobilization rates measured by 15N isotope dilution (Muruganandam et al., 2010). All the physical dissection methods described so far depend upon collecting enough soil to use IRMS approaches without the addition of a “spike” of N (Fig. 4.3). It is tempting to think that one could physically
Nitrogen Cycling at Millimeter Scales
101
separate smaller samples, for example, by sampling a transect through a soil aggregate (Fig. 4.4C), as has been done for ammonia- and nitrite-oxidizing bacteria or the mineralization of a 14C-labeled herbicide (Gonod et al., 2006; Grundmann and Debouzie, 2000). Calculations suggest that, with current technology, this could be scaled down to a sample of 2 mm in linear dimension (Fig. 4.3). Other methods, such as secondary ion mass spectrometry (SIMS), are necessary to examine finer-scale resolution of N mineralization or assimilation.
3.3. Applications of SIMS analysis to soil microhabitats SIMS has the potential to provide quantitative measures of N assimilation at the single-cell scale; however, relatively few SIMS studies have been carried out in microbiological systems, with only a handful of applications in soil (Blair et al., 2006; Clode et al., 2009; Cliff et al., 2002, 2007; DeRito et al., 2005; Herrmann et al., 2007a,b; Pumphrey et al., 2009). In SIMS imaging, a highly charged ion beam is used to sputter a sample surface, causing secondary ions that are derived from the sample’s upper layers to be emitted (Fig. 4.5). When these ions are separated by their mass/charge ratio and detected, a quantitative ion map of the sputtered area is created. There are two broad classes of SIMS instruments used to study N dynamics in soils: time-of-flight (ToF) and dynamic (magnetic sector) SIMS. In ToF-SIMS, a primary ion beam is pulsed and resulting secondary ions are detected based on their mass-to-charge ratio and the time an ion takes to reach the detector. Although ToF-SIMS has the capacity to measure the full mass spectrum and detect molecular species, its design can require the user to compromise between high spatial resolution and mass resolving power (see reviews by Jacoby, 2006; Lockyer and Vickerman, 2004). With dynamic SIMS (e.g., the Cameca 3f, 5f, and NanoSIMS), N assimilation can be quantitatively measured with up to 50-nm resolution, typically after a cell culture or environmental sample has been exposed to a continuous or pulsechase 15N-labeling experiment. The highest spatial resolution is accomplished by visualizing 15N distribution with either the NanoSIMS 50 or 50 L ion microprobe (Cameca, Gennevilliers, France). Because N ionizes poorly alone, N must be detected as part of the cyanide (12C14N or 12C15N) polyatomic ion. In a ratio image of the 12C15N:12C14N ion maps, an 15N enrichment greater than the natural 15N abundance ratio of 0.37 atom% suggests that the cell, particle, or subcellular region assimilated “new” N during the labeling period. MALDI-ToF (matrix assisted laser desorption/ ionization ToF mass spectrometry) is one additional non-SIMS imaging technique that may also be useful for fine-scale imaging of N uptake. However, this type of analysis, where a laser is used to desorb surface molecules that are then detected by a ToF spectrometer, has so far been used primarily for biomolecule imaging in tissue and organs (reviewed by Burnum et al., 2008; McDonnell and Heeren, 2007) as opposed to soils.
102
David D. Myrold et al.
To mass spectrometer
Analysis beam sources (Cs+, O–)
– –
–
y ar nd o c
s ion
Sec – on da ry
io n
s
Se
–
Cs+
+ e–
–
e–
–
–
e– e– + – e– e–
e– –
Sample n
tio
e–
ec oll
M
d
12
C
19
F
-c lti
u
+
rs
to
c ete 31
P
32
S
35
Cl
Sample surface
50 nm beam diameter under ideal conditions
Figure 4.5 NanoSIMS instrument schematic. The left panel depicts the NanoSIMS sputtering process where primary ions (Csþ in this case) impact the sample surface, and secondary ions derived from the sample’s upper layers are extracted coaxial to the primary ion beam. The right panel shows an overview of the entire instrument, following the ion path from the primary ion source, to sample chamber, through the magnetic sector and ultimately secondary ion detection by a series of five electron multiplier detectors. Courtesy of Cameca (Gennevilliers, France), as modified by Dr. Peter Weber (Lawrence Livermore National Laboratory, USA).
ToF-SIMS and MALDI-ToF may be particularly useful for questions where the spatial scale of interest ranges between 100 mm and 1 cm (Fig. 4.4; e.g., in micro-and some macroaggregates), or where the molecular fate of assimilated 15N is of interest. For finer scale applications (e.g., single cells or colonies, bacteria–mineral interactions, <100 mm microaggregates), NanoSIMS imaging has a number of advantages: high sensitivity (1 in 20 N atoms are detected), ability to measure concurrent data for multiple (5–7) elements/isotopes, and high mass specificity (e.g., allowing the user to distinguish 12C15N from 13C14N at mass 27) while retaining high resolution (50 nm; Boxer et al., 2009; Lechene et al., 2006). Although NanoSIMS is still an emerging technology, it allows the investigator to quantitatively visualize such fine-scale differences in N uptake as those between bacteria in the endosphere, rhizosphere, or ectosphere of plant roots exposed to 15 NH4þ (Clode et al., 2009). These differences would never be discernable with bulk IRMS analysis. Access to these instruments is currently limited ( 20 exist worldwide, with 8 instruments focused on biological samples);
Nitrogen Cycling at Millimeter Scales
103
however, multiple new instruments are being installed each year. As this approach has the potential to provide valuable insights into the interactions between microbial diversity and soil N cycling, we focus on it here. The rate of new N uptake may be quantitatively determined with NanoSIMS analysis following an 15N tracer experiment where samples were exposed to 15N2, 15NH4þ, or other 15N-labeled substrate. Exposure periods should be kept brief relative to best estimates of the doubling time of microbial populations being studied and subsamples should be harvested at multiple time points during the isotope incubation in order to measure and minimize recycling and leakage, which can approach 35% of newly fixed N (Ploug et al., 2010). As the NanoSIMS measures total N, and does not discriminate between N derived from NO3, NH4þ, or amino pools, measurements yield net N uptake only, not gross assimilation. The amount of N lost from a cell due to secondary metabolite production, denitrification, passive leakage, or sample preparation effects cannot be precisely measured with NanoSIMS analysis. Indeed, it is important to remember that the instrument measures total N ionized, without discerning between organic and inorganic sources. If we define N assimilation strictly as the uptake of N and its conversion into cellular organic N forms, NanoSIMS measurements will bulk all new 15N taken up regardless of whether the organism has utilized it for organic biosynthesis or not. By contrast, with ToF-SIMS analyses, enrichment of NO3, NH4þ, and amino pools can be measured independently; this allowed Cliff et al. (2007) to measure microspatial patterns in gross N assimilation and mineralization in a model soil system— following the Kirkham and Bartholomew model described in detail above. In some situations, such as a cell culture where one may collect multiple replicate samples under controlled conditions, net N assimilation may be nearly equal to gross N assimilation. Using 99.99 atom% NaH13CO3 and 15 N2 as cyanobacterial substrates, Popa et al. (2007) and Finzi-Hart et al. (2009) demonstrated that NanoSIMS can be used to isolate subcellular regions of high N2-fixation activity, as well as storage locations, mobilization, and assimilation rates of newly fixed N in cyanobacteria. To calculate atom% 15 N excess (APE), they measured the initial N isotopic ratios of the culture at T0 (Ri) and the isotopic ratio of the labeled cells (Rf): APE ¼ ½Rf =ðRf þ 1Þ Ri =ðRi þ 1Þ 100%
ð4:1Þ
Net-fixation (Fxnet) or the percentage of N assimilation into the cells relative to their initial N content was calculated as Fxnet ¼ ðFs =Fi Þ 100%;
ð4:2Þ
where Fi is the fraction of N in the sampled cells derived from the initial cellular N content and Fs is the fraction of N in the sampled cells taken up
104
David D. Myrold et al.
from the spiked 15N pool. These and many other NanoSIMS studies (Clode et al., 2009; Halm et al., 2009; Herrmann et al., 2007a,b; Musat et al., 2008) document a high level of microheterogeneity in N assimilation at the singlecell level, which, while not surprising, was heretofore unknown. In a rhizosphere exposed briefly to 15NH4þ, Clode et al. (2009) found individual cells varied in N uptake by up to 110% relative to each other (more than 5s). The vagaries of microedaphic and genetic factors that underlie this phenomenon may be scientifically interesting—yet this cell–cell variability is also a potential problem for NanoSIMS isotopic imaging that must be overcome by adequate replication of analysis locations. With pure cultures, 5–20 individual cells/time point may be adequate to characterize the N uptake rates for the entire population (Finzi-Hart et al., 2009; Peteranderl and Lechene, 2004; Popa et al., 2007). Quantitative measurements of net N assimilation can be more difficult to achieve at small spatial scales in mixed, natural systems such as soils and sediments. In such settings, where it is not possible to know the starting total N pool that is being enriched or that an isotope tracer is homogeneously distributed, 15N tracer experiments can still provide qualitative or “potential” estimates of N immobilization for individual taxa (Musat et al., 2008; Ploug et al., 2010), can distinguish treatment effects or spatial gradients (Cliff et al., 2007; Orphan et al., 2009), and can provide evidence of symbiotic interactions. The arena of trophic and symbiotic relationships may be one of the more fruitful avenues for future NanoSIMS research on N assimilation. For example, Lechene et al. (2007) demonstrated that in some shipworms, symbiotic bacteria fix N2 that is then used by their eukaryal host cell for metabolism. In another example, Orphan et al. (2009) showed that in marine methane-oxidizing aggregates, the methanotrophic archaea member of the consortia assimilated far more N than its symbiotic sulfate reducing partner. Finally, in a study of arbuscular mycorrhizal transport of N and C to plant roots from 15N/13C enriched soil organic matter, Herman et al. (in review) were able to quantify hyphal 15N assimilation and transport to host roots at both the macro- (IRMS) and microscale (Fig. 4.6). Silicates, clays, and Fe/Al oxide minerals make it additionally challenging to apply similar experiments in soil matrices because they make it difficult to embed and thin-section soil samples (Fig. 4.7), and also cause electrical charging effects (Cliff et al., 2002). To date, a small number of proof-of-concept studies have showed that 15N isotope additions can be imaged by NanoSIMS within a natural or synthetic soil matrix. Herrmann et al. (2007a,b) used NanoSIMS to locate previously 15N-labeled Pseudomonas fluorescens cells within a sterilized sand matrix and found significant variability in N isotopic enrichment from cell to cell. In a rhizosphere system incubated with added 15NH4þ, Clode et al. (2009) also found variability as different bacterial cells took up the 15N label to differing degrees. In those that did incorporate the 15NH4þ, up to 50% of the cell
105
Nitrogen Cycling at Millimeter Scales
15
14
SE
N
d N ‰
d 15N
30000 25714
6021 AM Hyphae
1756
17142
23261
12856
26804 Secondary root laying across surface
21428
2307
Main root surface
8570 4284
AM Hyphae
2 um 0
Figure 4.6 NanoSIMS images from the surface of a Plantago root infected with Glomus hoi arbuscular mycorrhizal fungi. Fungi had access to 15N and 13C enriched soil organic matter (root did not). From left to right, total ion counts for 14N displayed in grayscale (white ¼ highest counts); NanoSIMS secondary electron image; ratio of 12 15 C N:12C14N images indicating areas of isotopic enrichment. Values superimposed on ratio image indicate 15N enrichment for subregions labeled on 14N image. The regions circled with white outlines represent the background—or main root surface. Courtesy of coauthor Pett-Ridge (Lawrence Livermore National Laboratory, USA) and Dr. Angela Hodge (University of York, UK).
N was newly assimilated. One of the few studies to have moved beyond these proof-of-principle tests used ToF-SIMS to study small-scale differences in N assimilation as a function of C versus N limitation (Fig. 4.8; Cliff et al., 2002). They qualitatively followed 15N and 13C incorporation into soil microorganisms, using an analysis regime balancing spatial resolution with high mass specificity. When they compared SIMS values with bulk-measured microbial biomass N assimilation, they found substantial spatial heterogeneity in 15N distribution that was not apparent through bulk analysis (Cliff et al., 2007). The same concept could certainly be applied with 15N-labeled plant materials—to track microbial and aggregate immobilization of plant-derived N in soil. 3.3.1. Combining N assimilation with microbial identification Many studies of microbial function in the environment aim to link phylogenetic identity and metabolic activity of individual cells. Indeed, the first significant microbiological SIMS study (Orphan et al., 2001) showed SIMS could be used to measure C assimilation, the source of C, and the taxa involved using FISH (fluorescent in situ hybridization). This can be accomplished in situ with a technique combining NanoSIMS imaging and rRNAbased in situ hybridization, called “El-FISH” or “FISH-SIMS” (Behrens et al., 2008; Li et al., 2008; Musat et al., 2008). In this approach, fluorine or bromine atoms are introduced into cells via 16S rRNA-targeted probes or in situ hybridization with halogen-labeled tyramides, enabling phylogenetic identification of individual cells by NanoSIMS imaging. This novel approach could potentially facilitate studies of the ecophysiology of known
106
David D. Myrold et al.
B
A
2 um
C
2 um
15
N
500 nm
F
E
D
0.2 um
0.2 um
0.2 um
Figure 4.7 Soil aggregate from a sandy soil amended with 13C and 15N-labeled Pinus ponderosa fine roots and needles. (A) Montage of multiple transmission electron microscopy images (FEI Tecnai 12 120 KV Transmission Electron Microscope) of a single soil aggregate, embedded in sulfur, and microtomed to 200 nm; (B) higher resolution TEM, (C) 12C15N NanoSIMS image of putative fungal hyphae (16 mm field of view; area is indicated in (A)). Its relatively low phosphorus (P) content (data not shown) suggests that this feature may be a ‘ghost hyphae’, that is, the shell marking where live tissue once existed. (D–F) Higher resolution TEM images of likely organic particle and bacterial cells; areas are indicated relative to image in (A). Reproduced from Herrmann et al. (2007a,b).
and uncultured microorganisms in soil; however, it will need to overcome several methodological barriers, including background autofluorescence. 3.3.2. Sample preparation for SIMS SIMS experiments must be custom designed based on the hypotheses being tested, the sample matrix, and the amount of analysis time available. Analysis is performed under ultrahigh vacuum; therefore, samples must be dry, relatively flat, and vacuum stable. Sample preparation methods that preserve both the quantitative and spatial distribution of N within cells are essential. When N assimilation has resulted in the accumulation of NO3, NH4þ, or amino acids in a cell, but not yet proceeded to biosynthesis, there is a risk that these diffusible ions can be lost during sample preparation. Chemical fixation appears to attenuate this effect by cross-linking proteins, purines, and pyrimidines, and retaining at least as much newly fixed N in a cell as freeze drying (Peteranderl and Lechene, 2004). Still, the techniques used in
107
Nitrogen Cycling at Millimeter Scales
B
17
A 18 10
20
10 19
Straw
9
10
Manure
Figure 4.8 Secondary electron image (A) and light micrograph (B) of an Si contact slide that was in contact with a model soil system. The system consisted of a straw–manure interface on kaolinite to which 15NO3was added. The area in panel A is bracketed in yellow in panel B. Dark, electron-poor sputtered areas in panel A are represented by white boxes in panel B. The values adjacent to the analysis areas are the atom% 15N of the region of interest of the fungal hyphae (shaded red). The dashed line represents the straw–manure interface. Note the greater 15N assimilation by the hyphae growing on the C-rich, N-poor straw compared to the N-rich manure. Bar ¼ 100 mm. Reproduced from Cliff et al. (2002).
electron microscopy (such as fast freezing followed by low temperature dehydration) would appear to be the most prudent approach. Other standard electron microscopy techniques, such as chemical fixation (e.g., 2% glutaraldehyde to stabilize biological membranes), cell filtering, resin embedding (LR White, epoxy resin Araldite 502, or sulfur) combined with ultramicrotomy, or simple air drying may suffice for stable samples (see Herrmann et al., 2007a,b for detailed embedding methods). If intact soils need to be sectioned, a diamond knife or diamond saw is necessary to cut through particles with heterogeneous density. For pure cultures or biofilms, samples should be repeatedly washed with Milli-Q H2O and transferred onto a silica chip (or other conductive smooth surface), and dried and coated with a thin conductive layer (5–20 nm) of Au, Ir, or C prior to analysis. Regardless of the sample preparation, evaluation of sample quality, topography, and morphology with high-resolution light microscopy, SEM, or TEM is critical prior to SIMS analysis. 3.3.3. NanoSIMS instrument use For analyses, an 1–5 pA Csþ primary beam should be focused to a spot size of 50–150 nm and stepped over the sample in a 128 128 pixel raster (for 1–10 mm2) or 256 256 pixel raster (for 10–30 mm2) to generate secondary ions for quantification. Dwell time is typically 1 ms per pixel and,
108
David D. Myrold et al.
although the typical raster size ranges from 5 to 50 mm2, mapping of larger areas is possible by digitally stitching multiple individual rasters together (e.g., Clode et al., 2009; Lechene et al., 2007). The SIMS instrument must be tuned for 6800 mass resolving power to resolve isobaric interferences at mass 27. Data may be collected for up to seven (with the NanoSIMS 50 L) secondary ions (e.g., 12C, 13C, 16O, 12C14N, 12C15N, 28Si, 31P) in simultaneous collection mode. Enough serial secondary ion images (i.e., layers) should be collected to achieve consistent ion yields and isotope ratios with sputtering depth. The depth of a typical analysis ranges between 50 and 200 nm and is controlled by the energy of the primary beam and the length of the analysis time (see Ghosal et al., 2008 for depth of analysis calculations). For reference, the sample should also be imaged simultaneously by secondary electrons detected by a photomultiplier. To achieve sputtering equilibrium, samples should be presputtered to a depth of 100 nm. Measurements should be repeated on multiple cells or regions of the sample to ensure accuracy and capture natural variations in N uptake. Data can be processed as quantitative isotopic ratio images using image processing software such as Cameca’s proprietary WinImage, or the MIMS plugin for ImageJ freeware (http://www.nrims.hms.harvard.edu/NRIMS_ImageJ. php), and corrected for detector dead-time and image shifts from layer to layer. Individual bacterial cells or other particles of interest may be defined as “regions of interest” (ROI), and the isotopic composition for each ROI can be calculated by averaging over all the replicate layers. Reference materials should be used as calibration standards for isotopic measurements; options include samples from microcosms where no 13C or 15N was applied, well-characterized preparations of homogeneous bioparticles (e.g., Behrens et al., 2008), or pulverized bovine liver sample (NIST SRM 1577b). Precision of 2s should be determined for individual measurements; typically measurement precision for cell cultures is 0.4–1.4% (2s) for individual 15N/14N measurements, and analytical precision of standard materials is 2.1% (2s) for an individual measurement (Popa et al., 2007). Precision for replicate analyses should be calculated by appropriate error propagation techniques. As with any technique, the user should be aware of potential issues that can compromise the quality of NanoSIMS data. Charging is the most common artifact affecting SIMS analyses of soil samples, which frequently comprise insulating materials. Although the organic constituents of soil may act as semiconductors, most mineral particles are electrically insulating and will require (at least) a 5–20 nm coating of Au, Ir, C, or other high-purity conductive material, and (commonly) the use of the electron flood gun to provide charge compensation at the sample surface. During exploratory analyses on a new sample type, the user should also sputter at high-beam currents between repeat measurements to determine if isotopic composition changes with depth.
Nitrogen Cycling at Millimeter Scales
109
4. Conclusions Measurements of N mineralization and assimilation require the use of N, employed either by isotope dilution or as a tracer. In soil microhabitats, such as the rhizosphere, detritusphere, and soil aggregates, the method of 15 N isotope dilution can be scaled down to measure N mineralization in samples as small as 100 mg; N assimilation can be measured by IRMS in 10-mg samples of soil. This corresponds to microhabitats with linear dimensions of >2 mm. At smaller spatial scales, it is necessary to use SIMS, which can measure the uptake and assimilation of 15N into microorganisms and allow visualization of cell–cell interactions, but cannot measure N mineralization. Clearly, there are trade-offs between the use of the 15N isotope pool dilution approach (which yields bulk-scale gross N immobilization, but little insight into microscale controlling factors) and 15N stable isotope probing with SIMS (which can measure gross N assimilation at high spatial resolution, though at a significant cost). Given the right experimental design, this method may provide new insights into the primary factors controlling N assimilation at the microscale (e.g., moisture content and temperature), as well as biotic factors ranging from spatial distribution of active microorganisms, association of microorganisms with particular minerals, roles of filamentous fungi in mediating transport of N and other elements, and distribution/impact of N2-fixing soil microbes. To date, studies have demonstrated that N mineralization and assimilation can vary at small scales and that the balance between these opposing processes can be influenced by C inputs from roots or decaying plant materials. It is also likely that synergistic or competitive interactions among microorganisms (e.g., bacteria growing in association with fungal hyphae) affect the balance between N mineralization and assimilation, but demonstration of this possibility awaits future applications of SIMS imaging methods coupled with well-designed 15N labeling experiments. 15
REFERENCES Andersen, M. K., and Jensen, L. S. (2001). Low soil temperature effects on short-term gross N mineralisation-immobilisation turnover after incorporation of a green manure. Soil Biol. Biochem. 33, 11–521. Angers, D. A., Recous, S., and Aita, C. (1997). Fate of carbon and nitrogen in water-stable aggregates during decomposition of 13C15N-labelled wheat straw in situ. Eur. J. Soil Sci. 48, 295–300. Barrie, A., and Prosser, S. J. (1996). Automated analysis of light-element stable isotopes by isotope ratio mass spectrometry. In “Mass Spectrometry of Soils,” (T. W. Boutton and S. I. Yamsaki, eds.), pp. 1–46. Marcel Dekker, Inc., New York, NY.
110
David D. Myrold et al.
Baumann, K., Marschner, P., Smernik, R. J., and Baldock, J. A. (2009). Residue chemistry and microbial community structure during decomposition of eucalypt, wheat and vetch residues. Soil Biol. Biochem. 41, 1966–1975. Beare, M. H., Coleman, D. C., Crossley, D. A., Hendrix, P. F., and Odum, E. P. (1995). A hierarchical approach to evaluating the significance of soil biodiversity to biogeochemical cycling. Plant Soil 170, 5–22. Behrens, S., Losekann, T., Pett-Ridge, J., Weber, P. K., Ng, W. O., Stevenson, B. S., Hutcheon, I. D., Relman, D. A., and Spormann, A. M. (2008). Linking microbial phylogeny to metabolic activity at the single-cell level by using enhanced element labeling-catalyzed reporter deposition fluorescence in situ hybridization (EL-FISH) and NanoSIMS. Appl. Environ. Microbiol. 74, 3143–3150. Blair, N., Prince, K. E., Faulkner, R. D., and Till, A. R. (2006). Using the scanning electron microprobe and secondary ion mass spectrometry to locate 14C- and 13C-labelled plant residues within soil aggregates. Scanning 28, 259–266. Boxer, S. G., Kraft, M. L., and Weber, P. K. (2009). Advances in imaging secondary ion mass spectrometry for biological samples. Annu. Rev. Biophys 38, 53–74. Breland, T. A., and Bakken, L. R. (1991). Microbial growth and nitrogen immobilization in the root zone of barley (Hordeum vulgare L.), Italian ryegrass (Lolium multiflorum Lam.), and white clover (Trifolium repens L.). Biol. Fertil. Soils 12, 154–160. Brookes, P. C., Landman, A., Pruden, G., and Jenkinson, D. S. (1985). Chloroform fumigation and the release of soil nitrogen: A rapid direct extraction method to measure microbial biomass nitrogen in soil. Soil Biol. Biochem. 17, 837–842. Burnum, K. E., Frappier, S. L., and Caprioli, R. M. (2008). Matrix-assisted laser desorption/ ionization imaging mass spectrometry for the investigation of proteins and peptides. Annu. Rev. Anal. Chem. 1, 689–705. Chen, J., and Stark, J. M. (2000). Plant species effects and carbon and nitrogen cycling in a sagebrush-crested wheatgrass soil. Soil Biol. Biochem. 32, 47–57. Cliff, J. B., Gaspar, D. J., Bottomley, P. J., and Myrold, D. D. (2002). Exploration of inorganic C and N assimilation by soil microbes with time-of-flight secondary ion mass spectrometry. Appl. Environ. Microbiol. 68, 4067–4073. Cliff, J. B., Bottomley, P. J., Gaspar, D. J., and Myrold, D. D. (2007). Nitrogen mineralization and assimilation at millimeter scales. Soil Biol. Biochem. 39, 823–826. Clode, P. L., Kliburn, M. R., Jones, D. L., Stockdale, E. A., Cliff, J. B., III, Herrmann, A. M., and Murphy, D. V. (2009). In situ mapping of nutrient uptake in the rhizosphere using nanoscale secondary ion mass spectrometry. Plant Physiol. 151, 1751–1757. Davidson, E. A., Hart, S. C., Shanks, C. A., and Firestone, M. K. (1991). Measuring gross nitrogen mineralization, immobilization, and nitrification by N-15 isotopic pool dilution in intact soil cores. J. Soil Sci. 42, 335–349. Dechesne, A., Pallud, C., Debouzie, D., Flandrois, J. P., Vogel, T. M., Gaudet, J. P., and Grundmann, G. L. (2003). A novel method for characterizing the microscale 3D spatial distribution of bacteria in soil. Soil Biol. Biochem. 35, 1537–1546. Dechesne, A., Pallud, C., and Grundmann, G. L. (2007). Spatial distribution of bacteria at the microscale in soil. In “The Spatial Distribution of Microbes in the Environment,” (R. B. Franklin and A. L. Mills, eds.), pp. 88–107. Springer, Dordrecht, The Netherlands. DeRito, C. M., Pumphrey, G. M., and Madsen, E. L. (2005). Use of field-based stable isotope probing to identify adapted populations and track carbon flow through a phenol degrading soil microbial community. Appl. Environ. Microbiol. 78, 58–65. Dessaux, Y., Hinsinger, P., and Lemanceau, P. (2010). Rhizosphere: Achievements and Challenges. Springer, Dordrecht, The Netherlands, 538 pp. Elliot, E. T. (1986). Aggregate structure and carbon, nitrogen, and phosphorus in native and cultivated soils. Soil Sci. Soc. Am. J. 50, 627–633.
Nitrogen Cycling at Millimeter Scales
111
Finzi-Hart, J. A., Pett-Ridge, J., Weber, P. K., Popa, R., Fallon, S. J., Gunderson, T., Hutcheon, I. D., Nealson, K. H., and Capone, D. G. (2009). Fixation and fate of C and N in the cyanobacterium Trichiodesmium using nanometer-scale secondary ion mass spectrometry. Proc. Natl. Acad. Sci. USA 106, 6345–6350. Gaillard, B., Chenu, C., Recous, S., and Richard, G. (1999). Carbon, nitrogen and microbial gradients induced by plant residues decomposing in soil. Eur. J. Soil Sci. 50, 567–578. Ghosal, S., Fallon, S. J., Leighton, T., Wheeler, K. E., Hutcheon, I. D., and Weber, P. K. (2008). Imaging and 3D elemental characterization of intact bacterial spores with highresolution secondary ion mass spectrometry (NanoSIMS) depth profile analysis. Anal. Chem. 80, 5986–5992. Gonod, L. V., Chadoeug, J., and Chenu, C. (2006). Spatial distribution of microbial 2, 4-dichlorophenoxy acetic acid mineralization from field to microhabitat scales. Soil Sci. Soc. Am. J. 70, 64–71. Grundmann, G. L., and Debouzie, D. (2000). Geostatistical analysis of the distribution of NH4þ and NO2–-oxidizing bacteria and serotypes at the millimeter scale along a soil transect. FEMS Microbiol. Ecol. 34, 57–62. Halm, H., Musat, N., Lam, P., Langlois, R., Musat, F., Peduzzi, S., Lavik, G., Schubert, C., Singha, B., LaRoche, J., and Kuypers, M. (2009). Co-occurence of denitrification and nitrogen fixation in a meromictic lake, Lake Cadagno (Switzerland). Environ. Microbiol. 11, 1945–1958. Hart, S. C., and Myrold, D. D. (1996). 15N tracer studies of soil nitrogen transformations. In “Mass Spectrometry of Soils,” (T. W. Boutton and S. I. Yamsaki, eds.), pp. 225–245. Marcel Dekker, Inc., New York, NY. Hart, S. C., Stark, J. M., Davidson, E. A., and Firestone, M. K. (1994). Nitrogen mineralization, immobilization, and nitrification. In “Methods of Soil Analysis, Part 2. Microbiological and Biochemical Properties,” (R. W. Weaver, S. Angle, P. Bottomley, D. Bezdicek, S. Smith, A. Tabatabai, and A. Wollum, eds.), pp. 985–1018. Soil Science Society of America, Madison, WI. Hatch, D. J., Jarvis, S. C., Parkinson, R. J., and Lovell, R. D. (2000). Combining field incubation with nitrogen-15 labelling to examine nitrogen transformations in low to high intensity grassland management systems. Biol. Fertil. Soils 30, 492–499. Hawkes, C. V., DeAngelis, K. M., and Firestone, M. K. (2007). Root interactions with soil microbial communities and processes. In “The Rhizosphere: An Ecological Perspective,” (Z. G. Cardon and J. L. Whitbeck, eds.), pp. 1–29. Academic Press, New York, NY. Herman, D. J., Johnson, K. K., Jaeger, C. H., III, Schwartz, E., and Firestone, M. K. (2006). Root influence on nitrogen mineralization and nitrifications in Avena barbata rhizosphere soil. Soil Sci. Soc. Am. J. 70, 1504–1511. Herman, D. J., Firestone, M. K., Pett-Ridge, J., Nuccio, E., and Hodge, A. (in review). Microbial community utilization of carbon and nitrogen from decomposing root Litter: Effects of an arbuscular mycorrhizal fungus. FEMS Microbiol. Ecol. Herrmann, A. M., Clode, P. L., Fletcher, I. R., Nunan, N., Stockdale, E. A., O’Donnel, A. G., and Murphy, D. V. (2007a). A novel method for the study of the biophysical interface in soils using nano-scale secondary ion mass spectrometry. Rapid Commun. Mass Spectrom. 21, 29–34. Herrmann, A. M., Ritz, K., Nunan, N., Clode, P. L., Pett-Ridge, J., Kilburn, M. R., Murphy, D. V., O’Donnell, A. G., and Stockdale, E. A. (2007b). Nano-scale secondary ion mass spectrometry—A new analytical tool in biogeochemistry and soil ecology: A review article. Soil Biol. Biochem. 39, 1835–1850. Herron, P. M., Stark, J. M., Holt, C., Hooker, T., and Cardon, Z. G. (2009). Microbial growth efficiencies across a soil moisture gradient assessed using 13C-acetic acid vapor and 15 N-ammonia gas. Soil Biol. Biochem. 41, 1262–1269.
112
David D. Myrold et al.
Inselsbacher, E., Umana, N. H. N., Stange, F. C., Gorfer, M., Schu¨ller, E., Ripka, K., Zechmeister-Boltenstern, S., Hood-Novotny, R., Strauss, J., and Wanek, W. (2010). Short-term competition between crop plants and soil microbes for inorganic N fertilizer. Soil Biol. Biochem. 42, 360–372. Jacoby, M. (2006). Bioimaging with mass spectrometry. Chem. Eng. News 84, 55–56. Jastrow, J. D., and Miller, R. M. (1998). Soil aggregate stabilization and carbon sequestration: Feedbacks through organomineral associations. In “Soil Processes and the Carbon Cycle,” (R. Lal, J. M. Kimble, R. F. Follett, and B. A. Stewart, eds.), pp. 207–223. CRC Press LLC, Boca Raton, FL. Jones, D. L., Nguyen, C., and Finlay, R. D. (2009). Carbon flow in the rhizosphere: Carbon trading at the soil-root interface. Plant Soil 321, 5–33. Kaye, J. P., and Hart, S. C. (1997). Competition for nitrogen between plants and soil microorganisms. Trends Ecol. Evol. 12, 139–143. Kirkham, D., and Bartholomew, W. V. (1954). Equations for following nutrient transformations in soil, utilizing tracer data. Soil Sci. Soc. Am. Proc. 18, 33–34. Kirkham, D., and Bartholomew, W. V. (1955). Equations for following nutrient transformations in soil, utilizing tracer data: II. Soil Sci. Soc. Am. Proc. 19, 189–192. Lechene, C., Hillion, F., McMahon, G., Benson, D., Kleinfeld, A. M., Kampf, J. P., Distel, D., Luyten, Y., Bonventre, J., Hentschel, D., Park, K. M., Ito, S., et al. (2006). High-resolution quantitative imaging of mammalian and bacterial cells using stable isotope mass spectrometry. J. Biol. 5, 20. Lechene, C. P., Luyten, Y., McMahon, G., and Distel, D. L. (2007). Quantitative imaging of nitrogen fixation within animal cells. Science 317, 1563–1566. Ledgard, S. F., Jarvis, S. C., and Hatch, D. J. (1998). Short-term nitrogen fluxes in grassland soils under different long-term management regimes. Soil Biol. Biochem. 30, 1233–1241. Li, T., Wu, T. D., Mazeas, L., Toffin, L., Guerquin-Kern, J. L., Leblon, G., and Bouchez, T. (2008). Simultaneous analysis of microbial identity and function using NanoSIMS. Environ. Microbiol. 10, 580–588. Lockyer, N. P., and Vickerman, J. C. (2004). Progress in cellular analysis using ToF-SIMS. Appl. Surf. Sci. 212–232, 377–384. Luster, J., Go¨ttlein, A., Nowack, B., and Sarret, G. (2009). Sampling, defining, characterising and modeling the rhizosphere-the soil science tool box. Plant Soil 321, 457–482. Magid, J., De Neergaard, A., and Brandt, M. (2006). Heterogeneous distribution may substantially decrease initial decomposition, long-term microbial growth and N-immobilization from high C-to-N ratio resources. Eur. J. Soil Sci. 57, 517–529. Ma˚nsson, K., Bengtson, P., Falkengren-Grerup, U., and Bengtsson, G. (2009). Plant-microbial competition for nitrogen uncoupled from soil C:N ratios. Oikos 118, 1908–1916. Manzoni, S., Porporato, A., and Schimel, J. P. (2008). Soil heterogeneity in lumped mineralization-immobilization models. Soil Biol. Biochem. 40, 1137–1148. Mary, B., Recous, S., and Robin, D. (1998). A model for calculating nitrogen fluxes in soil using 15N tracing. Soil Biol. Biochem. 30, 1963–1979. McDonnell, L. A., and Heeren, R. M. A. (2007). Imaging mass spectrometry. Mass Spectrom. Rev. 26, 606–643. McMahon, S. K., Williams, M. A., Bottomley, P. J., and Myrold, D. D. (2005). Dynamics of microbial communities during decomposition of carbon-13 labeled ryegrass fractions in soil. Soil Sci. Soc. Am. J. 69, 1238–1247. Mendes, I. C., Bandick, A. K., Dick, R. P., and Bottomley, P. J. (1999). Microbial biomass and activities in soil aggregates affected by winter cover crops. Soil Sci. Soc. Am. J. 63, 873–881. Mu¨ller, C., Ru¨tting, T., Kattge, J., Laughlin, R. J., and Stevens, R. J. (2007). Estimation of parameters in complex 15N tracing models by Monte Carlo sampling. Soil Biol. Biochem. 39, 715–726.
Nitrogen Cycling at Millimeter Scales
113
Murphy, D. V., Fillery, I. R. P., and Sparling, G. P. (1997). Method to label soil cores with 15 NH3 gas as a prerequisite for 15N isotopic dilution and measurement of gross N mineralization. Soil Biol. Biochem. 29, 1731–1741. Murphy, D. V., Recous, S., Stockdale, E. A., Fillery, I. R. P., Jensen, L. S., Hatch, D. J., and Goulding, K. W. T. (2003). Gross nitrogen fluxes in soil: Theory, measurements and application of 15N pool dilution techniques. Adv. Agron. 79, 69–118. Muruganandam, S., Israel, D. W., and Robarge, W. P. (2009). Activities of nitrogenmineralization enzymes associated with soil aggregate size fractions of three tillage systems. Soil Sci. Soc. Am. J. 73, 751–759. Muruganandam, S., Israel, D. W., and Robarge, W. P. (2010). Nitrogen transformations and microbial communities in soil aggregates from three tillage systems. Soil Sci. Soc. Am. J. 74, 120–129. Musat, N., Halm, H., Winterholler, B., Hoppe, P., Peduzzi, S., Hillion, F., Horreard, F., Amann, R., Jorgensen, B. B., and Kuypers, M. M. M. (2008). A single-cell view on the ecophysiology of anaerobic phototrophic bacteria. Proc. Natl. Acad. Sci. USA 105, 17861–17866. Myrold, D. D., and Bottomley, P. J. (2008). Nitrogen mineralization and immobilization. In “Nitrogen in Agricultural Soils,” (W. Raun and J. S. Schepers, eds.), pp. 157–172. American Society of Agronomy, Madison, WI. Myrold, D. D., and Tiedje, J. M. (1986). Simultaneous estimation of several nitrogen cycle rates using 15N: Theory and application. Soil Biol. Biochem. 18, 559–568. Norton, J. M., and Firestone, M. K. (1996). N dynamics in the rhizosphere of Ponderosa pine seedlings. Soil Biol. Biochem. 28, 351–362. Nunan, N., Young, I. M., Crawford, J. W., and Ritz, K. (2007). Bacterial interactions at the microscale—linking habitat to function in soil. In “The Spatial Distribution of Microbes in the Environment,” (R. B. Franklin and A. L. Mills, eds.), pp. 61–85. Springer, Dordrecht, The Netherlands. Or, D., Smets, B. F., Wraith, J. M., Dechesne, A., and Friedman, S. P. (2007). Physical constraints affecting bacterial habitats and activity in unsaturated porous media—A review. Adv. Water Resour. 30, 1505–1527. Orphan, V. J., House, C. H., Hinrichs, K.-U., McKeegan, K. D., and DeLong, E. F. (2001). Methane-consuming Archaea revealed by directly coupled isotopic and phylogenetic analysis. Science 293, 484–487. Orphan, V. J., Turk, K. A., Green, A., and House, C. H. (2009). Patterns of 15N assimilation and growth of methanotrophic ANME-2 archaea and sulfate-reducing bacteria within structured syntrophic consortia revealed by FISH-SIMS. Environ. Microbiol. 11, 1777–1791. Peteranderl, R., and Lechene, C. P. (2004). Measure of carbon and nitrogen stable isotope ratios in cultured cells. J. Am. Soc. Mass Spectrom. 15, 478–485. Philippot, L., Hallin, S., Bo¨rjesson, G., and Baggs, E. M. (2009). Biochemical cycling in the rhizosphere having an impact on global change. Plant Soil 321, 61–81. Ploug, H., Musat, N., Adam, B., Moraru, C. L., Lavik, G., Vagner, T., Bergman, B., and Kuypers, M. M. (2010). Carbon and nitrogen fluxes associated with the cyanobacterium Aphanizomenon sp. in the Baltic Sea. ISME J. 4, 1–9. Popa, R., Weber, P. K., Pett-Ridge, J., Finzi, J. A., Fallon, S. J., Hutcheon, I. D., Nealson, K. H., and Capone, D. G. (2007). Carbon and nitrogen fixation and metabolite exchange in and between individual cells of Anabaena oscillarioides. ISME J. 1, 354–360. Pumphrey, G. M., Hanson, B. T., Chandra, S., and Madsen, E. L. (2009). Dynamic secondary ion mass spectrometry imaging of microbial populations utilizing C-13labelled substrates in pure culture and in soil. Environ. Microbiol. 11, 220–229. Recous, S., Aita, C., and Mary, B. (1999). In situ changes in gross N transformations in bare soil after addition of straw. Soil Biol. Biochem. 31, 119–133.
114
David D. Myrold et al.
Rousk, J., and Ba˚a˚th, E. (2007). Fungal and bacterial growth in soil with plant materials of different C/N ratios. FEMS Microbiol. Ecol. 62, 258–267. Schenk zu Schweinsberg-Mickan, M., Joergensen, R. G., and Mu¨ller, T. (2010). Fate of 13 C- and 15N-labelled rhizodeposition of Lolium perenne as a function of the distance to the root surface. Soil Biol. Biochem. 42, 910–918. Schimel, J. P., and Bennett, J. (2004). Nitrogen mineralization: Challenges of a changing paradigm. Ecology 85, 591–602. Sexstone, A. J., Revsbech, N. P., Parkin, T. B., and Tiedje, J. M. (1985). Direct measurement of oxygen profiles and denitrification rates in soil aggregates. Soil Sci. Soc. Am. J. 49, 645–651. Six, J., Elliott, E. T., and Paustian, K. (1999). Aggregate and soil organic matter dynamics under conventional and no-tillage agriculture. Soil Sci. Soc. Am. J. 63, 1350–1358. Stark, J. M., and Hart, S. C. (1996). Diffusion technique for preparing salt solutions, Kjeldahl digests, and persulfate digests for nitrogen-15 analysis. Soil Sci. Soc. Am. J. 60, 1846–1855. Tisdall, J. M., and Oades, J. M. (1982). Organic matter and water-stable aggregates in soils. J. Soil Sci. 33, 141–163. Wang, J. G., and Bakken, L. R. (1997). Competition for nitrogen during mineralization of plant residues in soil: Microbial response to C and N availability. Soil Biol. Biochem. 29, 163–170. Williams, M. A., Myrold, D. D., and Bottomley, P. J. (2007). Carbon flow from 13C-labeled clover and ryegrass residues into a residue-associated microbial community under field conditions. Soil Biol. Biochem. 39, 819–822.
C H A P T E R
F I V E
Measurement of Carbon Dioxide, Methane, Nitrous oxide, and Water Potential in Soil Ecosystems Martin E. Brummell and Steven D. Siciliano Contents 1. 2. 3. 4. 5. 6.
Introduction Soil Gas Probes Flux Estimates to the Atmosphere Using Recirculating Chambers Data Analysis Soil Profile Analysis FTIR Calibration 6.1. Recirculating versus static chambers 6.2. Absolute calibrations 7. Correlations Between Profile Concentrations and Surface Flux in Field Measurements 8. Correlations Between FTIR and Traditional Water Activity Measures 9. Common Issues During FTIR Measurement 9.1. Other sources of difficulty 10. Conclusions Acknowledgments References
116 122 125 125 127 128 128 129 129 132 132 134 134 135 135
Abstract New technologies in trace gas detection are revolutionizing our ability to study soil microbiological ecosystems. Field-deployable infrared-spectroscopy detectors capable of rapidly measuring multiple analyte gases simultaneously allow estimates of soil:atmosphere gas exchange and below-ground gas concentrations, and production dynamics across divergent ecosystems, creating opportunities to study interactions between microorganisms, soils, atmospheres, and global cycling, as well as interactions between different gases. The greenhouse gases CO2, CH4, and N2O can be measured in the field and compared to each other to uncover links between the biochemical pathways responsible for the Department of Soil Science, University of Saskatchewan, Saskatoon, Saskatchewan, Canada Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00005-1
#
2011 Elsevier Inc. All rights reserved.
115
116
Martin E. Brummell and Steven D. Siciliano
production and consumption of these gases. We have developed techniques using a nondestructive, Fourier-transform infrared detector under remote field conditions in three campaigns in the Canadian High Arctic to measure highly variable gas processes in soils.
1. Introduction Greenhouse gas (GHG) emissions from soils, primarily CO2, CH4, and N2O, are an important component of global emissions. Soils are responsible for a large fraction of CH4 and N2O emissions, and while CO2 is produced by plant roots as well as microorganisms and abiotic processes (Kuzyakov, 2006), CH4 and N2O are overwhelmingly the result of prokaryote and fungal metabolic pathways (Firestone and Davidson, 1989; Laughlin and Stevens, 2002). Methane has a global warming potential 40 times that of CO2 per mole, and N2O has a potential 300 times that of CO2. Measurement of the distribution and production of these gases is a critical step in understanding both how soil ecosystems contribute to and may react to climate change. The three major GHG emitted from soils are the end products, or in some cases by-products, of different biochemical pathways. Besides the weathering of carbonate minerals, CO2 production is the result of soil respiration, the sum total CO2 production by all soil organisms. Soil respiration is related to biomass, soil organic matter, nutrient limitation, temperature, and other factors (Davidson et al., 2000; Kuzyakov, 2006; Risk et al., 2002; Rustad et al., 2000; Smith et al., 2003). Much of the CO2 produced by soils may be consumed by photosynthesis, and highly productive ecosystems are net sinks for CO2 despite high levels of soil respiration (Gilmanov et al., 2010). While CO2 is not consumed below ground by soil organisms in significant quantities in most ecosystems (Kellman and Kavanaugh, 2008; Risk et al., 2002), both CH4 and N2O may be oxidized or reduced, respectively, by some functional groups of soil microorganisms depending on local and sometimes transient physical and chemical conditions (Smith et al., 2003). Methane is produced almost exclusively under very wet or saturated conditions, by methanogenic bacteria and archaea that may be either facultative or obligate anaerobes. Like CO2, CH4 production is linked to temperature but is more strongly related to soil water content (Conrad, 1989). Under more aerobic conditions, as are found near the surface in many soil ecosystems, populations of methanotrophs intercept CH4 diffusing upward from deeper, wetter layers (Galchenko et al., 1989; Whalen and Reeburgh, 2000).
Measurement of CO2, CH4, N2O, H2O Potential in Soil
117
Nitrous oxide is produced through several distinct biochemical pathways in soils. Nitrifying organisms release N2O during the reduction of NO2 when O2 is limiting (Firestone and Davidson, 1989; Firestone et al., 1980). Denitrifying organisms, in contrast, release N2O depending on the availability of electron donors (primarily organic carbon) and electron acceptors, often a range of N-oxides (Firestone and Davidson, 1989). Denitrification is the major source of N2O in soils ( Johnson et al., 2005), but due to the multiple contributing pathways and diverse organisms, rates of production may be high under wet conditions conducive to denitrification (e.g., Bedard-Haughn et al., 2006), or under drier conditions where both denitrification and nitrification may occur simultaneously (Davidson et al., 2000; Stevens et al., 1997); the composition of the microbial community may be as important to N2O emissions as environmental parameters such as water content or temperature (Bedard-Haughn et al., 2006). Nitrous oxide is reduced by denitrifiers under more strictly anaerobic conditions, when they use it as an electron acceptor in the absence of other electron acceptors such as O2 (McBride, 1994). Diffusion of N2O from regions of production to regions of consumption can occur in soils, especially where adjacent soil layers differ in water and oxygen content (Kellman and Kavanaugh, 2008). Surface flux estimates of N2O are particularly vulnerable to underestimation of N2O production due to transient or microhabitatassociated zones of consumption (Chapuis-Lardy et al., 2007). Soil GHG processes are highly variable and dynamic, and respond to physical and chemical conditions that may change rapidly. Measurement of GHG in situ is therefore critical for understanding actual dynamics under natural conditions and estimating landscape-scale emissions. There are two major approaches to measuring soil GHG in the field: collect samples and return them to the laboratory for analysis, or bring field-portable analytical instruments to the field site. Neither approach to field work is fundamentally superior, and different research programs will require different approaches depending on the scale of investigation, time available in the field, logistical constraints, and budget. Many studies of soil atmospheres have been conducted using the first approach, collecting gas samples in the field, and analyzing using sophisticated and powerful laboratory-based techniques. The most widely used technique includes the use of a gas chromatograph (GC) and electron capture detector. While some field-portable designs exist, most GC units never leave the lab. Gas samples collected from the field or from laboratory microcosm experiments are injected into the column and concentrations of CO2, CH4, N2O, and other gases are measured individually (Kabwe et al., 2005; Pennok et al., 2010; Siciliano et al., 2009). Sample collection in the field is most often conducted using syringes; a volume of gas is extracted from a chamber or soil probe and injected into a previously evacuated airtight container.
118
Martin E. Brummell and Steven D. Siciliano
The alternate approach, of bringing a field-portable analyzer to the field, introduces several additional sources of potentially disastrous error such as loss or failure of the instrument. Given the cost and delicacy of highly sensitive instruments, damage to the equipment is usually a primary concern of the research team. However, field-based analysis provides several advantages over a GCbased field study, most importantly that of the ability to examine and interpret results as soon as they are collected. This near-real-time feature of field-based analytical instruments allows very flexible study designs, and the researchers can react to unusual and unexpected situations and modify the study design accordingly; with the results unknown until after the end of the field campaign with a laboratory GC-based approach, such flexibility is not possible. Soil gas processes measured in the field fall into two broad categories: static measurement of in situ gas concentrations, often via a probe buried or inserted into the soil to a set depth, and flux measurements of the emission of gases from the soil surface to the atmosphere, either by chambers enclosing an area of soil, or by eddy-covariance towers. Both probes and chambers start with a measurement of concentration of the gases of interest, this measurement is compared directly between probes and ambient surface conditions to generate a soil gas profile, while a chamber can be used to estimate flux by observing the accumulation of gases inside the chamber over a period of time. Recent reviews of the use of chamber techniques for estimating fluxes such as (Davidson et al., 2002) and (Grndahl et al., 2008) provide excellent overviews of the contrasting requirements and constraints of a range of methodologies. Each probe, and each chamber, represents an experimental unit. An incubation is a more general term covering a set of probes and/or chambers installed in an ecosystem; both probes and chambers require some time after installation for the disturbance associated with their installation to dissipate. A volume of gas removed from a probe or chamber constitutes a single sample; in the case of nondestructive, recirculating analytical systems, a sample is taken when the experimental unit is connected to the instrument, the gas circuit is closed to outside air, and headspace gas mixes with the gas already present inside the measurement cell and associated tubing. Repeated sampling is used to generate a flux estimate from a chamber, as gas concentrations rise continuously during the measurement period. This continuous increase is recorded as a series of contiguous instantaneous measures based on integration of the large number of rapid measurements taken by the analytical instrument; in the case of the flux estimates described in this chapter, 600,100 ms measurements are integrated into a single 1-min gas concentration estimate, and 10 such measurements are combined to generate an estimate of flux. New commercially available detector technologies, namely, Fourier Transformed Infrared (FTIR) spectroscopy, represent a way to use the field-based approach to estimate gaseous compound concentrations in soil
Measurement of CO2, CH4, N2O, H2O Potential in Soil
119
or the flux of these compounds at the soil surface. This chapter will focus on field proven methods to estimate four key soil parameters either at the surface of the soil or throughout the soil profile when using FTIR detectors. The methods outlined in the chapter will likely work for any detector which uses a flow through, recirculating system, although pressurized detection systems would likely not work because of the difference in pressure inside the detection cell and the recirculating systems described here. Similarly, systems such as the Tekran group of analyzers that accumulate an analyte, such as gaseous mercury, will also not work because they alter the amount of analyte in the recirculating gas. The use of nondestructive detectors is revolutionizing our understanding of how microbial ecosystem processes influence biogeochemical cycling. This is largely due to two key advantages: (1) The ability to measure multiple analytes simultaneously allows investigators to explore links between the C and N cycles in a fashion not previously feasible. (2) The ability to monitor gaseous release from a system without altering the gaseous headspace, and to do so in near-real-time fashion, allows investigators to explore transient processes and investigate how transient fluxes of carbon and nitrogen are intertwined. For example, in the past, one would typically set up an incubation for a defined period of time, remove samples along a time course, hoping to hit key time steps, and then analyze the results. Often, the experiment would be completed before the results were known (e.g., Ma et al., 2007). With recirculating detectors, this is no longer a concern; results are available the instant a sample is taken. However, there is one drawback: these recirculating detection systems are not well suited to measuring many different experimental units simultaneously. This is because of the time required for analysis and purging each sample from the measurement cell; realistically it takes between 2 and 5 min to switch between experimental units. Hence, if, for example, one has a collection of chambers arranged along an environmental gradient such as a hillslope or across a soil discontinuity, each chamber can provide one flux estimate in 12–15 min, and the entire collection of chambers could be measured, one at a time, over the course of a few hours. In contrast, one can rapidly take samples for GC analysis, up to one every 30 s, allowing nearly simultaneous estimation of flux at all chambers; such systems are likely better suited to repeated measurement throughout a day, or large batch experiments than an FTIR-based system (Corre et al., 1996 Yates et al., 2006). Typically, CO2, CH4, and N2O are not measured simultaneously because of the additional vacutainers and GC runs required. Additional vacutainers require that investigators remove more samples out of their flux chamber or soil probe with resultant worries that this will result in a pressure
120
Martin E. Brummell and Steven D. Siciliano
differential within the chamber or probe and thereby “pull” gas out of the surrounding soil matrix. To combat this, investigators will inject an inert gas or a known atmosphere back into the system, with attendant worries that this no longer represents what is occurring in those ecosystems. In addition, multiple GC runs are required because of the different detectors used for CO2 and CH4 compared to N2O and each GC analysis is a destructive form of analysis which uses up a vacutainer. The principle advantages of FTIR detectors are that they can scan for multiple analytes and are nondestructive. Thus, analyzing for additional analytes does not incur additional time or cost. Further, because the sampling procedure is nondestructive, FTIR sampling typically involves setting up the chamber or probe in a sampling loop that includes the FTIR cell. Hence, no samples are removed from the flux chamber or soil probe and as long as the FTIR system is not too far from the sample chamber, then no vacuum will be created. Thus, an FTIR detector provides an investigator the capability to measure multiple gases, in real time, and nondestructively in the field. The FTIR can only detect gases with an infrared absorbance band between 900 and 4200 cm 1. Diatomic gases such as O2, H2, and N2 as well as noble gases and some airborne solid particles do not absorb IR in that region, and cannot be detected. Water content and CO2 concentration are often used as a proxy for O2 concentration, especially to estimate the status of a soil system as anaerobic versus aerobic; H2 and N2 are important gases in the processes of CH4 production and N2O consumption, respectively (Conrad, 1999; Firestone and Davidson, 1989). Some gas-specific detectors such as the Vaisala OMT-355 O2 detector can be connected to the FTIR measurement circuit in series, as they are also nondestructive samplers. Measurement of the small proportional changes in O2 concentration associated with soil respiration requires great sensitivity in the O2 detector, and we are currently evaluating the use of this technique to supply additional data in real time. The nondestructive and real-time analysis of the data under field conditions allows one to rapidly move between different soil ecosystems in the field and be assured that one is collecting high quality data. For example, in traditional flux measurement approaches, one takes a sample after a set period of time. In soil ecosystems that differ dramatically, this approach has many difficulties (Christensen et al., 1990a,b). In order to obtain high quality flux data, investigators need to sample gaseous concentrations through the period of near linear increase in headspace concentration of gases (Davidson et al., 2002). Because analytes increase in concentration in the headspace being analyzed due to concentration differentials between the soil pore space and the atmosphere, analyte concentration in headspace versus time is a sigmoidal curve (Farrell and Elliott, 2008). Thus, the key step for good quality flux data is to analyze at the appropriate time step for the ecosystem of interest. For example, should one sample every minute, every 5 min, or every 15 min in a
Measurement of CO2, CH4, N2O, H2O Potential in Soil
121
productive upland system compared to a nearby slough, or as is often encountered by our research group, how often should a polar desert be sampled compared to an arctic wetland? Using flux chambers that recirculate and are tied to nondestructive samplers allows one to avoid this problem and rapidly analyzes soil ecosystems that differ fundamentally in their flux rates. The reason for this is that a typical FTIR detector can be set to repeatedly analyze samples between 20 and 180 s which will provide the analyte versus time relationship that one can estimate flux from. Flux estimates by this method are calculated from a series of consecutive measurements from a single chamber, with no interruption in the flow of gas through the closed, recirculating circuit. When this circuit is opened, as when moving between sampling positions, the system must be allowed to reach equilibrium by mixing the gas already in the measurement circuit (primarily the gas volume of the measurement cell and associated tubing) with the sample atmosphere to be measured. This takes up to 3 min under the configuration we have used, though this time would be longer or shorter depending on the length and diameter of the tubing and the flow rate of the pump. Excessively high flow rates create large errors of measurement, while excessively low flow rates or very long tubes prevent adequate mixing of sample atmospheres. For these reasons, we recommend leaving a chamber open while in-circuit with the FTIR and pump at 5 L min 1, at the end of tubes no longer than 10 m, for at least 2 min between flux estimates or between gas probe samples. One exciting application of multiple gas analysis is in the investigation of soil microbial ecosystems, both in manipulated and in native ecosystems. The concentrations of CO2, CH4, and N2O in the soil atmosphere vary with depth and with the communities of organisms in the soil (Blume et al., 2002; Yu et al., 2008). These concentration differences, when coupled with diffusivity estimates, can highlight regions of production and consumption of gases. By analyzing multiple gases simultaneously, we can investigate if microbial communities cycling N2O are also influencing the CH4 cycle directly through gas transformation or indirectly through competition. To investigate subsurface processes, many researchers have investigated belowground atmospheric conditions using a range of pit and probe techniques (e.g., Davidson and Trumbore, 1995; Lee et al., 2010; Mastepanov and Christensen, 2008). Whereas the majority of these techniques involve digging a soil pit and inserting probes horizontally into the profile (e.g., Fang and Moncrieff, 1998; Kamman et al., 2001), a few studies have used probes inserted directly into undisturbed soil to survey subsurface gas concentrations (e.g., Czimczik and Welker, 2010; Elberling et al., 2004). In such surveys, gases were sampled via syringe, introducing a pressure difference at the probe:soil interface and potentially sampling from an unknown volume of soil. The probes used in conjunction with the FTIR are inserted into undisturbed soil and then allowed to equilibrate by diffusion for 24 h
122
Martin E. Brummell and Steven D. Siciliano
before sampling the internal gases using a recirculating system that applies negligible pressure differential and turbulence at the probe:soil interface. We would note that the probes described below for field assessments of microbial communities could also be readily transferred to laboratory microcosms. In this scenario, the reservoirs attached to the probes here are attached to the laboratory microcosms. Then, the FTIR is attached to the reservoir/microcosm to estimate gas production. The internal volume of the measurement cell necessitates reservoirs attached to microcosms or probes to ameliorate the dilution effect and consequent loss of sensitivity when a small sample volume is mixed with the in-circuit gas.
2. Soil Gas Probes Each probe consisted of a hollow steel cylinder (56 1.9 cm i.d.) with a conical point welded to one end and flanges extending 5 mm beyond the outside diameter of the steel tube (Fig. 5.1). The steel point allowed the probe to penetrate hard soil matrices and push aside small stones; the top end of the tube was open during installation, but was sealed with a black butyl rubber stopper (VWR, West Chester PA, USA) during equilibration and measurement. A handle near the top of the probe allowed for an embedded probe to be pulled free of the soil at the end of the season. Each probe was constructed with a ring of 12 holes (2 mm dia.) around the circumference of the tube at depths ranging from 4 cm to a maximum of 50 cm below the zero mark (i.e., below-ground surface, bgs). A 0–26 cm scale was engraved on the side of each probe, allowing for an accurate measurement of the depth at which gases were collected. Concentrations of CO2, CH4, and N2O were measured using a Gasmet DX-4015 Fourier Transform Infrared trace gas analyzer (FTIR-TGA; Gasmet Technologies Oy, Helsinki, Finland). The measurement cell of the FTIR-TGA had an internal volume of 500 mL, whereas each soil probe had an internal volume of 112.5 mL. Thus, to increase the effective sample volume—and minimize dilution effects from ambient air in the gas measurement cell—each probe was connected to a 1.0-L polyethylene bottle (Thermo Fisher Scientific, Waltham MA, USA) via the opening at the top of the probe during equilibration and measurement. A paired, 30 cm 3 mm (i.d.) Teflon sample hose (Zeus Inc., Orangeburg SC, USA) connected the bottle in-line with the probe. A quick-disconnect fitting (Li-Cor Inc., Lincoln, USA) in the return line was used to attach the probe to the FTIR-TGA (via a 10 m 3 mm i.d. Teflon sample hose) without contaminating the interior volume of the probe or reservoir bottle with atmospheric air. The butyl stopper is best attached to the probe using duct tape to avoid the stopper accidentally coming off during the equilibration period.
Measurement of CO2, CH4, N2O, H2O Potential in Soil
123
Open top Handle
Central joint, unscrews for storage
Diffusion holes at 46 cm in this example Flange Pointed tip
Figure 5.1 Soil gas probes were constructed from tube steel stock by the University of Saskatchewan Physics Machine Shop. Each probe consists of a hollow steel tube with a point welded to the downward end and a handle near the upper end. A scale at 1 cm intervals is etched down the side, extending 26 cm from the zero mark 4 cm below the upper end. A set of holes penetrates the steel tube at a position that varies between probes; the deepest probes can access soil air 50 cm below the surface. Probes are installed in clusters of six, spaced 10 cm apart and arranged to allow measurement of gases throughout the soil profile.
Gases were sampled from depth by diffusion. Probes were inserted into the soil to a set depth using a dead blow hammer. Initially a 2 lb hammer is used to start the probe followed by a 8 lb hammer to drive the probe to its full depth. The reservoir bottles are then attached to the probes, thus isolating the probe’s interior volume from the above-ground atmosphere. The time required to reach equilibrium between the probe-plus-reservoir internal atmosphere and the soil atmosphere was investigated by sampling from a series of probes over a 24-h period at the University of Saskatchewan field research site (Saskatoon, SK, Canada). Under ambient conditions, concentrations of CO2, CH4, and N2O ceased accumulating after 7 h (Fig. 5.2). To obtain an estimate of repeatability, measurements were repeated on consecutive days, after flushing the probes with ambient surface air and re-equilibrating with the soil atmosphere for 24 h (Fig. 5.3).
124
Martin E. Brummell and Steven D. Siciliano
25 20 15 10
160
16
140
14
120
100
80
N2O concentration (nmol L–1)
30
CH4 concentration (nmol L–1)
CO2 concentration (mmol L–1)
35
12
10
8
CO2 CH4
6 5
N2O
60 0
10 Time (h)
20
Figure 5.2 Gas concentrations ceased accumulation in probes installed at the University of Saskatchewan after 7 h. The line shown fits the CO2 concentrations, which showed the clearest signal of accumulation, reaching equilibration with soil gases at concentrations close to double CO2 concentrations at the surface.
35
% Deviation of duplicates
30 25 20 15 10 5 0 B3b
P1
B1 W1 Ecosystem
G3
P2
Figure 5.3 Percent deviation between consecutive days varied between ecosystems and between measured gases. CO2 (black bars) was the least variable between days at all ecosystems except P2, whereas CH4 (white bars) was less variable than either CO2 or N2O (hatched bars). The two most variable ecosystems, P2 and G3, also showed the greatest CO2 flux and AUC values, as well as the most variable N2O flux (see Fig. 5.5).
Measurement of CO2, CH4, N2O, H2O Potential in Soil
125
After a probe (with reservoir bottle) was connected to the FTIR-TGA, the soil air was cycled through the closed loop for 3 min at a rate of 5 L min 1. During this time, the FTIR-TGA collected one spectral sample every 100 ms, with the on-board software (CalcmetTM ver. 2005.1) recording gas concentrations averaged over the 3-min interval. The probe was then disconnected and the FTIR-TGA system flushed with ambient air for 2 min. Preliminary studies under ambient conditions demonstrated that this sampling/flushing scheme resulted in negligible carry over from one probe to the next, even at high GHG concentrations.
3. Flux Estimates to the Atmosphere Using Recirculating Chambers The key difference between the method described here and the traditional recirculating chamber design commonly used for CO2 fluxes is the use of the FTIR detector. Measurements of the GHG flux at the soil: atmosphere interface were measured by connecting the FTIR-TGA to a Li-Cor long-term monitoring chamber (Model 8100-104; Li-Cor). The chamber (with an internal volume of 4.5 L) was used to monitor GHG emissions from a 0.0314 m2 area enclosed by a collar (20 cm i.d.) that had been inserted into the soil surface to a depth of 7 cm. Collars were placed in an area representative of the vegetation community, and in close proximity to the soil probes, 1 day prior to chamber deployment. Flux measurements were obtained by closing the chamber and monitoring the change in gas concentration over a 10 min period. The FTIR-TGA collected one spectral sample every 100 ms, with the on-board software recording gas concentrations averaged over 60 s intervals. GHG fluxes were calculated by plotting the change in concentration versus time and using standard curve fitting techniques to determine the slope of the curve between 2 and 8 min of the accumulation plot.
4. Data Analysis For a given soil probe, the gas concentration measured by the FTIRTGA (CT) includes a contribution from the ambient air in the measurement system (Ca) as well as the soil atmosphere (Cs), that is, VS VFTIR CT ¼ CS þ Ca ð5:1Þ VT VT
126
Martin E. Brummell and Steven D. Siciliano
where VS is the volume of the sample probe, including the gas reservoir bottle (1.1125 L); VFTIR is the volume of the gas measurement cell (0.5000 L) and associated tubing (0.1455 L); and VT is the total volume of the closed sample loop (1.7580 L). The gas concentration in the soil atmosphere was calculated by rearranging Eq. (5.1) to solve for CS: Cs ¼
CT VT Ca VFTIR VS
ð5:2Þ
Gas concentrations in ppmv (i.e., mL L 1) were converted to molar concentrations by multiplying the measured concentration (CT and Ca) by the molar volume of a gas at standard temperature and pressure (STP; 0.04462 mmol L 1). It should be noted that the cell in the Gasmet DX-4015 is maintained at ambient pressure and 323 K, and thus, one does not need to adjust for temperature and pressure differences to convert ppmv to molar equivalents. Water potential (C) was calculated from measures of the relative humidity in the probes (based on FTIR-TGA measurements of water vapor) using Eq. (5.4) (Rawlins, 1972): RT e C¼ ln m e
ð5:3Þ
where R ¼ 8.31 J mol 1 K 1; T is temperature (K), m is the molar vapor pressure of pure water (18 g mol 1), and e/e* is the relative humidity. All values are reported as the mean standard error of the mean for each depth increment. In addition to gas fluxes, the FTIR system can also provide estimates of evapotranspiration by monitoring changes in relative humidity over time in the chambers (Brown et al., 2010; McLeod et al., 2004). Evapotranspiration is calculated (Stannard, 1988) by: ET ¼ 3:6
MVC A
ð5:4Þ
where ET is the instantaneous rate of evapotranspiration (mm h 1), 3.6 is a conversion factor to convert g m 2 to mm h 1, V is the volume inside the chamber (m3), C is a calibration factor (see below for how to calculate this), A is the area of land covered by the chamber (m2), and M is the slope of the constant slope section of the graph that plots vapor density (pv) versus time. The vapor density (pv) is calculated (Rosenberg et al., 1983) by: pv ¼
0:622e 1000 RT
ð5:5Þ
Measurement of CO2, CH4, N2O, H2O Potential in Soil
127
where R is the gas constant (287.04 J kg 1 K 1), T is the temperature in Kelvin, and the factor 0.622 is the ratio of the molecular weights of water to dry air. The parameter e is the partial vapor pressure which was calculated using relative humidity which is calculated by: e¼
RHes 100
ð5:6Þ
Where RH is relative humidity provided by the instrument and es is the saturation vapor pressure which is calculated by (CSIRO DWR, 1994): 17:5T eS ¼ 6:11 f ðP Þ ð5:7Þ 241:2 þ T where f(P) is assumed to be constant at 100.47 and T is in C. The calibration factor (C) used in Eq. (5.4) can be calculated by boiling water at different rates and measuring accumulation of vapor in the chamber. Calibration factors range from 2.22 (Raz-Yaseef et al., 2010), 1.534 (McLeod et al., 2004) to 1.298 (McJannet et al., 1996) and investigators need to calibrate each specific chamber used for their study.
5. Soil Profile Analysis Because it is not possible to insert the probes into the soil to exactly the same depth, the samples are grouped into 5 cm depth increments for statistical analysis. Ambient concentrations of each gas are determined by measuring the gas concentration in the air above the soil surface (n ¼ 5) on each sampling day, by opening the FTIR-TGA gas circuit to the atmosphere and placing the intake hose at 2 cm above the soil surface within the array of clusters at each vegetation community, and measuring for 3 min at 5 L min 1. Area-under-the-curve (AUC) analysis is used to integrate gas concentrations over the depth of the entire soil gas profile and provide an integrated estimate of the profile gas balance for CO2, CH4, and N2O. The AUC analysis calculated the area under the gas concentration depth curve using the trapezoidal rule and was conducted using NCSS Statistical and Power Analysis Software (Hintze, 2009). The baseline was set at the mean gas concentration measured in ambient air; thus, positive numbers (mol cm L 1) indicate that, on a profile-scale, gas production exceeded consumption. Conversely, negative numbers indicate that gas consumption exceeded production.
128
Martin E. Brummell and Steven D. Siciliano
It should be noted that individual peaks and troughs in the profile may not indicate production or consumption of the gas but may instead be linked to diffusivity differences with the soil profile. In other words, imagine a constant source at the bottom of the profile diffusing to the surface. If there are significant differences in diffusivity in certain soil segments, for example, there is a region of low diffusivity connected to an area of high diffusivity, then the area of low diffusivity will have a greater gaseous concentration of the analyte compared to the area of high diffusivity. Diffusivity of trace gases in soil is largely a function of the porosity of the soil, and the degree to which the pores are filled with water or air (De Jong and Schappert, 1972; Jury and Horton, 2004; Risk et al., 2002). All else being equal, wetter conditions slow diffusion of gases and allow large accumulations of gases at particular soil layers. For gases typically produced under wet conditions, such as CH4 and N2O, wet soils will appear in soil profiles as regions of high concentration. In contrast, consumption of CH4 occurs mainly under aerobic conditions typical of drier soils, where gases are freer to diffuse and may therefore appear as low concentrations both because of oxidation and because of rapid movement to other areas.
6. FTIR Calibration 6.1. Recirculating versus static chambers GHG fluxes were determined using nonsteady state, vented aluminum chambers (Livingston and Hutchinson, 1995) wrapped with insulation and reflective foil to minimize heating effects (Hutchinson and Mosier, 1981). Chamber collars (15 20 cm i.d.) were manually inserted into the soil to a depth of 5 cm; chamber lids were fastened to the bases by means of two snap locks. To alleviate disturbance effects, chamber collars were inserted into the soil 1 day prior to the first gas sampling date (Tiedje et al., 1989). The first gas sample was used as time-zero (t0) measurement for the flux calculation and represented ambient CO2 and N2O concentrations. Three 20-cm3 gas samples were subsequently collected from the enclosed headspace every 5 min using 25-cm3 syringes equipped with 25 gauge, 1.6-cm long needles (Monoject, Kendall LT, USA) and injected into pre-evacuated ( 40 Pa), 12-mL ExetainerÒ vials (uncoated soda glass vials, Labco Limited, United Kingdom). Concentrations of N2O and CO2 were determined using gas chromatography (Kabwe et al., 2005; Yates et al., 2006). The results with this traditional static chamber system indicated that the FTIR-TGA with LI-COR recirculating chambers corresponded well (r2 between 0.69 and 0.88) with the static chamber systems.
Measurement of CO2, CH4, N2O, H2O Potential in Soil
129
6.2. Absolute calibrations Calibrations were conducted in an acrylic open-top box with ports for gas injection and sampling. The box was fitted with a wood and mesh top and play sand was spread across the mesh to a depth of 5.5 cm. Pure gas samples of N2O and CH4 were injected into the box through a rubber septum, while pure CO2 was introduced through a copper line fixed to the box. Much larger volumes of CO2 were introduced because ambient CO2 concentrations inside the box were up to 1000 times higher than either N2O or CH4. Total volume of injected gas ranged from 70 to 150 mL, into a box internal volume of 300 L. Soil collars were inserted 2 cm into the sand in the box and an LI-COR long-term monitoring chamber positioned above the collar. Each calibration trial consisted of three phases. First, gases were injected into the box and a single FTIR estimate of gas concentrations in the footspace of the apparatus was taken. This was followed by 15 cycles of LI-COR chamber closing and measurement over a 10-min period, and finally by a second static measurement of the footspace concentrations. The two footspace measurements were used to calculate the “Box flux” or the expected gas flux over the sampling period from the sand to the atmosphere through the collar. This measure corresponds to a static chamber estimate. The Box flux values and the mean of the 15 active chamber measures were compared over a range of gas concentrations. Regressions between the box and chamber fluxes (Fig. 5.4) were used to examine the relationship between static and active chamber estimates. A perfectly calibrated system would result in regressions of box against chamber fluxes with a slope and an r2 of 1.
7. Correlations Between Profile Concentrations and Surface Flux in Field Measurements Gas profile net production or consumption inferred from AUC analysis of gas profiles agreed well with observed patterns of gas flux as measured by accumulation or depletion of gases in surface chambers for CO2 but not for CH4 or N2O (Fig. 5.5). The variability associated with the AUC analysis was similar to that observed in the surface flux measurements with a standard error of 25% in the AUC and 88% in the surface flux measurements. Correlation, as measured by Pearson’s r, was positive and significant for CO2 (r = 0.842, p = 0.035), but not significant for CH4 ( p = 0.186) or for N2O ( p = 0.649).
130
Martin E. Brummell and Steven D. Siciliano
Chamber flux (mol m–2 s–1)
4.0 × 10–6 Chamber = 0.85 * flux from box r2 = 0.97 3.0 × 10–6
2.0 × 10–6
1.0 × 10–6 CO2 0.0 0.0
Chamber flux (mol m–2 s–1)
4.0 × 10–9
1.0 × 10–6 2.0 × 10–6 3.0 × 10–6 4.0 × 10–6 Chamber = 0.91 * flux from box r2 = 0.77
3.0 × 10–9
2.0 × 10–9
1.0 × 10–9 CH4 0.0 0.0
1.0 × 10–9 2.0 × 10–9 3.0 × 10–9 4.0 × 10–9
Chamber flux (mol m–2 s–1)
4.0 × 10–9 Chamber = 1.16 * flux from box r2 = 0.95 3.0 × 10–9
2.0 × 10–9
1.0 × 10–9 N2O 0.0 0.0
1.0 × 10–9 2.0 × 10–9 3.0 × 10–9 4.0 × 10–9 Box flux (mol m–2 s–1)
Figure 5.4 Relationships between box flux (static chamber) and active chamber estimates of CO2, CH4, and N2O fluxes. The line indicates the regression line between the calibration box and the measured chamber flux. Gases injected into the footspace of the calibration box diffused upward through the layer of dry sand and into the flux chamber on top at rates proportional to their concentrations and the calculated diffusivity of the sand.
131
Measurement of CO2, CH4, N2O, H2O Potential in Soil
A
2.1 r = 0.842
CO2 flux (mmol m–2 s–1)
1.8 1.5
Sedge/dwarf-shrub
1.2 0.9
Hemiprostrate Prostrate
0.6
Wetland 0.3 Mountain
0.0
Barrens
–20
–10
0
10
20
30
40
50
CO2 AUC (mmol L–1 cm)
B
5 r = 0.624
CH4 flux (nmol m–2 s–1)
4 Wetland
3 2 1 0 –1
Barrens
Prostrate
Mountain Sedge/dwarf-shrub
–2 –400
–200
0
200
Hemiprostrate
400
600
800
1000
CH4 AUC (mmol L–1 cm)
C
2.5
r = 0.239
N2O flux (nmol m–2 s–1)
2.0 Sedge/ dwarf-shrub
1.5
Mountain
1.0
Hemiprostrate
0.5 0.0
Barrens
Prostrate
–0.5 Wetland
–1.0 –1.5
–20
0
20
40
60
N2O AUC (mmol L–1 cm)
Figure 5.5 Greenhouse gas flux as a function of the profile-integrated gas concentration. Surface flux of CO2 (A) was significantly (p ¼ 0.035) and positively correlated with subsurface profiles as AUC calculated values, but there was a weak association between surface flux and subsurface profiles for CH4 (B) (p ¼ 0.186) and none for N2O (C) (p ¼ 0.649). Values reported are the mean standard error (n ¼ 6). Profileintegrated gas concentrations were calculated using area-under-the-curve (AUC) analysis of the gas concentration versus depth profiles.
132
Martin E. Brummell and Steven D. Siciliano
The presence of sinks for CH4 and N2O may explain the weaker or absent correlation between profile and surface flux for these gases. A gas concentration profile represents a snapshot of conditions underground, and the role of soil diffusivity in structuring gas concentrations across depths provides a time-dependent factor. Nevertheless, the strong correlation for CO2, a gas that is not consumed in significant quantities by soil organisms, suggests the CO2 produced at depth is reaching the surface in a manner proportional to its rate of production as well as its rate of passage through the soil matrix. In contrast, CH4 and N2O may be consumed (oxidized and reduced, respectively) by soil microorganisms, with soil water content strongly determining the degree of such activity.
8. Correlations Between FTIR and Traditional Water Activity Measures Where water has displaced the majority of gaseous oxygen from soils, CH4 production will be strong while N2O may be consumed. In permafrost-affected soils, such conditions are more commonly found at the bottom of a soil profile in the active layer than near the surface, and CH4 produced at depth may be oxidized by methanotrophs in upper, more aerated layers. Similarly, N2O produced under unsaturated conditions may be consumed in deeper layers. When the net direction of diffusion of a gas in soil is not upward to the surface, a profile showing high concentrations of the gas will not release correspondingly large amounts at the surface. Water availability as well as its displacement of atmospheric oxygen is also important in structuring soil microbial communities. At equilibrium, water vapor in soil air will reflect the water potential in water-filled pores. Under very dry conditions, water potential may be limiting to microbial activity, preventing CH4 oxidation as well as CO2 production. Under natural conditions, soils may range in water contents from extremely dry to saturated, and some ecosystems may experience the full range in a single season. The current water status of a soil is thus of greater importance in structuring soil GHG dynamics than average or prior conditions. Simultaneous measurement of the water potential of a soil with gas concentrations provides a clear snapshot of both microbial community composition and current activity.
9. Common Issues During FTIR Measurement Use of an FTIR and recirculating chamber or probe design in field measurements of soil gas patterns and processes provides some advantages over other methods, but also some disadvantages. These are primarily the
Measurement of CO2, CH4, N2O, H2O Potential in Soil
133
use of sensitive and expensive analytical equipment under field conditions, the time required for sampling and flushing the circuit between samples, and the presence of surface-ambient air inside the measurement cell. An FTIR system may cost approximately the same as a GC analyzer, and requires a similar level of training to operate effectively. In addition, use of delicate instruments under field conditions carries significant risks of damage to the equipment and possible loss of data. The unit used in the experiments described here had a weather-sealed case and required the use of a 1000-W generator in the field; data were collected on a field-hardened laptop computer, and regularly backed up to different storage media. Additional costs associated with field conditions depend on logistics; in the extreme case of polar research, rental or purchase of a generator is a fraction of the costs of air transport that may be sensitive to the weight of the generator as well as the analytical equipment itself. These weights and associated costs may be several times higher than the cost and weight of a collection of evacuated vacutainers and lightweight, aluminum chambers. Running an FTIR detector on sometimes-unreliable generator power can present its own issues. While the FTIR unit itself suffered no ill effects from frequent power outages and movements across uneven terrain, a computer controlled valve/gas manifold system failed under these conditions, representing a waste of time and several thousand dollars. Moving the FTIR, the generator, the associated pump and hoses, and the chambers consumed a significant fraction of our field work time each day, though this cost clearly depends strongly on the available infrastructure at a field site. Unlike syringe-based sampling of headspace gases in GC-based designs that may require only a few seconds, sampling with the FTIR requires up to 12 min per sampling position. Moving between samples requires a flush cycle with the measurement circuit open to either local atmosphere or a carried supply of pure N2 gas; pure N2 is anyways required in small amounts to re-zero the device each day. This flush interval between samples can add considerable time to a measurement cycle; in the case of the soil gas probes used to examine soil gas profiles, the 2 min flush between each 3 min measurement effectively extended measurement times from 12 to 30 min per cluster. Measuring flux by continuously monitoring gas concentrations in a closed chamber requires flushing only between separate flux estimates, but each estimate is based on up to 10, 1 min measurements during which the FTIR must not be moved or turned off. These restrictions prevent the rapid measurement of many, widely spaced sampling positions within a narrow time window, such as at a particular time of day. The FTIR gas circuit can be purged with a supply of N2 gas or other pure atmosphere to improve sensitivity to extremely low concentrations of gases of interest. Unlike purging with ambient atmosphere, which requires 2 min and simply opening the measurement circuit, the re-zeroing procedure used each day, in which pure N2 is forced into the measurement
134
Martin E. Brummell and Steven D. Siciliano
cell to displace all CO2, CH4, and N2O, requires up to 5 min of N2 injection and, under the procedure used here, does not purge ambient gas from the rest of the gas circuit (pump, hoses, chamber, or probe). Replacing the atmosphere inside the measurement circuit with a pure gas between each sample would increase the time required to collect data, creating a trade-off between accuracy for very low concentration measurements and sample size, which is not usually present using GC-based sampling designs.
9.1. Other sources of difficulty The quick-disconnect systems used to rapidly disengage and reengage the hoses and chambers and probes are subject to failure, either as spontaneous disconnection (possibly in the middle of a measurement cycle) or as a leak, usually due to either improper connection or solid particles accumulating inside moving parts. Other connection points, such as the black butyl rubber stoppers used to seal the tops of the probes, may also fail and allow accumulated gases to escape. While the FTIR may be weather sealed, exposure to severe weather can result in liquid water inside the measurement cell, preventing operation and requiring an expensive service call to repair. We have found the advantages of the FTIR for studying soil gas processes in situ—real-time data production, flexible sample design, nondestructive sampling, and simultaneous measurement of multiple gases of interest—to outweigh the disadvantages, many of which are not unique to the FTIR system or are a matter of degree rather than kind. In particular, the nondestructive, real-time, simultaneous multigas measurements allow rapid response to changing conditions in the field and the implementation of improved experimental design to take advantage of unexpected discoveries including pockets of exceptional gas concentration driven by local organic matter accumulation or sudden changes in soil water content driven by rapid snowmelt or heavy precipitation.
10. Conclusions The new recirculating, nondestructive analyzers provide new opportunities for investigators to link how water, CO2, CH4, and N2O cycles are connected in a variety of settings. Our description above has focused on field portable, and proven techniques accumulated over three High Arctic expeditions. However, there is no reason why these approaches will not also work in a laboratory setting. We would caution investigators that the use of these steel probes in climates in which there is a large temperature
Measurement of CO2, CH4, N2O, H2O Potential in Soil
135
differential between the soil depths and the air temperature may require additional insulation to avoid thermal transfer into the soil profile.
ACKNOWLEDGMENTS We would like to thank Dr. Rich Farrell for the initial design of the FTIR-TGA system along with the many conversations of the adaptation of this equipment to field conditions. The input of Dr. Ian Snape into the use and abuse of these systems under Arctic and Antarctic conditions is also deeply appreciated. We would also like to thank Dr. Lisa Stein and one anonymous reviewer for critical comments that improved the manuscript.
REFERENCES Bedard-Haughn, A., Matson, A. L., and Pennock, D. J. (2006). Land use effects on gross nitrogen mineralization, nitrification, and N2O emissions in ephemeral wetlands. Soil Biol. Biochem. 38, 3398–3406. Blume, E., Mischoff, M., Reichert, J. M., Moorman, T., Konopka, A., and Turco, R. F. (2002). Surface and subsurface microbial biomass, community structure and metabolic activity as a function of soil depth and season. Appl. Soil Ecol. 20, 171–181. Brown, S. M., Petrone, R. M., Mendoza, C., and Devito, K. J. (2010). Surface vegetation controls on evapotranspiration from a sub-humid Western Boreal Plain wetland. Hydrol. Process. 24, 1072–1085. Chapuis-Lardy, L., Wrage, L., Metay, A., Chotte, J.-L., and Bernoux, M. (2007). Soils, a sink for N2O? A review. Glob. Change Biol. 13, 1–17. Christensen, S., Simkins, S., and Tiedje, J. M. (1990a). Spatial variation in denitrification: Dependency of activity centers on the soil environment. Soil Sci. Soc. Am. J. 54, 1608–1613. Christensen, S., Simkins, S., and Tiedje, J. M. (1990b). Temporal patterns of soil denitrification: Their stability and causes. Soil Sci. Soc. Am. J. 54, 1614–1618. Conrad, R. (1989). Control of methane production in terrestrial ecosystems. In “Exchange of Trace Gases Between Terrestrial Ecosystems and the Atmosphere,” (M. O. Andraea and D. S. Schimel, eds.), pp. 39–58. John Wiley & Sons, Chichester, UK. Conrad, R. (1999). Contribution of hydrogen to methane production and control of hydrogen concentrations in methanogenic soils and sediments. FEMS Microbiol. Ecol. 28, 193–202. Corre, M. D., van Kessel, C., and Pennock, D. J. (1996). Landscape and seasonal patterns of nitrous oxide emissions in a semiarid region. Soil Sci. Soc. Am. J. 60, 1806–1815. CSIRO DWR (1994). Second Quarterly Report to MERIWA & AMIRA for the Period October to December 1993 on Groundwater Supply to the Mining Industry in the WA Goldfields. CSIRO, Division of Water Resources Project M217/P321A, Canberra, Australia. Czimczik, C. I., and Welker, J. M. (2010). Radiocarbon content of CO2 respired from High Arctic tundra in northwest Greenland. Arct. Antarct. Alpine Res. 42, 342–350. Davidson, E. A., and Trumbore, S. E. (1995). Gas diffusivity and production of CO2 in deep soils of the eastern Amazon. Tellus 47b, 550–565. Davidson, E. A., Verchot, L. V., Cattaˆnio, J. H., Ackerman, I. L., and Carvalho, J. E. M. (2000). Effects of soil water content on soil respiration in forests and cattle pastures of eastern Amazonia. Biogeochemistry 48, 53–69. Davidson, E. A., Savage, K., Verchot, L. V., and Navarro, R. (2002). Minimizing artifacts and biases in chamber-based measurements of soil respiration. Agr. Forest Meterol. 113, 21–37.
136
Martin E. Brummell and Steven D. Siciliano
De Jong, E., and Schappert, H. J. V. (1972). Calculation of soil respiration and activity from CO2 profiles in the soil. Soil Sci. 113, 328–333. Elberling, B., Jakobsen, B. H., Berg, P., Sondergaard, J., and Sigsgaard, C. (2004). Influence of vegetation, temperature, and water content on soil carbon distribution and mineralization in four High Arctic soils. Arct. Antarct. Alp. Res. 36, 528–538. Fang, C., and Moncrieff, J. B. (1998). Simple and fast technique to measure CO2 profiles in soil. Soil Biol. Biochem. 30, 2107–2112. Farrell, R. E., and Elliott, J. A. (2008). Soil air. In “Soil Sampling and Methods of Analysis,” (M. R. Carter and E. G. Gregorich, eds.), 2nd edn. Chapter 64, pp. 833–850. Lewis, Canadian Society of Soil Science, CRC Press, Boca Raton, FL. Firestone, M. K., and Davidson, E. A. (1989). Microbiological basis of NO AND N2O production and consumption in soil. In “Exchange of Trace Gases Between Terrestrial Ecosystems and the Atmosphere,” (M. O. Andraea and D. S. Schimel, eds.), pp. 7–21. John Wiley & Sons, Chichester, UK. Firestone, M. K., Firestone, R. B., and Tiedje, J. M. (1980). Nitrous oxide from soil denitrification: Factors controlling its biological production. Science 208, 749–751. Galchenko, V. F., Lein, A., and Ivanov, M. (1989). Biological sinks of methane. In “Exchange of Trace Gases Between Terrestrial Ecosystems and the Atmosphere,” (M. O. Andraea and D. S. Schimel, eds.), pp. 59–71. John Wiley & Sons, Chichester, UK. Gilmanov, T. G., Aires, L., Barcza, Z., Baron, V. S., Belelli, L., Beringer, J., Billesbach, D., Bonal, D., Bradford, E., Ceschia, E., et al. (2010). Productivity, respiration, and lightresponse parameters of world grassland and agroecosystems derived from flux-tower measurements. Rangeland Ecol. Manage. 63, 16–39. Grndahl, L., Friborg, T., Christensen, T. R., Ekberg, A., Elberling, B., Illeris, L., Nordstrøm, C., Rennermalm, A˚., Sigsgaard, C., and Søgaard, H. (2008). Spatial and inter-annual variability of trace gas fluxes in a heterogeneous High-Arctic landscape. Adv. Ecol. Res. 40, 473–498. Hintze, J. (2009). NCSS. NCSS, LLC, Kaysville, USA. Hutchinson, G. L., and Mosier, A. R. (1981). Improved soil cover method for field measurement of nitrous oxide fluxes. Soil Sci. Soc. Am. J. 45, 311–316. Johnson, J. M. F., Reicosky, D. C., Allmaras, R. R., Sauer, T. J., Venterea, R. T., and Dell, C. J. (2005). Greenhouse gas contributions and mitigation potential of agriculture in the central USA. Soil Till. Res. 83, 73–94. Jury, W. A., and Horton, R. (2004). Soil Physics. 6th edn. John Wiley & Sons, Hoboken, NJ. Kabwe, L. K., Farrell, R. E., Carey, S. K., Hendry, M. J., and Wilson, G. W. (2005). Characterizing spatial and temporal variations in CO2 fluxes from ground surface using three complimentary measurement techniques. J. Hydrol. 311, 80–90. Kamman, C., Gru¨nhage, L., and Ja¨ger, H.-J. (2001). A new sampling technique to monitor concentrations of CH4, N2O and CO2 in air at well-defined depths in soils with varied water potential. Eur. J. Soil Sci. 52, 297–303. Kellman, L., and Kavanaugh, K. (2008). Nitrous oxide dynamics in managed northern forest soil profiles: Is production offset by consumption? Biogeochemistry 90, 115–128. Kuzyakov, Y. (2006). Sources of CO2 efflux from soil and review of partitioning methods. Soil Biol. Biochem. 38, 425–448. Laughlin, R. J., and Stevens, R. J. (2002). Evidence for fungal dominance of denitrification and codenitrification in a grassland soil. Soil Sci. Am. J. 66, 1540–1548. Lee, H., Schuur, E. A. G., and Vogel, J. G. (2010). Soil CO2 production in upland tundra where permafrost is thawing. J. Geophys. Res. 115, G0100910.1029/2008JG000906. Livingston, G. P., and Hutchinson, G. L. (1995). Enclosure-based measurement of trace gas exchange: Application and sources of error. In “Biogenic Trace Gases: Measuring Emissions from Soil and Water,” (P. A. Matson and R. C. Harris, eds.), pp. 164–205. Blackwell Science Ltd., Oxford, UK.
Measurement of CO2, CH4, N2O, H2O Potential in Soil
137
Ma, W. K., Schautz, A., Fishback, L.-A.E., Bedard-Haughn, A., Farrell, R. E., and Siciliano, S. D. (2007). Assessing the potential of ammonia oxidizing bacteria to produce nitrous oxide in soils of a High Arctic lowland ecosystem on Devon Island, Canada. Soil Biol. Biochem. 39, 2001–2013. Mastepanov, M., and Christensen, T. R. (2008). Bimembrane diffusion probe for continuous recording of dissolved and entrapped bubble gas concentrations in peat. Soil Biol. Biochem. 40, 2992–3003. McBride, M. B. (1994). Environmental Chemistry of Soils. Oxford University Press, New York, USA. McJannet, D. L., Vertessy, R. A., Tapper, N. J., O’Sullivan, S. K., Beringer, J., and Cleugh, H. (1996). Soil and Litter Evaporation Beneath Re-growth and Old-growth Mountain Ash Forest. Cooperative Research Centre for Catchment Hydrology, Clayton, Victoria. McLeod, M. K., Daniel, H., Faulkner, R., and Murison, R. (2004). Evaluation of an enclosed portable chamber to measure crop and pasture actual evapotranspiration at small scale. Agric. Water Manag. 67, 15–34. Pennok, D., Yates, T., Bedard-Haughn, A., Phipps, K., Farrell, R., and McDougal, R. (2010). Landscape controls on N2O and CH4 emissions from freshwater mineral soil wetlands of the Canadian prairie pothole region. Geoderma 155, 308–319. Rawlins, S. L. (1972). Theory of thermocouple psychrometers for measuring plant and soil water. In “Psychrometry in Water Relations Research,” (R. W. Brown and B. P. van Haveren, eds.), pp. 43–50. Utah Agricultural Experiment Station, Logan, UT. Raz-Yaseef, N., Rotenberg, E., and Yakir, D. (2010). Effects of spatial variations in soil evaporation caused by tree shading on water flux partitioning in a semi-arid pine forest. Agric. For. Meteorol. 150, 454–462. Risk, D., Kellman, L., and Beltrami, H. (2002). Carbon dioxide in soil profiles: Production and temperature dependence. Geophys. Res. Lett. 29, doi: 10.1029/2001GL014002. Rosenberg, N. J., Blad, B. L., and Verma, S. H. (1983). Microclimate: The Biological Environment. 2nd edn. John Wiley, New York. Rustad, L. E., Huntington, T. G., and Boone, R. D. (2000). Controls on soil respiration: Implications for climate change. Biogeochemistry 48, 1–6. Siciliano, S. D., Ma, W. K., Ferguson, S., and Farrell, R. E. (2009). Nitrifier dominance of arctic soil nitrous oxide emissions arises due to fungal competition with denitrifiers for nitrate. Soil Biol. Biochem. 41, 1104–1110. Smith, K. A., Ball, T., Conen, F., Dobbie, K. E., Massheder, J., and Rey, A. (2003). Exchange of greenhouse gases between soil and atmosphere: Interactions of soil physical factors and biological processes. Eur. J. Soil Sci. 54, 779–791. Stannard, D. I. (1988). Use of a Hemispherical Chamber for Measurement of Evapotranspiration. United States Geological Survey, Denver, CO, Open-File Report 88-452. Stevens, R. J., Laughlin, R. J., Burns, L. C., Arah, J. R. M., and Hood, R. C. (1997). Measuring the contributions of nitrification and denitrification to the flux of nitrous oxide from soil. Soil Biol. Biochem. 29, 139–151. Tiedje, J. M., Simkins, S., and Groffman, P. M. (1989). Perspectives on measurement of denitrification in the field including protocols for acetylene based methods. Plant Soil 115, 261–284. Whalen, S. C., and Reeburgh, W. S. (2000). Methane oxidation, production, and emission at contrasting sites in a boreal bog. Geomicrobiol. J. 17, 237–251. Yates, T. T., Si, B. C., Farrell, R. E., and Pennock, D. J. (2006). Probability distribution and spatial dependence of nitrous oxide emission: Temporal change in hummocky terrain. Soil Sci. Soc. Am. J. 70, 753–762. Yu, K., Faulkner, S. P., and Baldwin, M. J. (2008). Effect of hydrological conditions on nitrous oxide, methane, and carbon dioxide dynamics in a bottomland hardwood forest and its implications for soil carbon sequestration. Glob. Change Biol. 14, 798–812.
C H A P T E R
S I X
Source Determination of Nitrous Oxide Based on Nitrogen and Oxygen Isotope Tracing: Dealing with Oxygen Exchange Dorien M. Kool,*,1 Jan Willem Van Groenigen,* and Nicole Wrage† Contents 1. Introduction 2. Experimental Approach 2.1. Experimental setup 2.2. Laboratory analyses 3. Data Evaluation for Nitrous Oxide Source Determination 3.1. Main assumptions 3.2. Quantifying O exchange: The ERR approach 3.3. Distinguishing N2O production pathways: 15N data analyses 3.4. Distinguishing N2O production pathways: 18O data analyses 4. Application of the ERR Principle in Nitrate Source Determination 5. Discussion, Applications, and Future Directions References
140 143 143 144 145 145 146 147 148 150 152 156
Abstract Source determination of nitrous oxide (N2O) from soils has so far been complicated by methodological constraints: the frequently used 15N tracer method could not differentiate between pathways related to nitrification, that is, nitrifier nitrification (NN), nitrifier denitrification (ND), and nitrification-coupled denitrification (NCD). To overcome this problem, a dual isotope method using both 15 N and 18O was proposed. However, O exchange between nitrogen oxides and water has been found to disturb such a method. We here explain in detail a novel dual isotope method that allows to quantify O exchange in denitrification and to differentiate N2O production from NN, ND, NCD, and fertilizer denitrification (FD). The method has already been applied to a range of soils with good success. Potential of and scope for further improvement of the method are discussed. * Department of Soil Quality, Wageningen University and Research Centre, Wageningen, The Netherlands Institute of Grassland Science, University of Go¨ttingen, Go¨ttingen, Germany Current address: Radboud University Nijmegen, Nijmegen, The Netherlands
{ 1
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00006-3
#
2011 Elsevier Inc. All rights reserved.
139
140
Dorien M. Kool et al.
1. Introduction To effectively mitigate emissions of the greenhouse gas nitrous oxide (N2O), it is essential to understand the biochemical pathways by which it is produced. As different pathways of N2O production respond differently to environmental factors, understanding and distinguishing these pathways is essential to develop accurate N2O emission inventories and effective mitigation strategies for N2O emissions. Globally, the majority of the N2O in our atmosphere is derived from soil (IPCC, 2007). In soils, N2O has long been assumed to be mainly produced through the pathways of nitrification and denitrification. It is by now clear that many more processes are capable of producing N2O, but their relative significance to total production is generally still thought to be minor. One particular pathway, however, has increasingly gained attention as it may in fact constitute a substantial contribution to N2O emissions from soil: nitrifier denitrification (ND) (Fig. 6.1). ND is the reduction of nitrite (NO2) to N2O and/or N2, alike denitrification, with the significant distinction that it is performed by autotrophic ammonia oxidizers. Soil-based experimental studies increasingly suggest that ND could contribute significantly to N2O production in soil (Granli and Bockman, 1994; Hu¨tsch et al., 1999; Ma et al., 2007; McLain and Martens, 2005; Sa´nchez-Martı´n et al., 2008; Venterea, 2007; Webster and Hopkins, 1996; Wrage et al., 2004a), However, until
O2
NH4+
NH2OH
N2O
(NN)
N2O
(ND)
H2O NO2–
NO
H2O NO3–
NO2–
NO
N2O
(NCD)
NO3–
NO2–
NO
N2O
(FD)
Figure 6.1 Depiction of the major pathways of N2O formation. We distinguish N2O production from nitrifiers as by-product of ammonia oxidation (nitrifier nitrification: NN) as well as through nitrifier denitrification (ND), and N2O production from denitrifiers through reduction of NO3 produced from nitrification (nitrification-coupled denitrification: NCD) as well as through reduction of applied NO3 (fertilizer denitrification: FD).
Source Determination of Nitrous Oxide
141
recently available methodology did not enable to experimentally distinguish and conclusively proof the presence of ND in soil. Here we describe our recently developed nitrogen (N) and oxygen (O) stable isotope tracing approach to distinguish nitrification, denitrification, and ND as N2O production pathways in soil. Conventional N isotope labeling techniques differentiate N2O production from nitrification and denitrification in soil by applying and tracing 15N enrichment from NH4þ and NO3. However, 15N labeling alone cannot distinguish the N2O that results from nitrifiers’ NO2 reduction (i.e., ND) from the N2O generated as by-product from ammonia oxidation (i.e., the first step of “conventional” nitrification), as in both pathways the N originates from NH3 (Hayatsu et al., 2008; Wrage et al., 2005). Based on the idea that the origin of the O atom in N2O differs for different biochemical pathways, an additional 18O tracing approach could help to further distinguish between these pathways than 15N tracing alone. In the N2O produced through the different pathways, the O atom originates from H2O, O2, and NO3, in ratios reflecting reaction stoichiometry (Table 6.1). However, reaction stoichiometry only partially determines the origin of the O atom and resultant isotopic composition of N2O. In addition, O exchange between H2O and nitrogen oxides during N2O production alters the 18O signature of N2O (Kool et al., 2007). Only recently the significance of O exchange has been properly acknowledged, and it is vital that it is taken into account when interpreting the O isotopic data of N2O (Kool et al., 2009a). Our novel dual isotope approach takes O exchange into account and therewith provides a more accurate approach to distinguish N2O sources based on combined O and N isotope tracing. Our methodology aims to distinguish N2O production (a) from nitrifiers as by-product of ammonia oxidation, that is, nitrifier nitrification (NN); (b) from nitrifiers through ND; (c) from denitrifiers by reduction of NO3 produced from nitrification, that is, nitrification-coupled denitrification (NCD); and (d) from denitrifiers by reduction of applied NO3, that is, fertilizer denitrification (FD) (Fig. 6.1). The method is based on the 15N and 18O tracing of applied labeled compounds into newly produced N2O from soil. As part of our method, the effect of O exchange during NO3 reduction to N2O is quantified with the so-called enrichment ratio retention (ERR) approach. Reaction stoichiometry and the quantified O exchange together are the determining factors of the isotopic signature of N2O (fractionation effects are negligible because of the use of enriched compounds). Based on this, the 15N and 18 O isotopic signature of N2O is evaluated to provide improved insight in the relative contribution of the different pathways to total N2O production from soil.
Table 6.1 The table shows how the O isotopic signature of N2O from the different N2O-forming pathways is determined by the O isotopic signal of O2, H2O, or NO3, in case no oxygen exchange between H2O and intermediate compounds takes place
N2O–O isotopic signature reflects that of
Preceding compound O2 H2O Fertilizer NO3
Nitrification
Nitrifier denitrification
Nitrification-coupled denitrification
Fertilizer denitrification
NH2OH 100% 0% 0%
NO2 50% 50% 0%
NO3 33% 67% 0%
NO3 0% 0% 100%
Furthermore, the preceding compounds indicate the source of N in N2O.
Source Determination of Nitrous Oxide
143
2. Experimental Approach 2.1. Experimental setup Soil samples are collected, oven dried at 40 C, sieved over 2 mm, and stored cool until further use. It is also possible to use fresh soil. However, one has to keep in mind that water has to be added to enable the isotope tracer applications. Subsamples of 75–100 g dry soil are preincubated for 7 days, at the incubation temperature (e.g., 16 C). Moisture content during preincubation is lower than during the incubation, allowing for the tracer applications at the start of the incubation. The moisture content used for the incubations may be adjusted depending on the objective of the experiment. Samples are incubated in glass jars of 300 mL for 24–28 h. Such a headspace volume and incubation period was tested to allow for sufficient N2O production without undesirable side effects like headspace saturation and nonlinear N2O increase, possibility for dissimilatory nitrate reduction to ammonia (DNRA), oxygen deficiency, and/or significant changes in moisture content. The presence (absence) of DNRA can be checked afterward by examining the 15N signature of NH4þ and NO2 in soils treated with 15 N–NO3, which should not show significant enrichments after incubation; the O2 concentration in the headspace is verified to have remained sufficient by the end of the incubation by GC measurement; and the moisture content of the soil is determined gravimetrically. We used ambient O2 concentrations. However, it is also possible to work with experimental atmospheres for certain questions. At the start of the incubation, all units receive equal amounts of mineral N, that is, 50 mg NH4þ–N kg 1 and 50 mg NO3–N kg 1 soil. Four different treatments are included, which involve the application of compounds enriched in 18O or 15N. The established treatments (TR) are as follows: 18O-enriched H2O (TR1), 18O-enriched NO3 (TR2), 15N-enriched NO3 (TR3), and 15 N-enriched NH4þ (TR4). All treatments should be replicated properly, preferably (at least) five times. In previous work, the respective compounds in the treatment solutions were enriched in 18O at 1.0 at% excess and at 40.0 atom% excess for 15N. Higher levels of enrichment could very well be used, as discussed below. The NH4þ (15N-enriched and nonenriched) was applied as NH4Cl; NO3 as Ca(NO3)24H2O (15N-enriched and nonenriched) and partially as NaNO3 in TR2 (18O-enriched NO3). Demineralized water was used in all treatments to establish the correct moisture content. Immediately after treatment application, the jars are closed with septumequipped air-tight lids for the duration of the incubation. At the end of incubation, gas samples are taken from the headspace and transferred to (helium-flushed and evacuated) 12 mL exetainer vials, to be analyzed on N2O content and its isotopic signatures.
144
Dorien M. Kool et al.
Soil samples are taken after gas sampling. Subsamples of 20 g moist soil are taken for analyses of mineral N (NH4þ–N and NO3–N) and its 15N isotopic signature. Additional subsamples of each replicate (40 g) are taken to determine the soil dry weight and moisture content to calculate the exact 18 O enrichment of the soil water. Preliminary incubations should verify that only minor changes in the moisture content occur over the chosen incubation period.
2.2. Laboratory analyses 2.2.1. N2O analyses The gas samples are analyzed on the N2O concentration and 15N and 18O signatures. In our previous work (Kool et al., 2009a, 2010a,b), these are determined using a Sercon Cryoprep trace gas concentration system interfaced to a Sercon 20/20 isotope ratio mass spectrometer (Sercon Ltd., Cheshire, UK). Isotope ratios are compared with N2 and N2O reference gases. No international certified isotope standards are available for N2O; therefore, the d15N of the N2O reference gas is calibrated by comparison with N2 with known isotopic content (i.e., d15N ¼ 3.1% vs. atmospheric N2) after reduction of N2O to N2 over copper at 600 C. We derived a d18O value for the N2O reference gas by comparison with CO2 of known isotopic content (d18O ¼ 10.41% VSMOW) after conversion of both gases to CO over carbon at 1400 C. For reliable analysis, N2O concentrations of 800 and 5000 mL m 3 are considered to be the lower threshold values for the analysis of 15N and 18O signatures, respectively, corresponding to 0.4 and 2.5 nmol N2O in our gas samples (12 mL exetainer vials). At these amounts of N2O, the typical standard deviation of isotope measurements is 3%. For further calculations, measured values were corrected for background levels and isotopic compositions of N2O. 2.2.2. Soil mineral N analyses Soil mineral N content and isotopic signature of the NH4þ and NO3 pool need to be determined. We adopted the following procedure, as is also largely described in Kool et al. (2010a,b). Soil mineral N content is determined by extraction with 1 M KCl (50 mL 20 g 1 soil) followed by segmented flow analysis (SFA) (Skalar Analytical, Breda, The Netherlands) (Kool et al., 2006). The 15N enrichments of the mineral N in treatments TR3 and TR4 are derived using a microdiffusion method based on Brooks et al. (1989) and van Groenigen et al. (2005). Subsamples of the KCl extracts are taken, aiming for a volume that would contain an absolute amount of 80–120 mg N (in the relevant form, i.e., NH4þ or NO3). Depending on the soil mineral N content, this may entail that two subsamples are needed for separate NH4þ and NO3 analysis, otherwise both compounds can be isolated from the same sample subsequently. Demineralized water is added
Source Determination of Nitrous Oxide
145
to the subsamples to a standard volume to minimize the headspace in the flasks for the microdiffusion isolation procedure. For the NH4þ isolation a microfilter spiked with KHSO4 (2 M) and packed in Teflon is added to the sample, together with ashed MgO to raise the pH to 10, and the sample containers are closed for (at least) 6 days. After this period all NH4þ is assumed to be transferred from the solution onto the microfilter. The filter is removed before the addition of Devarda’s alloy, and a new filter for the NO3 isolation is added. The containers are again left standing for at least 6 days to allow all NO3 to be converted to NH4þ (catalyzed by Devarda’s alloy) and transferred onto the new filter. The samples are left at room temperature (20 C) for both microdiffusion steps. The 15N isotopic analyses on the filters are carried out on an elemental analyzer interfaced to a continuous flow isotope ratio mass spectrometer (EA-IRMS) (Sercon 20/20, Sercon Ltd.). Preferably two laboratory standards, calibrated against NIST standard reference materials, are analyzed with every 12 samples.
3. Data Evaluation for Nitrous Oxide Source Determination 3.1. Main assumptions It is commonly understood and also here assumed that N2O derived as by-product from ammonia oxidation (NN) does not contain any O from H2O. Nitrous oxide derived from ammonia oxidation is thought to be a by-product of (incomplete) oxidation of hydroxylamine (Arp and Stein, 2003; Hooper and Terry, 1979). As the O in hydroxylamine has been shown to originate from O2 and not from H2O (Dua et al., 1979; Hollocher et al., 1981), O2 is assumed to be the sole source of the O in N2O resulting as by-product from ammonia oxidation. Frame and Casciotti (2010) report additional support for this, as their experimental data could not be satisfactorily described by a mixing model that incorporated that some of the O in N2O from oxidation of hydroxylamine (NN) comes from H2O. A second assumption for this approach is that NO3 is the substrate and an obligatory intermediate for “FD” and NCD (i.e., total “conventional” denitrification). However, denitrifiers might also directly take up and reduce NO2 formed in the first steps of nitrification, although denitrification of NO3 is energetically more profitable. In this experimental set-up, NO3 is abundant (applied) and readily available to be denitrified. It can therefore be assumed that NO3 will be intermediate for the large majority of N2O produced through NCD in such soil incubation studies. Thirdly, across the pathways where O exchange is considered to occur, it is assumed that it takes place at the same rate as quantified for denitrification of NO3 to N2O. From the literature it is clear that the rate of O exchange
146
Dorien M. Kool et al.
may differ significantly among different nitrifiers and denitrifiers (Casciotti et al., 2010; Kool et al., 2007). O exchange associated with nitrifiers is reported less often and may overall seem to be less profound than found for denitrifiers. Casciotti et al. (2010) measured in pure culture studies of ammonia oxidizers exchanges of less than 25% for four different species. Less than 3% of O in NO2 was exchanged with water in pure culture studies with nitrite oxidizers (Buchwald and Casciotti, 2010). Exchange rates for denitrifiers have usually been found to be higher (Kool et al., 2007 and references therein). Accordingly, assuming denitrification exchange rates would rather over- than underestimate the rate of exchange for the nitrifier pathways, and consequently rather under- than overestimate the occurrence and contribution of ND (and NCD) to total N2O production. Although there is some uncertainty related to this assumption, we argue that this is the best estimate of O exchange to be used.
3.2. Quantifying O exchange: The ERR approach Prior to evaluating the relative pathway contributions to total N2O production, the effect of O exchange is quantified with the “ERR” approach. This approach integrates the 18O and 15N isotope enrichment data. Application of both 18O and 15N enriched NO3 enables the quantification of O exchange during denitrification of NO3 based on the following principle. If no 18O from NO3 is exchanged with (nonenriched) H2O–O during denitrification, the 18O:15N enrichment ratio of NO3 should be retained in N2O, and all intermediates. Note that a dilution of the (intermediate) compounds would affect both enrichments equally, and therefore would not change their ratio. The 18O:15N ERR in the N2O compared to NO3 should therefore be 100% in the absence of O exchange: O N2 OðTR 2Þ ERRð%Þ ¼ 100 15 N N2 OðTR 3Þ 18
=
O NO3 ðTR 2Þ 15 N NO 3 ðTR 3Þ
18
where 18O(N2O(TR2)) denotes the 18O enrichment of the N2O produced in treatment TR2, and 18O(NO3(TR2)) and 15N(NO3(TR3)) the 18O and 15 N enrichment of the NO3 applied in treatment TR2 and TR3, respectively. The loss of the 18O enrichment relative to the 15N from NO3 into N2O consequently quantifies the percentage of O that has been exchanged (XERR): XERR ¼ 100 ERR
Source Determination of Nitrous Oxide
147
3.3. Distinguishing N2O production pathways: 15 N data analyses First, the proportions of total N2O derived from NH4þ and NO3, N2O(NH4) and N2O(NO3), are derived. These are calculated from the 15N–N2O enrichment in treatment TR3 and TR4, 15N(N2O(TR3)) and 15N(N2O(TR4)), respectively: 15 N N2 OðTR4Þ N2 OðNH4 þ Þ ¼ 100 15 N N2 OðTR3Þ þ15 N N2 OðTR4Þ 15 N N2 OðTR3Þ N2 OðNO3 Þ ¼ 100 15 N N2 OðTR3Þ þ15 N N2 OðTR4Þ Next, the relative contribution of “Fertilizer Denitrification”, to N2O production, FD, is defined as N2O(NO3): FD ¼ N2 OðNO3 Þ Further, the NH4þ-derived N2O (N2O(NH4)) comprises the contributions of NN, ND, and NCD. The maximum proportion of N2O that may have been derived from NCD, NCDmax, is calculated from the 15Nenrichment of the N2O and NO3 resulting from treatment TR4, 15N (N2O(TR4)), and 15N(NO3(TR4)). It is based on the assumption that nitrate is an obligatory intermediate for NCD. Therefore, where the 15Nenrichment in the total N2O did not exceed the 15N-enrichment of the NO3 (from TR4), the N2O(NH4) could have exclusively originated from NCD. The NCDmax then equaled the total N2O(NH4). When 15N– N2O exceeded the 15N-enrichment in the NO3 in TR4, part of the N2O(NH4) is produced through NN and ND. In that case, the NCDmax is a fraction of the N2O(NH4) that can be calculated from the 15N-enrichment data (from TR4). In summary, the NCDmax is derived as follows: If 15 N N2 OðTR4Þ 15 N NO3 ðTR4Þ ; then NCDmax ¼ N2 OðNH4 Þ ; If 15 N N2 OðTR4Þ > 15 NðNO3 ðTR4Þ Þ; then NCDmax ¼ N2 OðNH4 Þ 15 NðNO3 ðTR4Þ Þ= 15 NðNO3 ðTR4 Þ Þþ15 NðNO3 ðTR3Þ Þ
148
Dorien M. Kool et al.
3.4. Distinguishing N2O production pathways: 18 O data analyses Primarily, the “actual O incorporation from H2O into N2O” (AOI) is determined from the application of 18O-enriched H2O (TR1). This AOI (as percentage) is calculated from the measured 18O-enrichment of N2O relative to the applied enrichment of the 18O–H2O: 18 O N2 OðTR1Þ AOI ¼ 100 18 O H2 OðTR1Þ The evaluation of the pathway contributions, and specifically the identification and contribution of ND, is subsequently based on explaining the measured AOI. The pathway contributions are calculated based on the notion that their combined contributions to total N2O production should explain the O isotopic signature of N2O, that is, the AOI. The O incorporation differs per pathway, depending on (i) reaction stoichiometry and (ii) the effect of O exchange. As depicted in Figure 6.1, reaction stoichiometry shows that in ammonia oxidation to hydroxylamine, the O incorporated into hydroxylamine originates from O2. Accordingly, the N2O derived as by-product of nitrification (NN) will have obtained its O solely from H2O. Further oxidation of hydroxylamine to NO2 incorporates O from H2O. The NO2 will thus have obtained one O from O2, and the second O from H2O. Without O exchange, the O in N2O from subsequent ND from the reduction of NO2 would thus also originate for 50% from O2, and 50% from H2O. NO3 produced from NO2 will have obtained its additional O form H2O, that is, two-third of the O in NO3 from nitrification and consequently the N2O from NCD comes from H2O (in the absence of O exchange). N2O from denitrification of fertilizer NO3 (FD) will contain O from the applied NO3, and no O at all from H2O without a contribution of O exchange. Oxygen exchange is defined as XERR, and is experimentally quantified for denitrification of NO3 to N2O (see below). Although experimental O isotopic data suggest that O exchange will also affect nitrifier pathways (Kool et al., 2009b), we have no quantified proof of its effect on N2O produced through the nitrifier pathways from NH4þ. We therefore need to make assumptions on the presence (or absence) of O exchange. As such, for the pathways of which we are uncertain about the exact O exchange effect, we identify a minimum and maximum contribution to N2O production depending on the assumed presence or absence of O exchange. In those cases, where we assume that O exchange affects nitrifier pathways as well, we assume that it will take place at the same rate as quantified with the XERR. A higher AOI could thus be explained by a larger contribution from the pathways that allow for (relatively) more H2O–O incorporation through
Source Determination of Nitrous Oxide
149
reaction stoichiometry, as well as by increased O exchange. In our evaluation, O exchange is either maximized under (A), that is, assumed to take place during nitrifier pathways as well, or minimized under (B) when it is taken to only affect the N2O from denitrification of NO3. Next to the defined FD (which equals N2O(NO3)) and NCDmax, we put forward that the total N2O(NH4) is the sum of either (A) the maximum contribution of NN (NNmax), the minimum of ND (NDmin), and the maximum of NCD, or (B) the minimum contribution of NN (NNmin), the maximum of ND (NDmax), and the minimum of NCD (NCDmin). Under (A), a theoretical oxygen incorporation from H2O into N2O (TOI) is calculated that maximizes the O incorporation (assuming overall presence of O exchange) while minimizing the contribution of ND to N2O production (TOI1). In other words, this TOI tries to explain the AOI without any contribution of ND to N2O production and its resulting O isotopic signature. TOI1 ¼ N2 OðNO3 Þ XERR þ NCDmax 2=3 þ 2=3XERR 1=3ðXERR Þ2
When this TOI1 is lower than the actual oxygen incorporation AOI, this implies that without a contribution of ND the O incorporation from H2O cannot be explained. In other words, this model calculation signifies that ND will have had a minimum contribution (i.e., larger than zero) when the TOI1 is lower than the actual oxygen incorporation AOI. Under (B), the TOI2 is calculated, which maximizes the contribution of ND by assigning the total N2O(NH4) to ND and assuming the minimal contribution of this pathway to the O incorporation from H2O, that is, through reaction stoichiometry only without a contribution of O exchange during ND: TOI2 ¼ N2 OðNO3 Þ XERR þ N2 OðNH4 Þ 0:5 When the AOI is smaller than TOI2, not all of the N2O(NH4) can have originated from ND and part of the N2O(NH4) needs to be ascribed to NN (to obtain a lower TOI that better explains the AOI). On the other hand, when AOI is not smaller than TOI2 all N2O(NH4) may be assigned to NDmax. When the AOI is larger than TOI2, this may be explained by a minimal contribution of NCD, NCDmin. However, an effect of O exchange during nitrifier pathways may also cause the AOI to be higher than the TOI2 (under which O exchange is minimized for FD only). When additional O exchange is encountered, that is, affecting the intermediate NO2 as well, the O incorporation through ND can become just as high as through NCD. Therefore, assigning a minimum contribution to NCD would not necessarily be needed to explain the AOI better, as additional O exchange
150
Dorien M. Kool et al.
could just as well be the cause of a higher AOI. In other words, the minimum contribution of NCD, NCDmin, will be set to zero. After this evaluation of the TOI in comparison with the AOI, the minima and maxima of the pathway contributions are derived as below (based on explaining the measured AOI): (A) N2 OðNH4 Þ ¼ NNmax þ NDmin þ NCDmax ðNCD þ NDÞmin N2 OðNH4 Þ NNmax TOI1 ¼ N2 OðNO3 Þ XERR þ NCDmax 2=3 þ ð2=3ÞXERR 1=3ðXERR Þ2
If AOI TOI1 ; then NDmin ¼ 0; and NNmax ¼ 0 ðNCD þ NDÞmin ¼ N2 OðNH4 Þ If AOI > TOI1 ; then NDmin > 0; and ðNCD þ NDÞmin ¼ ðAOI FDXERR Þ= 2=3 þ ð2=3ÞXERR 1=3ðXERR Þ2 NDmin ¼ ðNCD þ NDÞmin NCDmax NNmax ¼ N2 OðNH4 Þ ðNCD þ NDÞmin (B) N2 OðNH4 Þ ¼ NNmin þ NDmax ðNCDmin ¼ 0Þ TOI2 ¼ N2 OðNO3 Þ XERR þ N2 OðNH4 Þ 0:5 If AOI TOI2 ; then NDmax ¼ N2 OðNH4 Þ ; and NNmin ¼ 0 If AOI < TOI2 ; then NDmax < N2 OðNH4 Þ ; and NNmin > 0 NDmax ¼ ðAOI FDXERR Þ=0:5 NNmin ¼ N2 OðNH4 Þ NDmax
4. Application of the ERR Principle in Nitrate Source Determination Isotopic analysis of the O isotopic signature of NO3 is a commonly used tool to distinguish different sources of NO3 in ecosystems catchments (e.g., Amberger and Schmidt, 1987; Burns et al., 2009; Durka et al., 1994;
Source Determination of Nitrous Oxide
151
Kendall et al., 2007). However, O exchange is in such studies hardly considered to be a determining factor of the O isotopic signature. If O exchange between H2O and NO3 would take place and alter the NO3–O isotopic signature as well as the N2O–O, this would bias the discrimination between the relevant sources of NO3 (with supposed distinct/different O isotopic signatures). Therefore, studying the effect of O exchange will also be of interest with respect to NO3 source determination in studies on ecosystem functioning. The study of Snider et al. (2010) indicates that assuming the d18O of NO3 to reflect the isotopic composition of H2O and O2 in a 2:1 ratio leads to discrepencies with measured results. Here, it seemed that the 18O incorporation from 18O labeled H2O into NO3 exceeded the incorporation that could be ascribed to nitrification according to reaction stoichiometry. However, this does not quantify an effect of O exchange if the relative contribution of multiple NO3 sources is not known. Following the ERR principle a similar experimental approach can be applied to study the effect of O exchange on the O isotopic signature of NO3 in a more direct way (Kool et al., under review). The experimental set-up remains largely the same. What is new is that in addition, analyses of the O isotopic enrichment (18O) of the NO3 are included. The relevant samples to be analyzed are those that received 18O–NO3, that is, in treatment TR2. Additional samples are incubated for both TR2 and TR3 (15N–NO3), for destructive sampling immediately after treatment application (or as soon as possible, within 4 h after application at the latest). Samples for 18O and 15N analyses are thus collected both at the start and end of the incubation. The NO3 in the soil samples is extracted using KCl as described above. After KCl extraction and mineral N analyses, one series of subsamples is taken for 15N analyses (using, e.g., microdiffusion as above). An additional series of subsamples of the KCl extracts is taken to determine the 18O isotopic signature of the NO3, using the denitrifier method (Casciotti et al., 2002; Xue et al., 2010), of which Rock and Ellert (2007) showed that it could also be used for KCl-extractable NO3 in soil samples. To assess whether O exchange affects the O isotopic signature of NO3, we examine whether the 18O and 15N enrichment change relatively to each other during the incubation. In other words, we again look at the ERR, but this time in NO3 itself over time (instead of in N2O). We thus define the 18 O:15N enrichment ratio of the NO3 (ER(NO3)): ERðNO3 Þ ¼18 O NO3 ðTR1 Þ =15 N NO3 ðTR2 Þ where 18O(NO3(TR1)) and 15N(NO3(TR2)) are the 18O and 15N isotopic enrichments of the NO3 in TR1 and TR2, respectively. The enrichment ratio at the end of the incubation (ER(NO3)end) is compared to the ratio at the start (ER(NO3)start), defining the enrichment ratio retention ERR(NO3): ERRðNO3 Þ ð%Þ ¼ 100ERðNO3 Þend =ERðNO3 Þstart
152
Dorien M. Kool et al.
As above when studying O exchange during N2O production, in the absence of O exchange the ER(NO3) should not change over the course of the incubation leaving the ERR(NO3) at 100%. O exchange would cause a decrease in the ER(NO3) at the end of the incubation relative to the start, presented by a loss in the ERR(NO3).
5. Discussion, Applications, and Future Directions Above, we have described a novel 18O and 15N dual isotope method that—accounting for O exchange—enables to distinguish between four N2O sources: from nitrifiers as by-product of ammonia oxidation (NN), from nitrifiers through ND, from denitrifiers by NCD, and from denitrification of fertilizer NO3 (FD). We demonstrated the applicability of the method by studying a range of 12 soils from agricultural fields, grasslands, and forests across Europe. Through tracing the O incorporation from applied 18O enriched water into N2O, oxygen exchange was identified to play a major role in determining the O isotopic signature of N2O in all soils (Kool et al., 2009a). Oxygen exchange during denitrification of NO3 was quantified, and further data evaluation disclosed that O exchange also occurred in nitrifier pathways in at least nine and potentially in all soils (Kool et al., 2009b). With respect to the N2O production, our approach allowed to quantify the contribution of FD and identify ranges for N2O production by NCD, ND, and NN (Kool et al., 2010a). This showed for the first time that ND can indeed contribute significantly to N2O production in soils: ND must have occurred (had an N2O production significantly larger than zero) in at least four of the soils. It remained difficult to link variation in soil properties to variation in O exchange rates or relative contributions of the different N2O producing pathways. Under moist experimental conditions (WFPS of 80%), O exchange was very high (80–100%) in the majority of soils, and FD was the major N2O producing pathway. Soil C quality and content and pH were suggested to affect the relative pathway contributions, but further testing remains necessary. In a study with a 13th soil at three different moisture contents, it could be shown that ND may be regulated distinctly from denitrification (Kool et al., 2010b). At lower WFPS both FD and ND declined, but there was only a slight decline in ND where a strong decline in the contribution of FD was observed (Kool et al., 2010b). This latter study was performed on one soil only, and further studies are needed to better understand the relationships between the relative pathway contributions and soil moisture content, and other soil properties and land
Source Determination of Nitrous Oxide
153
use. However, the results show that the dual isotope method helps to increase our understanding of N2O production in different environments. As described above, a similar approach as used to quantify the effect of O exchange on N2O could be employed to study the effect of O exchange on the O isotopic signature of NO3. We applied this approach in a study on two grassland soils and an arable soil. O exchange was found and could be quantified for both grassland soils (Kool et al., 2011). In the arable soil, ND may have occurred but could not be conclusively proven. Possibly this was related to differences in microbial activity, as the latter soil also previously showed lower N2O production rates. This stresses moreover the importance of measuring mineral N dynamics separately from N2O production: although the processes affecting both are the same, the net production of, for example, NO3 and N2O can differ largely (Wrage et al., 2004b). Despite the need for broader application, the above presented methods provide tools to improve our understanding of O exchange between nitrogen oxides and water, and the use of O isotopic signatures in N cycling studies. The dual isotope method for N2O production processes is the only method so far that allows a distinction between ND and the other processes regarded. However, there are also some shortcomings, which will be discussed below, together with suggestions for improvements of the method. First of all, there are other processes that may lead to N2O production in soils. However, potential nitrification by heterotrophs (both bacteria and fungi) (e.g., Papen et al., 1989; Robertson and Groffman, 2007) and archaea (Leininger et al., 2006), as well as fungal denitrification (Shoun et al., 1992) would not need to interfere with our approach when these processes would proceed via mainly the same reaction paths as assumed for autotrophic nitrification and heterotrophic bacterial denitrification, respectively. On the other hand, DNRA (e.g., Stevens et al., 1998) and codenitrification (e.g., Shoun et al., 1992) should be considered to affect the isotopic signatures in alternative ways. DNRA forms a distinct pathway in the N cycle. Although it is not yet well understood, it has been shown that N2O can be produced during ammonification of NO3 (Smith and Zimmerman, 1981; Stevens et al., 1998). Some studies speculate that DNRA could account for a significant part of NO3 reduction, also in soils (Bonin et al., 1998; Caskey and Tiedje, 1979; Huygens et al., 2007; Stevens et al., 1998; Wan et al., 2009). Disregarding N2O production by DNRA would overestimate the contribution of denitrification in isotope tracing studies, including the one in this thesis. Two types of DNRA are recognized: the first is coupled to fermentation, the second to sulfur oxidation (Burgin and Hamilton, 2007). Nitrate reduction through fermentative DNRA rather than denitrification is thought to be relatively favored in NO3-limited systems (Nijburg et al., 1997; Tiedje, 1988) and DNRA coupled to sulfur oxidation is found mainly in aquatic environments
154
Dorien M. Kool et al.
(Brettar and Rheinheimer, 1991; Brunet and Garcia-Gil, 1996). In our studies, DNRA was therefore unlikely to be significant. This is checked by measuring the 15N-enrichment of the NH4þ after application of enriched NO3. As DNRA can also lead to the production of enriched NO2, it would be desirable to also measure 15N–NO2 in incubations with added 15 N–NO3. However, this could also have been produced by FD, thus not presenting conclusive proof of DNRA. In general, understanding the pathway and role of DNRA in nitrogen cycling remains a challenge and it is necessary to check for DNRA in future N2O source determination studies. Another distinguished pathway of N2O production is codenitrification, where NO3 or NO2 is combined with other nitrogenous compounds to produce N2O or N2. This process is most commonly recognized in denitrifying fungi (Laughlin and Stevens, 2002; Morozkina and Kurakov, 2007; Shoun et al., 1992; Tanimoto et al., 1992), but some studies have also identified bacteria (including actinomycetes) able to carry out codenitrification (Garber and Hollocher, 1982; Kumon et al., 2002). Isotope (15N) labeling studies are suggested to enable the distinction between denitrification and codenitrification. However, in ecosystems the evident complexity of N-transformations complicates the isolation and discrimination of those two processes from the wide spectrum of other N2O and/or N2 producing processes. Furthermore, several Archaea have also been shown to carry out dissimilatory reduction of NO3 via NO2, NO and N2O to N2 (Cabello et al., 2004; Volkl et al., 1993; Werber and Mevarech, 1978). This pathway appears similar to the bacterial one (Hayatsu et al., 2008; Zumft and Kroneck, 2007), but genome sequencing has revealed differences in the genetic organization, structure, and regulation of the genes (Philippot, 2002). Recently, genes encoding for potential homologues of nitrite reductases (NirK) have also been found in ammonia oxidizing Archaea from various environments, including soils (Bartossek et al., 2010). Accounting for codenitrification and other so far not considered sources of N2O in soils remains a challenge. So far, the dual isotope method depends on the application of isotopically enriched compounds, which is related to a fertilization of the experimental units. The advantage of the use of enriched compounds with stable isotope tracing approaches is that the effect of fractionation, that is, the preferential use of the lighter isotope and residual enrichment of the heavier isotope, becomes negligible. This implies that with the inevitable fertilizer addition of NH4þ and NO3 this approach does not yet allow to determine the in situ relative contribution of N2O production pathways. Instead, it is designed to provide an assessment of the potential significance of the different pathways relative to each other, and to enable a comparison across, for example, soil types and environmental conditions. For the use in natural systems, it may be desirable to add less NH4þ and NO3, at potentially higher enrichments. Here, care has to be taken, however, as another
Source Determination of Nitrous Oxide
155
assumption of the dual isotope method is that NO3 is the substrate and obligatory intermediate for NCD. This is justified as long as NO3 is abundant, as the use of NO3 is energetically more profitable than that of NO2. Should NO3 be less abundant, the direct use of NO2 by heterotrophic denitrifiers in NCD (without prior oxidation to NO3 by nitrifiers) might not be negligible anymore. This would lead to an underestimation of the contribution of NCD to total N2O production and an overestimation of ND. A potential solution and improvement of this method might be to also include isotopic analyses of NO2. Although the determination of 15N and 18 O in NO2 is not simple, methods exist (Bo¨hlke et al., 2007; Stevens and Laughlin, 1994) and could be implemented. Some assumptions are also required regarding O exchange. It is quantified for the reduction of NO3 to N2O and considered to occur in other processes with the same exchange rate. Uncertainties regarding the extent of exchange are in our approach addressed by formulating different scenarios, leading to the ranges of N2O production for nitrifier pathways. Investigations on O exchange in pure culture studies may enable to adjust assumptions for both N2O and NO3 studies (e.g., Casciotti et al., 2010; Frame and Casciotti, 2010). Moreover, also here the addition of isotopic analyses of NO2 could provide further insight. What is not considered so far is the speed of O exchange. As a biochemical process, we expect it may proceed progressively with the N transformation processes, and/or be affected by substrate availability. This will be of key interest in future investigation. Our method constitutes a framework in which novel insights with respect to nature and rate of O exchange during the various pathways can be relatively simply incorporated. As seen above, potential exists for further improving the method. Including the analysis of NO2 isotopic signatures is already suggested to be valuable to both better define the NCD and the presence of O exchange in nitrifier pathways. Additional promising steps would also be to combine the dual isotope method with isotopomer measurements for further information about N2O sources. Analyzing the isotopomer composition is increasingly suggested as a promising tool in source determination of N2O (Baggs, 2008; Ostrom et al., 2010; Schmidt et al., 2004; Sutka et al., 2006; Toyoda et al., 2005). Such an approach evaluates the intramolecular site preference (SP) of the 15N in N2O, at natural abundance. Where isotope tracing studies need to apply enriched compounds to discount the effect of isotopic fractionation, studying the isotopomer composition can be done without the need to disturb ecosystems with fertilizing compounds. However, ambiguity about the SP for different pathways and microbial communities currently limits the use of isotopomer ratios to assess the contributions of distinct pathways to N2O production (Ostrom et al., 2007, 2010; Schmidt et al., 2004; Well et al., 2006). Future studies could aim at further characterizing distinct SP values and combining this tool with other stable
156
Dorien M. Kool et al.
isotope techniques. While recognizing the need for future investigation, recent studies have already suggested the potential of the d18O/SP fingerprint of N2O as a tool to identify the dominant production process of N2O in soil (Well and Flessa, 2009; Well et al., 2008). Also a combination with molecular techniques as, for example, in stable isotope probing might offer potential despite some remaining challenges (Baggs, 2008). In conclusion, the proposed dual isotope method gives the option of distinguishing the potential contribution of NN, ND, NCD, and FD to N2O production from soils. Although scope remains for further improving the method, it already offers a valuable tool for quantifying O exchange and improving our understanding of N2O production.
REFERENCES Amberger, A., and Schmidt, H. L. (1987). The natural isotope content of nitrate as an indication of its origin. Geochim. Cosmochim. Acta 51, 2699–2705. Arp, D. J., and Stein, L. Y. (2003). Metabolism of inorganic N compounds by ammoniaoxidizing bacteria. Crit. Rev. Biochem. Mol. Biol. 38, 471–495. Baggs, E. M. (2008). A review of stable isotope techniques for N2O source partitioning in soils: Recent progress, remaining challenges and future considerations. Rapid Commun. Mass Spectrom. 22, 1664–1672. Bartossek, R., Nicol, G. W., Lanzen, A., Klenk, H.-P., and Schleper, C. (2010). Homologues of nitrite reductases in ammonia-oxidizing archaea: Diversity and genomic context. Environ. Microbiol. 12, 1075–1088. Bo¨hlke, J. K., Smith, R. L., and Hannon, J. E. (2007). Isotopic analysis of N and O in nitrite and nitrate by sequential selective bacterial reduction to N2O. Anal. Chem. 79, 5888–5895. Bonin, P., Omnes, P., and Chalamet, A. (1998). Simultaneous occurrence of denitrification and nitrate ammonification in sediments of the French Mediterranean coast. Hydrobiologia 389, 169–182. Brettar, I., and Rheinheimer, G. (1991). Denitrification in the central Baltic: Evidence for H2S-oxidation as motor of denitrification at the oxic-anoxic interface. Mar. Ecol. Prog. Ser. 77, 157–169. Brooks, P. D., Stark, J. M., McInteer, B. B., and Preston, T. (1989). Diffusion method to prepare soil extracts for automated nitrogen-15 analysis. Soil Sci. Soc. Am. J. 53, 1707–1711. Brunet, R. C., and Garcia-Gil, L. J. (1996). Sulfide-induced dissimilatory nitrate reduction to ammonia in anaerobic freshwater sediments. FEMS Microbiol. Ecol. 21, 131–138. Buchwald, C., and Casciotti, K. L. (2010). Oxygen isotopic fractionation and exchange during bacterial nitrite oxidation. Limnol. Oceanogr. 55, 1064–1074. Burgin, A. J., and Hamilton, S. K. (2007). Have we overemphasized the role of denitrification in aquatic ecosystems? A review of nitrate removal pathways. Front. Ecol. Environ. 5, 89–96. Burns, D. A., Boyer, E. W., Elliott, E. M., and Kendall, C. (2009). Sources and transformations of nitrate from streams draining varying land uses: Evidence from dual isotope analysis. J. Environ. Qual. 38, 1149–1159. Cabello, P., Rolda´n, M. D., and Moreno-Vivia´n, C. (2004). Nitrate reduction and the nitrogen cycle in archaea. Microbiology 150, 3527–3546.
Source Determination of Nitrous Oxide
157
Casciotti, K. L., Sigman, D. M., Galanter Hastings, M., Bo¨hlke, J. K., and Hilkert, A. (2002). Measurement of the oxygen isotopic composition of nitrate in seawater and freshwater using the denitrifier method. Anal. Chem. 74, 4905–4912. Casciotti, K. L., McIlvyn, M., and Buchwald, C. (2010). Oxygen isotopic exchange and fractionation during bacterial ammonia oxidation. Limnol. Oceanogr. 55, 753–762. Caskey, W. H., and Tiedje, J. M. (1979). Evidence for clostridia as agents of dissimilatory reduction of nitrate to ammonium in soils. Soil Sci. Soc. Am. J. 43, 931–936. Dua, R. D., Bhandari, B., and Nicholas, D. J. D. (1979). Stable isotope studies on the oxidation of ammonia to hydroxylamine by Nitrosomonas europaea. FEBS Lett. 106, 401–404. Durka, W., Schulze, E. D., Gebauer, G., and Voerkelius, S. (1994). Effects of forest decline on uptake and leaching of deposited nitrate determined from 15N and 18O measurements. Nature 372, 765–767. Frame, C. H., and Casciotti, K. L. (2010). Biogeochemical controls and isotopic signatures of nitrous oxide production by a marine ammonia-oxidizing bacterium. Biogeosci. Discuss. 7, 3019–3059. Garber, E. A. E., and Hollocher, T. C. (1982). 15N, 18O tracer studies on the activation of nitrite by denitrifying bacteria. J. Biol. Chem. 257, 8091–8097. Granli, T., and Bockman, O. C. (1994). Nitrous oxide from agriculture. Nor. J. Agric. Sci. Suppl. 12, 7–128. Hayatsu, M., Tago, K., and Saito, M. (2008). Various players in the nitrogen cycle: Diversity and functions of the microorganisms involved in nitrification and denitrification. Soil Sci. Plant Nutr. 54, 33–45. Hollocher, T. C., Tate, M. E., and Nicholas, D. J. D. (1981). Oxidation of ammonia by Nitrosomonas europaea: Definitive 18O-tracer evidence that hydroxylamine formation involves a monooxygenase. J. Biol. Chem. 256, 10834–10836. Hooper, A. B., and Terry, K. R. (1979). Hydroxylamine oxidoreductase of Nitrosomonas production of nitric oxide from hydroxylamine. Biochim. Biophys. Acta 571, 12–20. Hu¨tsch, B. W., Wang, X., Feng, K., Yan, F., and Schubert, S. (1999). Nitrous oxide emission as affected by changes in soil water content and nitrogen fertilization. J. Plant Nutr. Soil Sci. 162, 607–613. Huygens, D., Ru¨tting, T., Boeckx, P., Van Cleemput, O., Godoy, R., and Mu¨ller, C. (2007). Soil nitrogen conservation mechanisms in a pristine south Chilean Nothofagus forest ecosystem. Soil Biol. Biochem. 39, 2448–2458. Intergovernmental Panel on Climate Change (IPCC) (2007). Climate Change 2007: The Physical Science Basis. Contribution of Working Group I, http://www.ipcc.ch/ipccreports/ar4-g1.htm. S. Solomon, et al. (eds.), 996pp., Cambridge University Press, New York, NY. Kendall, C., Elliott, E. M., and Wankel, S. D. (2007). Tracing anthropogenic inputs of nitrogen to ecosystems. In “Stable Isotopes in Ecology and Environmental Science,” (H. Michener and K. Lajtha, eds.), pp. 375–449. Blackwell Publishing, Oxford. Kool, D. M., Hoffland, E., Abrahamse, P. A., and van Groenigen, J. W. (2006). What artificial urine composition is adequate for simulating soil N2O fluxes and mineral N dynamics? Soil Biol. Biochem. 38, 1757–1763. Kool, D. M., Wrage, N., Oenema, O., Dolfing, J., and van Groenigen, J. W. (2007). Oxygen exchange between (de)nitrification intermediates and H2O and its implications for source determination of NO3 and N2O: A review. Rapid Commun. Mass Spectrom. 21, 3569–3578. Kool, D. M., Wrage, N., Oenema, O., Harris, D., and van Groenigen, J. W. (2009a). The 18 O signature of biogenic nitrous oxide is determined by O exchange with water. Rapid Commun. Mass Spectrom. 23, 104–108.
158
Dorien M. Kool et al.
Kool, D. M., Mu¨ller, C., Wrage, N., Oenema, O., and van Groenigen, J. W. (2009b). Oxygen exchange between nitrogen oxides and H2O can occur during nitrifier pathways. Soil Biol. Biochem. 41, 1632–1641. Kool, D. M., Dolfing, J., Wrage, N., and van Groenigen, J. W. (2010a). Nitrifier denitrification as a distinct and significant source of nitrous oxide from soil. Soil Biol. Biochem. 43, 174–178. Kool, D. M., Wrage, N., Zechmeister-Boltenstern, S., Pfeffer, M., Brus, D., Oenema, O., and van Groenigen, J. W. (2010b). Nitrifier denitrification can be a source of N2O from soil: A revised approach to the dual-isotope labelling method. Eur. J. Soil Sci. 61, 759–772. Kool, D. M., Wrage, N., Oenema, O., van Kessel, C., and van Groenigen, J.W. (2011). Oxygen exchange with water alters the oxygen isotopic signature of nitrate in soil ecosystems. Soil Biol. Biochem, doi:10.1016/j.soilbio.2011.02.006. Kumon, Y., Sasaki, Y., Kato, I., Takaya, N., Shoun, H., and Beppu, T. (2002). Codenitrification and denitrification are dual metabolic pathways through which dinitrogen evolves from nitrate in Streptomyces antibioticus. J. Bacteriol. 184, 2963–2968. Laughlin, R. J., and Stevens, R. J. (2002). Evidence for fungal dominance of denitrification and codenitrification in a grassland soil. Soil Sci. Soc. Am. J. 66, 1540–1548. Leininger, S., Urich, T., Schloter, M., Schwark, L., Qi, J., Nicol, G. W., Prosser, J. I., Schuster, S. C., and Schleper, C. (2006). Archaea predominate among ammonia-oxidizing prokaryotes in soils. Nature 442, 806–809. Ma, W. K., Schautz, A., Fishback, L. A. E., Bedard-Haughn, A., Farrell, R. E., and Siciliano, S. D. (2007). Assessing the potential of ammonia oxidizing bacteria to produce nitrous oxide in soils of high arctic lowland ecosystem on Devon Island, Canada. Soil Biol. Biochem. 39, 2001–2013. McLain, J. E. T., and Martens, D. A. (2005). Nitrous oxide flux from soil amino acid mineralization. Soil Biol. Biochem. 37, 289–299. Morozkina, E. V., and Kurakov, A. V. (2007). Dissimilatory nitrate reduction in fungi under conditions of hypoxia and anoxia: A review. Appl. Biochem. Microbiol. 43, 544–549. Nijburg, J. W., Coolen, M. J. L., Gerards, S., Klein Gunnewiek, P. J. A., and Laanbroek, H. J. (1997). Effects of nitrate availability and the presence of Glyceria maxima on the composition and activity of the dissimilatory nitrate-reducing bacterial community. Appl. Environ. Microbiol. 63, 931–937. Ostrom, N. E., Pitt, A., Sutka, R., Ostrom, P. H., Grandy, A. S., Huizinga, K. M., and Robertson, G. P. (2007). Isotopologue effects during N2O reduction in soils and in pure cultures of denitrifiers. J. Geophys. Res. 112, G02005. Ostrom, N. E., Sutka, R., Ostrom, P. H., Stuart Grandy, A., Huizinga, K. M., Gandhi, H., Fischer, J. C. V., and Robertson, G. P. (2010). Isotopologue data reveal bacterial denitrification as the primary source of N2O during a high flux event following cultivation of a native temperate grassland. Soil Biol. Biochem. 42, 499–506. Papen, H., von Berg, R., Hinkel, I., Thoene, B., and Rennenberg, H. (1989). Heterotrophic nitrification by Alcaligenes faecalis: NO2, NO3, N2O, and NO production in exponentially growing cultures. Appl. Environ. Microbiol. 55, 2068–2072. Philippot, L. (2002). Denitrifying genes in bacterial and Archaeal genomes. Biochim. Biophys. Acta 1577, 355–376. Robertson, G. P., and Groffman, P. M. (2007). Nitrogen transformations. In “Soil Microbiology, Biochemistry, and Ecology,” (E. A. Paul, ed.), pp. 341–364. New York, Springer. Rock, L., and Ellert, B. H. (2007). Nitrogen-15 and oxygen-18 natural abundance of potassium chloride extractable soil nitrate using the denitrifier method. Soil Sci. Soc. Am. J. 71, 355–361. Sa´nchez-Martı´n, L., Vallejo, A., Dick, J., and Skiba, U. M. (2008). The influence of soluble carbon and fertilizer nitrogen on nitric oxide and nitrous oxide emissions from two contrasting agricultural soils. Soil Biol. Biochem. 40, 142–151.
Source Determination of Nitrous Oxide
159
Schmidt, H. L., Werner, R. A., Yoshida, N., and Well, R. (2004). Is the composition of nitrous oxide an indicator for its origin from nitrification or denitrification? A theoretical approach from referred data and microbiological and enzyme kinetic aspects. Rapid Commun. Mass Spectrom. 18, 2036–2040. Shoun, H., Kim, D., Uchiyama, H., and Sugiyama, J. (1992). Denitrification by fungi. FEMS Microbiol. Lett. 94, 277–282. Smith, M. S., and Zimmerman, K. (1981). Nitrous oxide production by nondenitrifying soil nitrate reducers. Soil Sci. Soc. Am. J. 45, 865–871. Snider, D. M., Spoelstra, J., Schiff, S. L., and Venkiteswaran, J. J. (2010). Stable oxygen isotope ratios of nitrate produced from nitrification: 18O-labeled water incubations of agricultural and temperate forest soils. Environ. Sci. Technol. 44, 5358–5364. Stevens, R. J., and Laughlin, R. J. (1994). Determining nitrogen-15 in nitrite or nitrate by producing nitrous oxide. Soil Sci. Soc. Am. J. 58, 1108–1116. Stevens, R. J., Laughlin, R. J., and Malone, J. P. (1998). Soil pH affects the process reducing nitrate to nitrous oxide and di-nitrogen. Soil Biol. Biochem. 30, 1119–1126. Sutka, R. L., Ostrom, N. E., Ostrom, P. H., Breznak, J. A., Gandhi, H., Pitt, A. J., and Li, F. (2006). Distinguishing nitrous oxide production from nitrification and denitrification on the basis of isotopomer abundances. Appl. Environ. Microbiol. 72, 638–644. Tanimoto, T., Hatano, K., Kim, D., Uchiyama, H., and Shoun, H. (1992). Co-denitrification by the denitrifying system of the fungus Fusarium oxysporum. Microbial Lett. 93, 177–180. Tiedje, J. M. (1988). Ecology of denitrification and dissimilatory nitrate reduction to ammonium. In “Biology of Anaerobic Microorganisms,” (A. J. B. Zehnder, ed.). John Wiley and Sons, New York, NY. Toyoda, S., Mutobe, H., Yamagishi, H., Yoshida, N., and Tanji, Y. (2005). Fractionation of N2O isotopomers during production by denitrifier. Soil Biol. Biochem. 37, 1535–1545. Van Groenigen, J. W., Georgius, P. J., Van Kessel, C., Hummelink, E. J. W., Velthof, G. L., and Zwart, K. B. (2005). Subsoil 15N–N2O concentrations in a sandy soil profile after application of 15N-fertilizer. Nutr. Cycl. Agroecosyst. 72, 13–25. Venterea, R. T. (2007). Nitrite-driven nitrous oxide production under aerobic soil conditions: Kinetics and biochemical controls. Global Change Biol. 13, 1798–1809. Volkl, P., Huber, R., Drobner, E., Rachel, R., Burggraf, S., Trincone, A., and Stetter, K. O. (1993). Pyrobaculum aerophilum sp. nov., a novel nitrate-reducing hyperthermophilic archaeum. Appl. Environ. Microbiol. 59, 2918–2926. Wan, Y., Ju, X., Ingwersen, J., Schwarz, U., Stange, C. F., Zhang, F., and Streck, T. (2009). Gross nitrogen transformations and related nitrous oxide emissions in an intensively used calcareous soil. Soil Sci. Soc. Am. J. 73, 102–112. Webster, E. A., and Hopkins, D. W. (1996). Contributions from different microbial processes to N2O emission from soil under different moisture regimes. Biol. Fertil. Soils 22, 331–335. Well, R., and Flessa, H. (2009). Isotopologue signatures of N2O produced by denitrification in soils. J. Geophys. Res. 114, G02020. Well, R., Kurganova, I., Lopes de Gerenyu, V., and Flessa, H. (2006). Isotopomer signatures of soil-emitted N2O under different moisture conditions - a microcosm study with arable loess soil. Soil Biol. Biochem. 38, 2923–2933. Well, R., Flessa, H., Xing, L., Xiaotang, J., and Ro¨mheld, V. (2008). Isotopologue ratios of N2O emitted from microcosms with NH4þ fertilized arable soils under conditions favoring nitrification. Soil Biol. Biochem. 40, 2416–2426. Werber, M. M., and Mevarech, M. (1978). Induction of a dissimilatory reduction pathway of nitrate in Halobacterium of the Dead Sea. Arch. Biochem. Biophys. 186, 60–65.
160
Dorien M. Kool et al.
Wrage, N., Velthof, G. L., Laanbroek, H. J., and Oenema, O. (2004a). Nitrous oxide production in grassland soils: Assessing the contribution of nitrifier denitrification. Soil Biol. Biochem. 36, 229–236. Wrage, N., Lauf, J., del Prado, A., Pinto, M., Pietrzak, S., Yamulki, S., Oenema, O., and Gebauer, G. (2004b). Distinguishing sources of N2O in European grasslands by stable isotope analysis. Rapid Commun. Mass Spectrom. 18, 1–7. Wrage, N., Van Groenigen, J. W., Oenema, O., and Baggs, E. M. (2005). A novel dualisotope labelling method for distinguishing between soil sources of N2O. Rapid Commun. Mass Spectrom. 19, 3298–3306. Xue, D., De Baets, B., Botte, J., Vermeulen, J., Van Cleemput, O., and Boeckx, P. (2010). Comparison of the silver nitrate and bacterial denitrification methods for the determination of nitrogen and oxygen isotope ratios of nitrate in surface water. Rapid Commun. Mass Spectrom. 24, 833–840. Zumft, W. G., and Kroneck, P. M. H. (2007). Respiratory transformation of nitrous oxide (N2O) to dnitrogen by bacteria and archaea. Adv. Microb. Physiol. 52, 107–227.
C H A P T E R
S E V E N
A Polyphasic Approach to Study Ecophysiology of Complex Multispecies Nitrifying Biofilms Satoshi Okabe,* Hisashi Satoh,* and Tomonori Kindaichi† Contents 1. Introduction 2. Microsensors 2.1. Amperometric microsensors 2.2. Potentiometric microsensors 3. Microsensor Measurements 4. Estimation of Microbial Activities 5. Limitations of Microsensor Measurements 6. MAR–FISH 7. Methodology of MAR–FISH 7.1. Sample incubation with radioactive compound 7.2. Sample fixation, washing, and preparation of slides 7.3. FISH 7.4. MAR 7.5. Microscopic observation 8. Application of Microsensors and MAR–FISH to Nitrifying Biofilms 9. Ecophysiological Interaction Among Community Members 10. Conclusions References
164 165 166 167 169 169 171 172 172 173 174 175 176 176 177 180 182 182
Abstract This chapter aims to highlight the great potential of the combined use of microautoradiography (MAR) combined with fluorescent in situ hybridization (FISH) and microsensor technology in studies of complex multispecies nitrifying biofilms. The combination of FISH and microsensor technology is a powerful and reliable tool to link the spatial organization of microbial communities and their in situ function at community levels. MAR-FISH can be used to * Division of Environmental Engineering, Graduate School of Engineering, Hokkaido University, Sapporo, Hokkaido, Japan Graduate School of Engineering, Hiroshima University, Kagamiyama, Higashihiroshima, Japan
{
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00007-5
#
2011 Elsevier Inc. All rights reserved.
163
164
Satoshi Okabe et al.
simultaneously examine the 16S rRNA-based phylogenetic identity and specific metabolic activity of cultivable or uncultivable microorganisms within complex microbial communities at a single-cell level. Information obtained at both resolution levels must be combined to draw a clear picture of a complex multispecies biofilm ecosystem. In addition, ecophysiological interactions among community members in complex multispecies biofilms can be investigated by tracing the fate of radiolabeled [14C] atom incorporated in nitrifying bacteria with MAR-FISH. The structure, function, and ecophysiological interactions among community members in complex multispecies nitrifying biofilms will be illustrated as an example of the combined use of MAR–FISH and microsensor technology.
1. Introduction Most microorganisms in the natural environment and engineering systems are present in the form of complex multispecies biofilms or aggregates rather than as planktonic (free swimming) cells (Okabe et al., 2003, 2004a; Satoh et al., 2007; Schramm et al., 1996; Yawata et al., 2010). Such complex microbial communities are often characterized by phylogenetic identities, abundance, spatial distribution, activities, interaction among community members, and interspecies competition for space and substrate. Thus, understanding the in situ abundance, spatial distribution, and activity of target microorganisms in complex microbial community is a central theme in microbial ecology. Recent development of ribosomal RNA (rRNA) sequencebased molecular techniques provided new insights into the composition and structure of microbial communities and revealed a remarkably vast microbial diversity including many hitherto-recognized and yet uncultured species in various microbial habitats. There are a vast number of new groups of bacteria and archaea known only from molecular sequences, but their ecophysiological roles in the environment are largely unknown (Narihiro et al., 2009). The significance of this microbial diversity and its relation to function is not fully understood. It is difficult to understand a relationship between the microbial community structure and in situ function without knowing local microenvironments. Change in local microenvironments undoubtedly affects in situ microbial activity and consequently changes microbial composition and spatial distribution (Okabe et al., 2004a; Satoh et al., 2000). Even when microorganisms can be cultivated, physiological properties determined in the laboratory may not necessarily reflect the activity and physiology in the environments, where resource competition, environmental heterogeneity, and other interactions occur. Therefore, appropriate techniques and tools with sufficiently high spatial and temporal resolution are required to link microbial community structure with in situ function (activity).
Ecophysiology of Nitrifying Biofilms
165
Combination of FISH and microsensor technology has been proven to be powerful and reliable tool to link microbial community structure with in situ function (Okabe et al., 1999a,b; Schramm, 2003). The microsensors can detect, directly and with minimum disturbance, the concentration profiles across biofilms, from which lateral average of in situ activity (net rates of production and consumption at a certain depth) can be calculated. The spatial resolution of microsensors is 10–100 mm, depending on the tip diameter. This resolution is at the community level, which is, however, inadequate to characterize substrate uptakes of both cultivated and uncultivated microorganisms at a single-cell level. Further, when the substrates used by unidentified microorganisms are not known, or their abundance is low, the substrate profiles cannot be correlated with the spatial distribution of specific microbial populations. To directly link specific microbial populations or cells to the specific metabolic function (specific substrate uptake) within complex microbial communities, microautoradiography (MAR) combined with fluorescent in situ hybridization (FISH) can be used (Lee et al., 1999; Okabe et al., 2004b; Ouverney and Fuhrman, 1999). In this combination, the activity or function of interest can be determined by microautoradiography, and the phylogenetic identity of microorganisms can be determined with FISH. If one can combine microsensor technology and MAR–FISH, (1) the determination of the physicochemical microenvironment, (2) in situ identification, localization, and quantification of specific microbial populations, groups, or species, and (3) in situ activity (i.e., substrate uptake) of target microorganisms or groups at single-cell level can be simultaneously examined within complex microbial communities such as biofilms. This chapter aims to highlight the principle, experimental protocol, and application of the MAR–FISH and microsensor technology to complex multispecies nitrifying biofilms to address structure, function, and ecophysiological interaction among community members from a single-cell level to a community level, with emphasis on MAR–FISH. The great potential of the combined use of MAR–FISH and microsensors will be addressed. The structure, function, and ecophysiological interactions among community members in complex nitrification biofilms will be illustrated below as an example of the combined use of MAR–FISH and microsensors.
2. Microsensors The microsensors are needle-shaped biochemical sensors with a tip diameter of 1–100 mm which allow for the measurements of the concentrations of specific chemical compounds in microbial communities. Net specific consumption and production rates (i.e., activity) at a certain depth can be estimated from the measured concentration profiles. However,
166
Satoshi Okabe et al.
microsensors may disrupt the physicochemical structure of the microbial communities by consumption of the solute measured, by compression of the local matrix, and by disturbing the flow regime. Although microsensors have inherently such disadvantages, the use of microsensors is at present the best way for direct in situ measurement of chemical concentrations inside microbial communities. Three types of electrochemical microsensors are most often used in studies of microbial ecology: (1) amperometric microsensors, (2) potentiometric microsensors, and (3) microbiosensors that are actually amperometric microsensors including a biological or an enzymatic reaction in the sensor tip. As the principle and construction of all the sensors have been well described elsewhere (de Beer et al., 1997; Gieseke and de Beer, 2004; Revsbech, 2005), they will be described briefly here.
2.1. Amperometric microsensors The typical examples of amperometric microsensors are O2, N2O, and NO microsensors (Andersen et al., 2001; Revsbech, 1989; Schreiber et al., 2008). The construction of amperometric microsensors is well established. As it is not possible to outline all the details for the construction of amperometric microsensors here, only the construction of Clark-type O2 microsensor is described (Revsbech, 1989). The Clark-type O2 microsensor consists of a tapered platinum wire situated behind a silicone membrane and immersed in an electrolyte solution, which works as a sensing cathode (Fig. 7.1). The platinum wire is finely tapered by etching in a saturated
Guard cathode Ag/AgCl anode as reference electrode
Platinum wire 8533 glass Electrolyte
Sensing gold cathode
Silicone membrane
Figure 7.1 Schematic drawing of a Clark-type oxygen microsensor.
Ecophysiology of Nitrifying Biofilms
167
KCN solution, while 2–7 V AC is applied. For etching, a graphite rod (e.g., pencil lead) is immersed in the saturated KCN solution as the other electrode to complete the circuit. Then the etched platinum wire is coated with a glass capillary (e.g., Schott 8533 glass, Schott, Maim, Germany) that has good insulating characteristics and stability under alkaline conditions. The tip of the platinum wire should be exposed by heating excess glass with a small nichrome wire and electroplated with gold in the tip of the Pasteur pipette under a microscope. The glass-covered and gold-plated platinum wire is inserted in an outer casing made from a tapered Pasteur pipet. The opening of the tip of the outer casing is closed by silicone membrane. A guard cathode is made from a silver wire with a 50–200 mm of diameter, which is electrochemically coated with AgCl. The guard cathode is used to prevent diffusion of oxygen to the cathode from the electrolyte reservoir and thus reduce the background signal. The outer casing is filled with the electrolyte (1 M KCl) through an opening at the end of the casing, a chlorinated silver (Ag/AgCl) wire as a reference electrode and a guard cathode are inserted into the electrolyte, and then the microsensor is ready for use. As described above, the construction of amperometric microsensors is complicated and laborious, and requires special skills. However, the amperometric microsensors are now commercially available (www.unisense.com, Unisense A/S, Aarhus, Denmark), making the use of them easier.
2.2. Potentiometric microsensors Liquid ion exchange (LIX)-based microsensors are the examples of potentiometric sensors, and there are microsensors for NH4þ, NO2, NO3, and pH, which have been used often for the studies of nitrogen cycle (de Beer et al., 1997; Gieseke and de Beer, 2004; Gieseke et al., 2003; Kindaichi et al., 2004a; Okabe et al., 1999a, 2004a). The ion-selective membrane is in this case liquid ion exchangers, some of which are commercially available (e.g., from Fluka). The construction of the LIX-based microsensors is easier than that of the amperometric microsensors. A green glass capillary (e.g., 3.5 mm outer diameter, No. 8516; Schott, Maim, Germany) with good insulating characteristics is heated in the flame and pulled into a microcapillary with a thickness of about 200 mm. The shoulder at thick part of the green glass is cut and then fused together with a slightly tapered white glass (e.g., 5 mm outer diameter, AR glass, Schott, Maim, Germany) in a small flame (Fig. 7.2). Both glasses must be completely sealed. Further, the thin glass capillary is hanged, heated by a nichrome wire, and pulled by gravity to a thickness of ca. 15 mm. The tip of the green glass capillary is broken to open the hole with the desired dimension with a cutter knife. The opening is shaped to a sphere by heating it with the small nichrome wire. To seal the tip of the capillary with the hydrophobic LIX membrane, the glass must be
168
Satoshi Okabe et al.
Outer casing Ag/AgCl wire
White glass Electrolyte Green glass Electrolyte Ag/AgCl wire
LIX
Figure 7.2
Schematic drawing of a LIX microsensor.
silanized. The glass capillary is baked at 150 C for 3 h to dry completely and then is silanized with N-dimethyltrimethylsilylamine overnight at 200 C in a desiccator. It should be noted that the gaseous silane is toxic so that one must be careful not to inhale the vapor. The silanized glass capillary is completely filled from the backside with the electrolyte corresponding to the LIX used. The filling electrolyte should be degassed under vacuum. To complete the electric circuit the air bubbles must be removed. The tip of the glass capillary is inserted into the LIX at the tip of a Pasteur pipette by carefully adjusting the position of the tip with a micromanipulator under the microscope. The LIX is introduced into the tip of the green glass capillary by applying suction with the syringe until a length of the LIX becomes about 300 mm. Subsequently, the LIX membrane should be solidified in the tip with LIX containing PVC. A silver wire coated with AgCl (50–200 mm in diameter) is inserted into the glass capillary. Finally, an outer casing is made from a Pasteur pipet, and the silanized glass capillary is inserted into an outer casing containing the electrolyte (1 M KCl) to reduce electrical noise. LIX microsensors can be constructed with a tip diameter as small as 1 mm. Although the LIX microsensors are not commercially available due to their short lifetime, construction of them is relatively easy and well established (de Beer et al., 1997; Gieseke and de Beer, 2004). Due to interferences, none of the mentioned LIX sensors can be applied in brackish or marine waters. The signal stability is also often a problem, but a coating of the sensor tips with a protein layer may improve the stability (de Beer,
Ecophysiology of Nitrifying Biofilms
169
2000). When constructing the LIX microsensors in your own laboratory, the estimation of selectivity factors is recommended.
3. Microsensor Measurements Intact biofilm samples are taken and fixed in a flow cell reactor that is filled with a synthetic medium. As LIX-based microsensors suffer from interference of other ions, the medium composition and concentrations should be considered carefully to minimize the interference. Temperature, pH, and other physicochemical parameters (e.g., a liquid flow rate) should be also adjusted and controlled to mimic the environment where the biofilm samples were taken from. Biofilm samples should then be acclimated in a medium a few hours before measurements to ensure that steadystate profiles are obtained. The profiles can be measured by advancing the microsensors at depth steps of 50–100 mm through the biofilm using a motor-driven micromanipulator. Signal readings are monitored with an ammeter for amperometric microsensors or a voltmeter for LIX-based microsensors. The motor-driven micromanipulator, ammeter, voltmeter, as well as other equipments for microsensor measurements are provided by Unisense A/S (www.unisense.com, Aarhus, Denmark). Due to fragility of microsensors and interference of other chemicals especially with LIX-based microsensors, it is difficult to measure the concentration profiles of the biofilms living in biological reactors in situ, although deep sea landers for in situ profiling has been successfully developed (www.unisense.com). Therefore, it is desirable that the concentration profiles should be measured under realistic conditions (i.e., water flow, water chemistry, temperature, etc.). To provide sufficient water flow (e.g., 2–3 cm s 1) above the biofilm, air and/or N2 gas is blown onto the water surface from a Pasteur pipette, the medium is mixed with a magnetic stirrer, or a flow cell (continuous feeding) system can be used. Concentration profiles should be measured several times at different positions or each chemical and condition because of biofilm heterogeneity. The experimenter must determine biofilm–liquid interface by viewing through a dissection microscope with special care.
4. Estimation of Microbial Activities Estimation of microbial activities in biofilm based on the concentration profiles measured with microsensors is one of the good examples of microsensor application. Due to the combined effect of microbial conversion and mass transfer resistance, substrate and product gradients develop inside biofilms. Assuming that no liquid flow occurs inside the biofilm,
170
Satoshi Okabe et al.
diffusion is the only transport mechanism inside the biofilm. The bulk liquid is usually well mixed by advective transport. In the boundary layer at the biofilm–liquid interface, the liquid flow velocity gradually decreases in direction of the biofilm. Consequently, the mode of transport changes gradually from advectional in the bulk liquid to diffusional in the boundary layer. Diffusional transport is driven by concentration differences as expressed in Fick’s law. The diffusional transport (i.e., total consumption rate or flux; Ji) of a type of solute i in biofilm can be calculated from the steady-state concentration profiles by using Fick’s first law of diffusion: dCi Ji ¼ Di dz where Di is the molecular diffusion coefficient in the liquid phase and dCi/ dz is the measured concentration gradient of the solute i in the boundary layer between the biofilm and bulk liquid. Moreover, net volumetric consumption rates of solute i in the biofilm are calculated from the steady-state concentration profiles by using Fick’s second law of diffusion as previously described by Lorenzen et al. (1998). Assuming steady state, the equation of Fick’s second law of diffusion including a consumption term (R(z)) can be reduced to dCðzÞ Di ¼ RðzÞ dz2 Defining A(z) ¼ R(z)/Di and using Euler’s formula for numeric integration, we find dC dC ¼ þ hAn dznþ1 dzn where h determines the step size used for numerical integration. After further integration, we have dC Cnþ1 ¼ Cn þ h dzn Substituting dC/dzn with the above equation, we find dC Cnþ1 ¼ Cn þ h þ hAn1 dzn1
Ecophysiology of Nitrifying Biofilms
171
As a boundary condition, we introduce the same concentration point below the deepest measuring point where the microbial activity is zero. From this point, concentration profiles were calculated stepwise toward the biofilm surface by altering net activities by using Microsoft Excel to minimize the sum of squared deviations of the calculated profile from the measured profile and the sum of squared first derivatives of the guessed activities. More details of this calculation method were described elsewhere (Lorenzen et al., 1998).
5. Limitations of Microsensor Measurements One of the advantages of microsensor measurements is to determine in situ microbial activities with biofilms alive. As the 90% response time of gas-sensitive amperometric microsensors is typically less than 0.5 s, a time series measurement of chemicals is possible in a biofilm in real time (Nakamura et al., 2004; Schreiber et al., 2009; von Ohle et al., 2010). However, it should be noted that true in situ measurements of microbial activity in the biofilms living in a biological reactor could be difficult, because profiles and rates measured in laboratory setups must show “pseudo in situ” profiles, and in general, they do not necessarily reflect the true in situ results. The actual spatial resolution of a microsensor should be at least two times of the tip diameter (Schramm, 2003). Some microsensors (e.g., NO2 microsensor) having too small tip diameter (<10 mm) tend to suffer more from the influence of interfering ions, although the sensors with a tip diameter of about 1 mm can be constructed (de Beer et al., 1997). However, the microsensors having larger tip diameter might cause consumption of the analyte by the sensor and disturbance of the diffusion boundary layer and biofilm structure. The latter leads to a change in flow rate and overestimation of calculated microbial activity. Therefore, to determine microenvironments in nitrifying biofilms, the spatial resolution has been restricted to a few 10 mm. During application of LIX microsensors to environmental samples, problems can sometimes appear. Gieseke and de Beer (2004) summarized typical problems that users may face and provide troubleshooting information for common problems (e.g., slow or no response, sudden signal jumps, signal drift, low slope of a calibration curve, and low signal-to-noise ratio). For instance, when readings show drift, you should doubt if leakage of current at glass surface and membrane interface causes dissipation of potential difference. If problem persists, new capillaries should be prepared with special care for silanization step. In addition, it is recommended that one wears antistatic shoes if signal is noisy when touching the setup.
172
Satoshi Okabe et al.
6. MAR–FISH The microautoradiography (MAR) was successfully combined with 16S rRNA gene-based fluorescence in situ hybridization (FISH) by Lee et al. (1999) and Ouverney and Fuhrman (1999). The combined MAR and FISH is also named as follows; MAR–FISH (Lee et al., 1999), STAR–FISH (substrate tracking autoradiography–fluorescence in situ hybridization) (Ouverney and Fuhrman, 1999), MICRO–FISH (MICROautoradiography–fluorescence in situ hybridization) (Cottrell and Kirchman, 2000). The principle of these techniques is basically identical. MAR–FISH allows a simultaneous analysis of the rRNA-based (probe defined) phylogenetic identification and in situ substrate uptake patterns (metabolic capability) of various cultivable or uncultivable bacteria in complex microbial communities at the single-cell level of resolution (0.5–2 mm). MAR–FISH has high sensitivity compared with other techniques such as DNA- or RNA-stable isotope probing (SIP) (Radajewski et al., 2000), because radioactive compounds can be incorporated into cellular macromolecules not only nucleic acids. MAR–FISH requires relatively short incubation times and thus can minimize substrate cross-feeding to nontargeted microorganisms. In addition, MAR–FISH has higher spatial resolution than microsensor technology. MAR–FISH has recently been used to study the in situ ecophysiology or metabolic potential of various cultivable or uncultivable microorganisms in various habitats reported by Gray and Head (2001), Nielsen and Nielsen (2005), Okabe et al. (2004b), and Wagner et al. (2006) The methodology of MAR–FISH and the application to complex nitrifying biofilms will be described below.
7. Methodology of MAR–FISH The typical MAR–FISH procedure is constituted of (1) sample incubation with radioactive compounds, (2) sample fixation and slide preparation, (3) in situ hybridization, (4) microautoradiography, and (5) microscopic observation (Fig. 7.3). The principle of MAR–FISH and improvements or options for applying to complex microbial communities are summarized by Nielsen and Nielsen (2005) and Okabe et al. (2004b) The details of each step of MAR–FISH procedure are described below. It should be noted that the experiments with radioactive compounds must comply with safety regulations and may require special facilities in many countries. The production of radioactive wastes should also be minimized.
173
Ecophysiology of Nitrifying Biofilms
1. Incubation Homogenized samples
• [3H] or [14C]-labeled substrates • Oxic/anoxic/anaerobic • Temperature
Biofilm samples 2. Fixation Slide preparation
• Fixation by 4% PFA • Washing by PBS • Homogenization or sectioning 3. FISH
In situ hybridization Hybridize with oligonucleotide probes
4. MAR
Coating (LM-1)
Exposure (2–7 days)
Development
Silver grains
5. Observation FISH
MAR
MAR–FISH
CLSM Fluorescence
Transmission
Uptake of 14C substrate
Figure 7.3 Experimental overview of MAR–FISH analysis.
7.1. Sample incubation with radioactive compound In advance of incubation with radioactive compounds, experimental parameters (e. g., incubation time, biomass concentration, radioactivity, combination of electron donor and acceptor, temperature, shake or static incubation, and culture volume) should be determined by preexperiment with nonradioactive compounds. The incubation time is dependent on the concentrations of biomass and substrate. The biomass and substrate concentrations should be set to avoid substrate depletion during incubation period. In nitrifying biofilms, we have used a 2–5 ml of culture volume (transferred into 10- to 20-ml glass serum vials) with 1–3 g volatile suspended solids per liter after homogenization, 1– 5 mCi ml 1 (37–185 kBq ml 1) for 3–6 h incubation (Kindaichi et al., 2004b;
174
Satoshi Okabe et al.
Okabe et al., 2005). The smaller culture volume is recommended to minimize the production of radioactive waste. Radioactive compound is chosen based on the availability (can be purchased or not), type of isotope (typically 14C or 3H labeled substrate, possibly 35S and 33P labeled substrates), and the position of the labeled atom(s) in compounds. Type of isotope is related to the resolution of MAR image: 3H is generally higher resolution compared with the 14C (Nielsen and Nielsen, 2005). The position of the labeled atom(s) must be carefully chosen in consideration of the ability of bacteria to incorporate the labeled atom to cells. It should be noted that some radioactive compound is dissolved in organic solvents such as ethanol or toluene. When autotrophs are the target microorganisms, these organic solvents should be removed prior to the incubation due to the inhibition or the potential growth of nontarget microorganisms. It is important to include negative controls (samples that are heated at 70 C for 15 min) in parallel to test the possible adsorption phenomena and chemography (silver grain formation without radioactivity). Specific inhibitors can be used to evaluate specific microbial activity. For example, allylthiourea (ATU) is a specific inhibitor for the activity of ammoniaoxidizing bacteria (AOB). Physicochemical parameters (pH, temperature, culture volume, and shaking speed) should be checked before and after incubations. Experiments must be run in duplicate or triplicate.
7.2. Sample fixation, washing, and preparation of slides After incubation with radioactive and nonradioactive compounds, the samples are fixed with paraformaldehyde (PFA) for 3 h at 4 C by adding the same amount of 8% PFA in phosphate-buffered saline (PBS) (10 mM sodium phosphate buffer, 130 mM sodium chloride, pH 7.2). After fixation, the samples must be washed three times by repeating centrifugation (10,000g for 8 min) and resuspension with washing buffer (PBS) to remove unincorporated radioactive compounds. The uptake of radioactive compounds into biomass must be confirmed by liquid scintillation counting in all experiments before MAR–FISH. One milliliter of culture samples is centrifuged at 10,000g for 8 min and washed three times with 1 ml of PBS. The harvested biomass is resuspended in 1 ml of PBS, and a 0.1 ml aliquot was then added to 3 ml of scintillation liquid (Ultima Gold XR; Packard BioScience Co., Meriden, CT). After the sample is thoroughly mixed with scintillation liquid and stored at room temperature for 3 h, the radioactivity can be measured with a liquid scintillation counter (e.g., Aloka model LSC-1000, Aloka, Co. Ltd., Tokyo, Japan). For measurement of total radioactive compounds, the culture sample (biomass plus culture medium) is directly subjected to the liquid scintillation counting. The percentage of radioactivity incorporated
Ecophysiology of Nitrifying Biofilms
175
into the biomass is calculated by subtracting the radioactivity in the biomass from that in the culture samples. In our experience, at least more than 1% of total radioactivity must be incorporated into biomass to detect sufficient amount of silver grain after 2–3 days of exposure. After the fixation and washing steps, about 20 ml of sample is spotted on gelatin-coated cover glasses and air dried. Then the sample is finally dehydrated by successive 50%, 80%, and 99% ethanol washes (1 min each), air dried, and stored at room temperature. It is sometimes required to homogenize the samples to quantitatively count the MAR-positive cell number for biofilm or aggregate samples. When one wants to study whole biofilms or aggregates, the biofilm samples are embedded in Tissue-Tek OCT compound (Miles, Elkhart, IN) and subsequently frozen at 20 C (Okabe et al., 1999a). The frozen sample is cut into 5- or 10-mm thick sections with a cryostat (e.g., Reichert-Jung Cyocut 1800, Leica) at 20 C. In general, the thinner section gives the better spatial resolution of MAR (Lee et al., 1999; Nielsen et al., 2002). The sectioned specimen is placed on gelatincoated cover glasses and air dried. Then the specimen is also dehydrated by successive 50%, 80%, and 99% ethanol washes (3 min each), air dried, and stored at room temperature. Gelatin coating is carried out using cover glasses (24 60 mm) that are washed in boiling water with 0.2% detergent to reduce the water-repellent surface and rinsed in distilled water. After rinsing, the cover glasses dipped in a solution containing 0.1% gelatin and 0.01% chromium potassium sulfate at 70 C and air dried. Insufficient coating may cause the detachment of spotted biomass or specimen during washing steps in FISH or MAR procedure.
7.3. FISH FISH can be directly applied to the samples spotted on the cover glass. We usually use 16 ml of hybridization buffer with the required formamide concentration with 2 ml of each probe (50 ng/ml). Then the sample is hybridized at 46 C for 3 h in a moisture chamber. It should be noted that the moisture chamber place horizontally to avoid spilling the hybridization buffer on the cover glasses. When applying two probes, simultaneous hybridizations with the probes requiring different stringency conditions are performed; hybridization with the probe requiring higher stringency is performed first, and then hybridization with the probe requiring lower stringency is performed (Wagner et al., 1994). After the hybridization, the cover glasses are washed with the washing buffer at 48 C for 20 min. The intensity of fluorescence signals tends to be reduced by pH variation during MAR development stage. In addition, antifade reagents cannot be used after MAR procedure. We therefore recommend using Alexa-, Fluorescein-, or Cy3-labeled probes, which show high fluorescence intensity and more stable signals regardless of pH variation. After FISH, other staining
176
Satoshi Okabe et al.
techniques such as DAPI can be performed at this step. When the catalyzed reporter deposition-FISH (CARD-FISH) can be performed to determine the activity of cells with low-ribosomal content, some modification is needed due to the strong background or permeability problems as described by Nielsen and Nielsen (2005).
7.4. MAR After FISH, autoradiographic procedure is performed in a dark room under the safelight for photography. The film emulsion (Hypercoat LM-1, GE healthcare) is warmed in water bath at 43 C at least 15 min with mildmixing to avoid the occurrence of bubbles in emulsion. Then the warmed emulsion is carefully (to avoid air bubbles) transferred into a dipping vessel in a water bath at 43 C. The cover glass is dipped in the emulsion for 5 s and then vertically placed on tissue papers for 5 s. Thereafter, the opposite side (not mounted samples) of cover glass is fully wiped with tissue papers. This dipping time (i.e., about 5 s) and temperature are important factors for obtaining the optimal thickness of autoradiographic films. We usually use a final emulsion concentration of 90% at 43 C. The cover glasses are horizontally arranged in a tray for 2 h in the dark room and then are rearranged in a light-tight (covered with aluminum foil) slide box with silica gel for exposure at 4 C. Although the exposure time depends on the amount of radioactive compound incorporated into the biomass as determined by scintillation counting, we usually expose for 1–7 days and examine several cover slides with different exposure times to find optimal exposure times after counter-staining with DAPI (MAR-DAPI). Long exposure time increases background signals and decreases probe fluorescence intensities, lowering the resolution of MAR. After exposure, the film development is performed in a dark room under the safelight. The exposed cover glasses are placed in the developer (Kodak D19, 40 g/l) for 3 min. The developed cover glasses are washed with pure water for 1 min and then placed in the fixer (sodium thiosulfate, 300 g/l) for 4 min. The fixed cover glasses are washed with pure water for 1 min and then placed in fresh pure water for 10 min. The pH in final washing water is important, because the fluorescence intensity of oligonucleotide probes sometimes depends on the pH. We often use tap water as final washing water. After washing, the cover glasses are air dried and store at 4 C (in a refrigerator) before the observation to avoid the decrease of fluorescence intensity.
7.5. Microscopic observation Silver grains on MAR image can be observed by phase-contrast microscopy, whereas cells that are hybridized with fluorescent probe can be observed by epifluorescence microscopy. We recommended the use of
Ecophysiology of Nitrifying Biofilms
177
confocal laser scanning microscopy, especially when examining aggregates or biofilms. In this case, MAR signals can be detected by transmitted light mode. It is noted that MAR and FISH images can be observed through the cover glass from the backside. Therefore, inverted microscopes are recommended for the observation. In case of upright microscopes, the cover glass is placed upside down, thereby preventing detachment or disruption of the autoradiographic film by the movement of objective lens (Lee et al., 1999). For MAR–FISH analysis, we often define a cell that accumulates more than five silver grains as a MAR-positive cell. The numbers of MARpositive cells and total probe-hybridized cells are quantified by directly counting a minimum of 500 silver grain-covered cells in randomly chosen microscopic fields. When samples are incubated with internal standards defined as bacteria with known specific radioactivity, the specific substrate uptake rate can be quantified (QMAR–FISH described by Nielsen et al., 2003).
8. Application of Microsensors and MAR–FISH to Nitrifying Biofilms The combined use of microsensors and MAR–FISH is a valuable tool that can improve our understanding of the structure and function of microbial community and ecophysiological interaction among the community members. As an example of the combined study, we will illustrate the structure and in situ function of multispecies nitrifying biofilms developed in a bench scale rotating disk reactor, in which removable slides (1 6 cm) for biofilm samplings were installed (Kindaichi et al., 2004b; Okabe et al., 2004a). First, chemical microprofiles are determined with microsensors as described above (Fig. 7.4). After microsensor measurements, biofilms were directly incubated with 20 mCi [14C]bicarbonate (sodium [14C]bicarbonate; specific activity, 58 mCi mmol–1, GE healthcare) and 1 mM NH4þ for 6 h (60 ml of culture volume) at 30 C, rinsed twice with distilled water, and then embedded in OCT compound, cryosectioned (10-mm thick), and subjected to FISH and microautoradiography as described above (Fig. 7.3). The localization of in situ NH4þ-oxidizing activity in the biofilm can be analyzed at a single-cell level and compared with the results of microsensor study that represent the lateral average of NH4þ-oxidizing activity. Figure 7.5 shows steady-state concentration profiles of O2, NH4þ, NO2, and NO3 in a nitrifying biofilm. Oxygen penetrated down to 160 mm in the biofilm. The concentration profiles in the biofilm revealed significant decreases in the concentrations of NH4þ and NO2 and a corresponding increase in the concentration of NO3 in the upper
178
Satoshi Okabe et al.
1 Microelectrode measurements
Microprofiles versus MAR–FISH
3 [14C]bicarbonate
2
MAR–FISH
6-h incubation Org-C NH4Cl DO pH Temp.
Cryosection FISH
0 mM 1000 mM 260 mM 7–8 20 ⬚C
Microautoradiography CSLM
Figure 7.4 A polyphasic approach to investigation on microbial community structure, function, and ecophysiological interactions among community members in complex multispecies nitrifying biofilms by combining microsensor technology with MAR–FISH.
Rate (µmol/cm3/h) 0
150
100
50
200
Biofilm depth (µm)
-200
-100
0
100
200 0
100
200
300
400
500
Concentration (µM )
Figure 7.5 Steady-state concentration profiles of O2 (d), NH4þ (m), NO2 (■), and NO3 (♦) in a nitrifying biofilm. The spatial distribution of the estimated volumetric consumption rates of NH4þ (bars) is also shown. The biofilm surface is at a depth of 0 mm.
179
Ecophysiology of Nitrifying Biofilms
100 mm of the biofilm (Fig. 7.5). It indicates that nitrification predominantly occurred in this surface layer due to higher O2 concentration. Figure 7.6 shows an representative MAR–FISH image of a thin section of the same nitrifying biofilm after incubation with [14C]bicarbonate and NH4þ for 6 h. In this nitrifying biofilms, most of the AOB were present in the form of dense spherical microcolonies. Two different groups of AOB were present: one was hybridized with both probes of Nso190 (Mobarry et al., 1996) and NEU (Wagner et al., 1995) and the other was only hybridized with Nso190. Only both AOB located in the surface 100 mm of the biofilm could assimilate [14C]bicarbonate, indicating high ammonia-oxidizing activity due to high NH4þ and O2 concentrations. This MAR–FISH result is consistent with the microsensor result. The microsensor measurement could reveal the distribution of lateral average ammonia- and nitrite-oxidizing activities, whereas the MAR–FISH reveals two-dimensional activity distributions at the single-cell resolution in complex microbial communities. Further, MAR–FISH shows the difference of physiological activity between AOB species. The AOB hybridized both probes (Nitrosomonas europaea cluster) could not take up [14C]bicarbonate under low NH4þ concentrations (below 1 mM of NH4þ). The members of AOB hybridized with only Nso190 probe are probably Kstrategists (with high substrate affinities) and thus most likely outcompete the members of N. europaea cluster that have low substrate affinities (r-strategists).
A
B
Figure 7.6 Combined MAR–FISH image of thin-sectioned autotrophic nitrifying biofilm. (A) In situ hybridization was performed with FITC-labeled probe NEU, which was used simultaneously with TRITC-labeled probe Nso190. (B) Uptake of [14C] bicarbonate by ammonia-oxidizing bacteria when 1 mM of NH4þ was used as the sole electron donor after 6 h of incubation under oxic condition at 30 C. The biofilm surface is at the top. Bars ¼ 10 mm.
180
Satoshi Okabe et al.
9. Ecophysiological Interaction Among Community Members The coexistence of heterotrophic bacteria with nitrifying bacteria has often been found in autotrophic nitrifying biofilms cultured without an external organic carbon supply (Kindaichi et al., 2004b; Okabe et al., 1999a). Okabe et al. (2005) reported the cross-feeding of microbial products derived from nitrifying bacteria to heterotrophic bacteria coexisting in an autotrophic nitrifying biofilms. In this study, nitrifying bacterial cells were first labeled with [14C]bicarbonate, and then the transfer of 14C originally incorporated into nitrifying bacteria to heterotrophic bacteria was quantitatively monitored with time by using MAR–FISH (Fig. 7.7). The MAR– FISH analysis revealed that the 14C-labeled microbial products derived from nitrifying bacterial cells were subsequently utilized by different phylogenetic groups of heterotrophic bacteria; these bacteria preferentially utilized substrate utilization-associated products of nitrifying bacteria and/or secondary metabolites of 14C-labeled structural cell components (biomass-associated products) (Fig. 7.8). The result revealed that there was an efficient food web (carbon metabolism) established in the autotrophic nitrifying biofilm community, which ensured maximum utilization of organic matter produced by First phase: NB Labeling experiment
3.6 mM NH+4 [14C]bicarbonate Homogenized biofilm
14
C
NB HB
6h incubation
14C-NB
14
C
Washing
14C-NB
HB
HB
Second phase: HB utilizing experiment
Homogenized new biofilm [14C]NB cells with or without 3.6 mM NH+4
HB 14C-NB
NB
HB
10 days incubation
14C-NB
NB
14C-HB
With 3.6 mM NH+4 [14C]HB cells incorporate UAP + BAP Without 3.6 mM NH+4 [14C]HB cells incorporate BAP
NB, nitrifying bacteria; HB, heterotrophic bacteria; UAP, utilization-associated products; BAP, baiomass-associated products
Figure 7.7 Overview of cross-feeding experiment. Only nitrifying bacteria are labeled by [14C]bicarbonate under oxic condition (first phase), and then the washed biomass is incubated with newly homogenized biofilm to investigate whether coexisting heterotrophic bacteria could incorporate microbial products derived from 14C-labeled nitrifying bacterial cells (second phase).
181
Ecophysiology of Nitrifying Biofilms
B 80
MAR-positive cells (%)
MAR-positive cells (%)
A Chloroflexi 60 40 20 0 0
2
4
6
8
80 CF-cluster 60 40 20 0
10
0
2
Time (day)
8
10
8
10
D 80
MAR-positive cells (%)
MAR-positive cells (%)
C
4 6 Time (day)
a-Proteobacteria
60 40 20 0 0
2
4 6 Time (day)
8
10
80
g-Proteobacteria
60 40 20 0 0
2
4 6 Time (day)
MAR-positive cells (%)
E 80
b-Proteobacteria %=
60 40
FISH-and MAR-positive cells FISH-positive cells
with NH4+ addition without NH4+ addition
20 0 0
2
4 6 Time (day)
8
10
Figure 7.8 Uptake patterns of 14C-labeled microbial products derived from nitrifying bacteria by Chloroflexi (A), by the members of the CF cluster (B), by Alphaproteobacteria (C), by Gammaproteobacteria (D), and by Betaproteobacteria (E). The fractions of probehybridized and MAR-positive cells that incorporated 14C-labeled microbial products derived from nitrifying bacteria were expressed as percentages of the total specific probe-hybridized cells. The error bars indicate the standard errors of duplicate samples. This figure is reproduced from Okabe et al. (2005).
nitrifying bacteria and prevented built-up of metabolites or waste materials of nitrifying bacteria. In complex multispecies nitrifying biofilms, exchange of substrates among community members is the most important and interesting ecophysiological interaction, which cannot be determined in individual pure culture studies and microsensor technology.
182
Satoshi Okabe et al.
10. Conclusions There are many useful tools with different spatial and temporal resolutions to study microbial ecology in complex microbial communities. Among which, the combined use of microsensor technology and MAR– FISH is undoubtedly very powerful to address fundamental questions about microbial identities, functions, and spatial organization in complex multispecies nitrifying biofilms. MAR–FISH has significant potential for providing a direct link between phylogenetic identification and in situ substrate uptake patterns without the need for cultivation or isolation. Further, ecophysiological interaction (exchange of substrates) among community members can be quantitatively determined by MAR–FISH. There is no one perfect analytical tool to address all the questions simultaneously, and thus a polyphasic approach (combining several analytical tools including classic culture-dependent analyses) is inevitable. New powerful tools, like metagenomic-, metatranscriptomic-, and metaproteomic-based approach, have been used to study the microbial community function and interaction among the community members in situ based on genomic information, which sequences relate to which proteins and functions. However, despite the rapid progress of new technology, the function of large portions of whole genomes from well-studied bacteria is still unknown. Thus, it is essential to take well-balanced combined approaches to understand the entity of complex multispecies nitrifying biofilms.
REFERENCES Andersen, K., Kjaer, T., and Revsbech, N. P. (2001). An oxygen insensitive microsensor for nitrous oxide. Sens. Actuators B 81, 42. Cottrell, M. T., and Kirchman, D. L. (2000). Natural assemblages of marine proteobacteria and members of the Cytophaga-Flavobacter cluster consuming low- and high-molecularweight dissolved organic matter. Appl. Environ. Microbiol. 66, 1692. de Beer, D. (2000). Potentiometric microsensors for in situ measurements in aquatic environments. In “In Situ Monitoring of Aquatic Systems: Chemical Analysis and Speciation,” ( J. Buffle and G. Horvai, eds.), pp. 161–194. Wiley, New York. de Beer, D., Schramm, A., Santegoeds, C. M., and Kuhl, M. (1997). A nitrite microsensor for profiling environmental biofilms. Appl. Environ. Microbiol. 63, 973. Gieseke, A., and de Beer, D. (2004). Use of microelectrodes to measure in situ microbial activities in biofilms, sediments, and microbial mats. In “Molecular Microbial Ecology Manual,” (A. D. L. Akkermans and D. van Elsas, eds.), pp. 1581–1612. Kluwer Academic Publishers, Dordrecht, The Netherlands. Gieseke, A., Bjerrum, L., Wagner, M., and Amann, R. (2003). Structure and activity of multiple nitrifying bacterial populations co-existing in a biofilm. Environ. Microbiol. 5, 355. Gray, N. D., and Head, I. M. (2001). Linking genetic identity and function in communities of uncultured bacteria. Environ. Microbiol. 3, 481.
Ecophysiology of Nitrifying Biofilms
183
Kindaichi, T., Okabe, S., Satoh, H., and Watanabe, Y. (2004a). Effects of hydroxylamine on microbial community structure and function of autotrophic nitrifying biofilms determined by in situ hybridization and the use of microelectrodes. Water Sci. Technol. 49, 61. Kindaichi, T., Ito, T., and Okabe, S. (2004b). Ecophysiological interaction between nitrifying bacteria and heterotrophic bacteria in autotrophic nitrifying biofilms as determined by microautoradiography-fluorescence in situ hybridization. Appl. Environ. Microbiol. 70, 1641. Lee, N., Nielsen, P. H., Andreasen, K. H., Juretschko, S., Nielsen, J. L., Schleifer, K.-H., and Wagner, M. (1999). Combination of fluorescent in situ hybridization and microautoradiography—A new tool for structure-function analyses in microbial ecology. Appl. Environ. Microbiol. 65, 1289. Lorenzen, J., Larsen, L. H., Kjaer, T., and Revsbech, N. P. (1998). Biosensor determination of the microscale distribution of nitrate, nitrate assimilation, nitrification, and denitrification in a diatom-inhabited freshwater sediment. Appl. Environ. Microbiol. 64, 3264. Mobarry, B. K., Wagner, M., Urbain, V., Rittmann, B. E., and Stahl, D. A. (1996). Phylogenetic probes for analyzing abundance and spatial organization of nitrifying bacteria. Appl. Environ. Microbiol. 62, 2156. Nakamura, Y., Satoh, H., Okabe, S., and Watanabe, Y. (2004). Photosynthesis in sediments determined at high spatial resolution by the use of microelectrodes. Water Res. 38, 2440. Narihiro, T., Terada, T., Kikuchi, K., Iguchi, A., Ikeda, M., Yamauchi, T., Shiraishi, K., Kamagata, Y., Nakamura, K., and Sekiguchi, Y. (2009). Comparative analysis of bacterial and archaeal communities in methanogenic sludge granules from upflow anaerobic sludge blanket reactors treating various food-processing, high-strength organic wastewaters. Microbes Environ. 24, 88. Nielsen, J. L., and Nielsen, P. H. (2005). Advance in microscopy: Microautoradiography of single cells. Methods Enzymol. 397, 237. Nielsen, J. L., Juretschko, S., Wagner, M., and Nielsen, P. H. (2002). Abundance and phylogenetic affiliation of iron reducers in activated sludge as assessed by fluorescence in situ hybridization and microautoradiography. Appl. Environ. Microbiol. 68, 4629. Nielsen, J. L., Christensen, D., Kloppenborg, M., and Nielsen, P. H. (2003). Quantification of cell-specific substrate uptake by probe-defined bacteria under in situ conditions by microautoradiography and fluorescence in situ hybridization. Environ. Microbiol. 5, 202. Okabe, S., Satoh, H., and Watanabe, Y. (1999a). In situ analysis of nitrifying biofilms as determined by in situ hybridization and the use of microelectrodes. Appl. Environ. Microbiol. 65, 3182. Okabe, S., Itoh, T., Satoh, H., and Watanabe, Y. (1999b). Analyses of spatial distributions and their activity of sulfate-reducing bacteria in aerobic wastewater biofilms. Appl. Environ. Microbiol. 65, 5107. Okabe, S., Ito, T., and Satoh, H. (2003). Sulfate-reducing bacterial community structure, function and their contribution to carbon mineralization in a wastewater biofilm growing microaerophilic conditions. Appl. Microbiol. Biotechnol. 63, 322. Okabe, S., Kindaichi, T., Ito, T., and Satoh, H. (2004a). Analysis of size distribution and cell density of ammonia-oxidizing bacterial microcolonies, in relation to substrate microprofiles in biofilms. Biotechnol. Bioeng. 85, 86. Okabe, S., Kindaichi, T., and Ito, T. (2004b). MAR-FISH—An ecophysiological approach to link phylogenetic affiliation and in situ metabolic activity of microorganisms at a singlecell resolution. Microbes Environ. 19, 83. Okabe, S., Kindaichi, T., and Ito, T. (2005). Fate of 14C-labeled microbial products derived from nitrifying bacteria in autotrophic nitrifying biofilms. Appl. Environ. Microbiol. 71, 3987.
184
Satoshi Okabe et al.
Ouverney, C. C., and Fuhrman, J. A. (1999). Combined microautoradiography-16S rRNA probe technique for determination of radioisotope uptake by specific microbial cell types in situ. Appl. Environ. Microbiol. 65, 1746. Radajewski, S., Ineson, P., Parekh, N. R., and Murrell, J. C. (2000). Stable-isotope probing as a tool in microbial ecology. Nature 403, 646. Revsbech, N. P. (1989). An oxygen microsensor with a guard cathode. Limnol. Oceanogr. 34, 474. Revsbech, N. P. (2005). Analysis of microbial communities with electrochemical microsensors and microscale biosensors. In “Methods in Enzymology,” ( J. R. Leadbetter, ed.) Vol. 397, pp. 147–166. Academic Press, London, UK. Satoh, H., Okabe, S., Norimatsu, N., and Watanabe, Y. (2000). Significance of substrate C/ N ratio on structure and activity of nitrifying biofilms determined by in situ hybridization and the use of microelectrodes. Water Sci. Technol. 41(4–5), 317. Satoh, H., Miura, Y., Tsushima, I., and Okabe, S. (2007). Layered structure of bacterial and archaeal communities and their in situ activities in anaerobic granules. Appl. Environ. Microbiol. 73, 7300. Schramm, A. (2003). In situ analysis of structure and activity of the nitrifying community in biofilms, aggregates, and sediments. Geomicrobiol. J. 20, 313. Schramm, A., Larsen, L. H., Revsbech, N. P., Ramsing, N. B., Amann, R., and Schleifer, K.-H. (1996). Structure and function of a nitrifying biofilm as determined by in situ hybridization and the use of microelectrodes. Appl. Environ. Microbiol. 62, 4641. Schreiber, F., Polerecky, L., and de Beer, D. (2008). Nitric oxide microsensor for high spatial resolution measurements in biofilms and sediments. Anal. Chem. 80, 1152. Schreiber, F., Loeffler, B., Polerecky, L., Kuypers, M. M. M., and de Beer, D. (2009). Mechanisms of transient nitric oxide and nitrous oxide production in a complex biofilm. ISME J. 3, 1301. von Ohle, C., Gieseke, A., Nistico, L., Decker, E. M., de Beer, D., and Stoodley, P. (2010). Real-time microsensor measurement of local metabolic activities in ex vivo dental biofilms exposed to sucrose and treated with chlorhexidine. Appl. Environ. Microbiol. 76, 2326. Wagner, M., Amann, R. I., Kapfer, P., Assmus, B., Hartmann, A., Hutzler, P., Springer, N., and Schleifer, K.-H. (1994). Identification and in situ detection of gram-negative filamentous bacteria in activated sludge. Syst. Appl. Microbiol. 17, 405. Wagner, M., Rath, G., Amann, R. I., Koops, H.-P., and Schleifer, K.-H. (1995). In situ identification of ammonia-oxidizing bacteria. Syst. Appl. Microbiol. 18, 251–264. Wagner, M., Nielsen, P. H., Loy, A., Nielsen, J. L., and Daims, H. (2006). Linking microbial community structure with function: Fluorescence in situ hybridizationmicroautoradiography and isotope arrays. Curr. Opin. Biotechnol. 17, 83. Yawata, Y., Uchiyama, H., and Nomura, N. (2010). Visualizing the effects of biofilm structures on the influx of fluorescent material using combined confocal reflection and fluorescent microscopy. Microbes Environ. 25, 49.
C H A P T E R
E I G H T
In Situ Techniques and Digital Image Analysis Methods for Quantifying Spatial Localization Patterns of Nitrifiers and Other Microorganisms in Biofilm and Flocs Holger Daims and Michael Wagner Contents 1. Introduction 2. Theory of Spatial Arrangement Quantification by Digital Image Analysis 2.1. The Linear Dipole Algorithm 2.2. The “Inflate Algorithm” 3. Protocols for the Spatial Arrangement Quantification of Nitrifiers 3.1. In situ detection of nitrifiers by FISH 3.2. Microscopy and image acquisition 3.3. Digital image analysis 4. An Application Example: Spatial Analysis of Three Nitrifying Biofilm Populations Acknowledgments References
186 190 190 197 201 201 206 206 208 211 211
Abstract The spatial localization patterns of microorganisms in multispecies biofilms reflect numerous phenomena that influence sessile microbial life, such as substrate concentration gradients within the biofilm and biological interactions with other biofilm populations. Quantitative and population-specific in situ analyses of spatial patterns have a high potential to provide novel insights into the biology of biofilm organisms, including yet uncultured microbes, but such approaches have been developed and used in a few studies only. Here, we outline digital image analysis methods to quantify the coaggregation, mutual avoidance, or random distribution of microbial populations in biofilm and flocs. Department of Microbial Ecology, Ecology Center, University of Vienna, Vienna, Austria Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00008-7
#
2011 Elsevier Inc. All rights reserved.
185
186
Holger Daims and Michael Wagner
A protocol is provided for fluorescence in situ hybridization with rRNA-targeted probes, which preserves the three-dimensional biofilm architecture for confocal microscopy and image analysis, and the combined use of these approaches is demonstrated by spatial analyses of nitrifying bacteria in complex biofilm samples.
1. Introduction The enrichment, isolation, and cultivation of microorganisms are core techniques of microbiology and were essential for the first characterization of ammonia- and nitrite-oxidizing bacteria (AOB and NOB; e.g., Winogradsky, 1892). Still in our days, cultivation has been key to exciting discoveries of novel nitrifiers in nature (Alawi et al., 2007; Ko¨nneke et al., 2005) and has greatly facilitated physiological and genomic analyses of these elusive organisms (Hatzenpichler et al., 2008; Lu¨cker et al., 2010; Walker et al., 2010). However, only the advent of cultivation-independent molecular techniques enabled microbiologists to study nitrifying microbes directly in their habitats and under natural instead of artificial laboratory conditions. These new methods have revealed novel aspects of nitrification biology, such as the strong tendency of many nitrifiers to grow in biofilms in the environment. Whether this growth behavior is also observed with pure cultures in the laboratory depends strongly on the cultivation conditions (Koops and Pommerening-Ro¨ser, 2001). Phylogenetically diverse ammonia and nitrite oxidizers have been detected in biofilms from wastewater treatment plants (Gieseke et al., 2003; Okabe et al., 1999; Schramm et al., 1996, 1998), aquaria (Hovanec et al., 1998), a drinking water distribution system (Martiny et al., 2005), thermal springs (Lebedeva et al., 2005; Weidler et al., 2008), intertidal or freshwater rocks (Magalhaes et al., 2007; Teissier and Torre, 2002), and the surface of rice roots (Briones et al., 2002). Clearly, many factors distinguish growth in biofilms from the planktonic mode of life. The elaborate architectures of biofilms, including dense regions with tight microbial aggregates, the extracellular matrix, and voids and channels (Lawrence et al., 1991), govern the fluxes of dissolved nutrients, gases, and metabolic waste products. These architectural features, and the metabolic activities of the microorganisms, create chemical gradients within biofilms that do not exist in mixed cell suspensions. Moreover, each sessile microbial cell can strongly be influenced by its local neighborhood via biotic interactions such as mutualistic symbioses or competition for resources. These biological phenomena may also occur in planktonic microbial communities, but in biofilms their effects combine with the aforementioned chemical gradients, creating a complex pattern of local conditions and microniches. It is more than justified to assume that such
Quantification of Spatial Localization Patterns
187
complexity is especially pronounced in multispecies biofilms, whose inhabitants represent a plethora of different physiologies and survival strategies. As outlined above, such biofilms are habitats of nitrifiers in natural and manmade systems. Thus, studying nitrifiers in complex biofilms is essential for understanding their ecology. Further, given the difficulties to cultivate many nitrifiers, in situ studies of nitrifying biofilms can be important steps toward a partial characterization of these microbes. Due to their structural and chemical complexity, the analysis of biofilms is technically challenging. Generally, the entire toolbox of cultivationindependent methods for studying environmental microorganisms can be applied on biofilm samples. One of the most prominent techniques in biofilm research is fluorescence in situ hybridization (FISH) with rRNAtargeted probes (Amann et al., 1995; DeLong et al., 1989). FISH allows the detection and simultaneous identification of microorganisms directly in environmental samples such as biofilms and flocs. When combined with confocal laser scanning microscopy (CLSM), FISH even enables the threedimensional visualization of the probe–target organisms in biofilms (Wagner et al., 1994). If the basic FISH protocol (Amann, 1995) fails to detect the target cells, specific problems can often be overcome by modifications of the method (reviewed by Wagner et al., 2003). Intriguingly, recently published variations of FISH allow the in situ detection of functional genes, extending the scope of this method toward the identification of novel members of functional groups (Hoshino and Schramm, 2010; Moraru et al., 2010). Obviously, these “Gene-FISH” methods will open new perspectives for studying structural and functional aspects of biofilms and other complex samples. Moreover, FISH can be combined with methods for monitoring in situ microbial activities and substrate uptake spectra. For example, the ammonia- and nitrite-oxidizing activities of nitrifiers in biofilms were measured by using microsensors, and were then related to the spatial positions of the ammonia and nitrite oxidizers as detected by FISH in the same biofilm samples (Gieseke et al., 2003; Okabe et al., 1999; Schramm et al., 1998). This powerful approach relates the spatial arrangement of organisms to substrate gradients in biofilms and has provided novel insight into the ecology of nitrification. For example, FISH/microsensor data led to the concept that ammonia oxidizers of the genus Nitrosospira and nitrite oxidizers of the genus Nitrospira are adapted to much lower substrate and oxygen concentrations than the ammonia and nitrite oxidizers in the genera Nitrosomonas and Nitrobacter (Schramm et al., 1999). By combining FISH and microautoradiography (FISH-MAR; Lee et al., 1999) using 14C-labeled substrates, autotrophic CO2 fixation by uncultured Nitrospira in activated sludge flocs was shown and mixotrophy of the same organisms using pyruvate was discovered (Daims et al., 2001). Other isotope techniques combinable with FISH, or with other in situ hybridization methods, are Raman microspectroscopy (Raman-FISH; Huang et al., 2007) and
188
Holger Daims and Michael Wagner
nano-secondary ion mass spectrometry (NanoSIMS; Lechene et al., 2007; see also Chapter 12 by Dekas and Orphan in volume 486). These tools are used to analyze the chemical (Raman-FISH) or elemental and isotopic (NanoSIMS) composition of single microbial cells or cell aggregates. In addition, both methods can detect the uptake and incorporation of stable isotope-labeled substrates by the target organisms, which are identified in parallel by in situ hybridization with specific probes (reviewed by Wagner, 2009). These single-cell in situ techniques have been developed only recently, and they will most likely play important roles in future studies on the physiology of biofilm organisms. Another in situ labeling approach, which has frequently been used in biofilm research, employs green fluorescence protein (GFP) as a molecular marker (e.g., Christensen et al., 1998). Despite this impressive set of tools, analyses of the spatial distribution of biofilm populations remain difficult and often suffer from great uncertainties. The reason lies in the way how fluorescence-stained biofilm samples are usually observed by epifluorescence microscopy or by CLSM. In general, a rather limited number of microscopic fields of view are inspected for the labeled organisms. The spatial localization of these cells relative to the boundaries of the biofilm and to other organisms is noticed, and exemplary images of the fluorescence signals are recorded to document these spatial structures. However, do such observations, made in some fields of view, truly reflect the arrangement patterns of the studied organisms in the entire biofilm? And if one researcher considers two different populations to be located close to each other, would a colleague agree with this conclusion? Or might an observer simply overlook subtle patterns of spatial arrangement in complex biofilms? This lack of confidence is unfortunate because spatial localization patterns can point at important biological traits of biofilm organisms. Examples are mutualistic symbioses if microbes tend to coaggregate, competition if they tend to avoid each other, or yet unknown physiological traits if they aggregate at certain positions in substrate gradients. Hence, anecdotic observations of spatial structures can lead to biased conclusions if they are not representative for the whole sample, whereas interesting aspects of an organism’s biology may be overlooked due to unnoticed structural features. These problems can only be solved by objective and quantitative approaches to analyze spatial structures, which should minimize observer-specific biases. An impressive body of literature and several computer programs deal with quantitative analyses of morphological biofilm features such as thickness, surface area coverage, total biovolume, roughness, diffusion distances, and fractal dimension (e.g., Beyenal et al., 2004; Heydorn et al., 2000; Kuehn et al., 1998; Merod et al., 2007; Mueller et al., 2006). These approaches measure gross parameters of the biomass, but usually do not operate at the level of selected populations. In contrast, the population-specific quantification of spatial localization patterns is a dramatically neglected aspect of microbial ecology and biofilm research. This
Quantification of Spatial Localization Patterns
189
shortcoming is quite surprising in view of the potential that such methods would have to deliver novel insights into the life of sessile microorganisms. Indeed, only a few studies have addressed this problem so far. For example, Minz et al. (1999) sliced a microbial mat at regular intervals and quantified the abundances of sulfate-reducing bacteria in the slices by slot-blot hybridization of extracted rRNA. For determining the vertical distribution of cyanobacteria in a hot spring microbial mat, Ramsing et al. (2000) prepared horizontal cryosections through the mat and analyzed them by denaturing gradient gel electrophoresis (DGGE). In addition, the spatial orientation of the cyanobacterial cells in the mat was quantified by digital analysis of epifluorescence images. Fike et al. (2008) applied FISH to detect sulfatereducing bacteria in the layers of a microbial mat. In addition, silver discs were incubated in the mat to capture sulfide, which was then detected by NanoSIMS and correlated with the spatial distribution of the sulfate reducers. In a study on nitrifying biofilms (Schramm et al., 1999), the cell numbers of probe-labeled Nitrosospira and Nitrospira in different biofilm layers were inferred by FISH, confocal microscopy, and digital image analysis. These cell numbers, and microsensor measurements, were used to estimate the in situ conversion rates for ammonia, nitrite, and oxygen. Gantner et al. (2006) applied confocal microscopy, the image analysis software CMEIAS (Liu et al., 2001), and geostatistical modeling to quantify the spatial proximity of Pseudomonas cells on plant root surfaces. Rodenacker et al. (2000) presented a first image analysis approach for quantifying the coaggregation of different populations in CLSM images. Their study used AOB and NOB in activated sludge flocs as an example for populations that should coaggregate, that is, occur in close proximity to each other. The coaggregation of nitrifiers has been observed by FISH and microscopy (e.g., Juretschko et al., 1998) and likely reflects a mutualistic symbiosis, where AOB produce the nitrite that is consumed and detoxified by NOB (Stein and Arp, 1998). Indeed, the quantitative analysis (Rodenacker et al., 2000) strongly supported the spatial coaggregation of nitrifiers in the analyzed flocs. Subsequently, the authors of this chapter developed a more general image analysis approach for quantifying the spatial distribution patterns of microbes (Daims et al., 2006). This “Linear Dipole Algorithm,” which is based on a stereological method (Reed and Howard, 1999), is described in detail below (Section 2.1). In a follow-up study, our approach was used to analyze a nitrifying biofilm that contained AOB and two coexisting populations of NOB (Maixner et al., 2006). Section 4 describes this study as an application example for the methods explained in this chapter. Recently, Augspurger et al. (2010) used the Linear Dipole Algorithm for quantifying the colonization patterns of bacterial cells in benthic biofilms. This study showed that colonization was affected by the local biofilm architecture, hydrodynamics, and possibly by biological properties of the colonizing cells.
190
Holger Daims and Michael Wagner
The following sections of this chapter describe our digital image analysis methods for quantifying the spatial arrangement patterns of microorganisms in biofilms and flocs. These approaches can be applied to analyze any microbial population, but we use AOB and NOB as examples to illustrate their use. After a theoretical outline of the methods, protocols are provided for the required wet-lab and image analysis work. Finally, an application example demonstrates the potential of spatial arrangement analyses for nitrification and biofilm research.
2. Theory of Spatial Arrangement Quantification by Digital Image Analysis All methods described here work best with high-quality CLSM images of fluorescence-labeled microorganisms. Therefore, we do not address problems that typically occur when imaging techniques are combined with conventional (wide-field) epifluorescence microscopy. Examples are blurred image regions and distorted objects due to out-of-focus fluorescence. The general microscopy literature provides (partial) solutions for these problems, such as image deconvolution by image processing software (e.g., Fung and Theriot, 1998; Model et al., 2010). As proper use of these approaches may be time consuming and often requires additional calibration steps, we recommend using a CLSM for biofilm analyses whenever possible. Please note that the algorithms explained below are highly sensitive to noise, blur, and other artifacts in fluorescence images.
2.1. The Linear Dipole Algorithm At first glance, a quantitative evaluation of microbial localization patterns seems to be relatively simple. For example, a naı¨ve approach would virtually reduce each microbial cell or cell aggregate in an image to only one point, which lies in the center of the respective object. Then the distances could be measured between all these central points of all biomass objects. The measured values could be further evaluated; for example, one could easily determine the minimal, maximal, and average distances between different probe-labeled populations. This method might indeed work if all analyzed microbes occur as single cells or very small aggregates with a defined geometric center. However, the reality of biofilms is different: Many organisms, in particular nitrifiers, form large cell clusters containing several hundreds or thousands of cells. The complex shapes of such cell aggregates often lack a clearly defined geometric center, which would equally represent all parts of the cluster. Many biofilms and flocs also contain filamentous bacteria, which stretch over relatively long distances and cannot be reduced
191
Quantification of Spatial Localization Patterns
to a single central point for distance measurements. But even if the analyzed populations formed perfectly spherical aggregates with clearly defined central points, the measured distances between the geometric centers would differ from the shorter distances between the surfaces of the clusters. Theoretically, these problems could be solved by a “brute force” approach that measures the distances from every pixel, which belongs to one population, to every pixel that belongs to another population in the analyzed images. Given the high pixel resolution of modern microscopy imaging systems, this very computation-intensive method would hardly be practicable with current personal computer (PC) hardware. A robust solution requires a more general approach that does not rely on a particular morphology, yields acceptable results for single cells, aggregates, and filaments, and works with commodity PCs. These conditions are met by the Linear Dipole Algorithm. This stereological approach was introduced by Reed and Howard (1999), who demonstrated its use for the spatial analysis of animal lung tissues. Later, we adapted the method to CLSM images of fluorescence-labeled microorganisms and used it for quantifying the coaggregation of AOB and NOB in activated sludge (Daims et al., 2006). The analysis starts with an image that contains two microbial populations, 1 and 2, which have been labeled by specific fluorescence markers (e.g., by FISH). A number of lines are virtually “thrown” onto the image like spillikins (Fig. 8.1A). These lines all have the same length, r, and are randomly oriented in two-dimensional (2-D) space. Now the positions of the two ends of each line are evaluated. If either end of the same line touches a different population, this line is counted as a “hit.” A line is counted as a “miss” if (a) only one end touches a population and the other end touches the image background, (b) both ends touch the same population, or (c) both ends touch the image background. As both ends of each line are inspected, the lines are called “linear dipole probes” in this approach. When all ends of all lines have been evaluated, the numbers of hits and misses are known. From these numbers, we calculate the probability P that a linear dipole probe of length r hits the two populations with its two ends: P ðr Þ ¼
Hr Tr
ð8:1Þ
where Hr is the number of hits and Tr is the sum of hits and misses. Obviously, P(r) already indicates whether the two populations coaggregate at distance r, but it depends on the densities of these populations in the image: The probability for a hit increases with their abundances. As the population densities may vary among images, this dependence should be eliminated. Therefore, let the two populations be randomly distributed in
192
Holger Daims and Michael Wagner
B
A
Pair cross-correlation function, g(r)
50 40 30
Coaggregation g(r) > 1
20 10
Random distribution g(r) » 1
0 0
20
40
60 80 100 Distance, r (mm)
120
140
C x
y
Figure 8.1 Principle of the Linear Dipole Algorithm. (A) Artificial image of two microbial populations. Linear dipole probes of the same length, which are randomly oriented, have been placed at random locations in the image (refer to the main text for a detailed explanation). In practice, the algorithm would evaluate a much larger number of linear dipole probes than shown here for illustrative purposes. (B) Plot of the pair cross-correlation function, g(r), against the corresponding distances, r. This example shows an analysis of nitrifying bacteria (AOB, Nitrosomonas sp. and NOB, Nitrospira sp.) in activated sludge. A strong coaggregation signal with g(r) > 1 was obtained for distances below 50 mm, whereas the nitrifiers were randomly distributed at longer distances [g(r) 1]. The solid curve depicts the mean g(r) determined from 48 images, which were recorded at random positions in the sludge sample. The stippled curves show 95% confidence limits. The horizontal stippled line indicates the threshold of g(r) ¼ 1 that separates coaggregation from mutual avoidance [g(r) < 1]. Modified from Daims et al. (2006). (C) The scanning-based implementation of the Linear Dipole Algorithm. The analyzed image is scanned, pixel by pixel, along the x and y axes. The stippled frame depicts the image borders. Linear dipole probes are virtually extended from each scanned pixel as a semicircle (right sketch). Dipole probes that hit the two populations with their ends are counted as hits (solid lines). Probes that do not hit the two populations are misses (stippled lines). Probes that extend the image borders are not counted (dotted lines). Modified from Daims et al. (2006).
193
Quantification of Spatial Localization Patterns
the image. In this case, P is constant for all distances and can directly be determined from the population densities: P ðrandomÞ ¼ 2D1 D2
ð8:2Þ
where D1 is the density of population 1 and D2 the density of population 2. The density of each population is defined as Dn ¼
An Ai
ð8:3Þ
with Dn as one of the densities (n ¼ 1 or n ¼ 2), An as the pixel area of the respective population in the image, and Ai as the pixel area of the whole image. These densities can easily be measured. Now we can normalize P(r), which was calculated in Eq. (8.1) from the numbers of hits and misses, with the probability for a hit if the two populations were randomly distributed. This step eliminates the dependence on the population densities: gðr Þ ¼
P ðr Þ P ðr Þ ¼ P ðrandomÞ 2D1 D2
ð8:4Þ
where g(r) is an estimate of the pair cross-correlation function at distance r for the two populations. Because of the normalization applied in Eq. (8.4), g(r) ¼ 1 if the two populations are randomly distributed at distance r. If g(r) > 1, then P(r) > P(random) and the two populations coaggregate at distance r. Consequently, if g(r) < 1, the two populations show mutual avoidance at distance r. To visualize the meaning of g(r), imagine a circle of radius r that is drawn around an arbitrary pixel of one population in the image. Then, g(r) is a measure of the likelihood to encounter a pixel of the other population on the edge of the circle (at distance r). The function g(r) can also be estimated for cells or cell clusters that belong to one and the same population; in this case, it is called the pair correlation function. For this purpose, Eq. (8.2) must be replaced by Eq. (8.5): P ðrandomÞ ¼ D2
ð8:5Þ
with D being the density of the analyzed population in the image. By using linear dipole probes of different lengths r, g(r) is determined for a range of distances. The values obtained for g(r) are then plotted against the distances r. The resulting graph (Fig. 8.1B) informs on the spatial localization pattern of the two populations at the analyzed distances. The analysis should be carried out for many images in order to allow statistical verification of the results (Fig. 8.1B). Further, a very large number of linear dipole
194
Holger Daims and Michael Wagner
probes should be evaluated for each image and distance. The latter condition is easily met, because 100,000 or more randomly oriented linear dipole probes can be evaluated within a few seconds on current PCs. However, for most precise results the entire images are scanned pixel by pixel. During the scan, a semicircle of linear dipole probes extending from each pixel is evaluated (Fig. 8.1C). This scanning-approach examines every pixel, taking into account all information stored in each image, but requires more computation time than the evaluation of randomly thrown linear dipole probes (Fig. 8.1A). The Linear Dipole Algorithm does not make assumptions about the morphology of the analyzed populations, and thus it is not compromised by any of the issues mentioned at the beginning of this section. The obtained graphs do not only indicate whether coaggregation occurs, but they also show the distances that separate regularly arranged cells or cell clusters (Fig. 8.2). The careful reader may have noticed that this algorithm uses 2-D images, although spatial localization patterns in biofilms are a 3-D feature. This apparent contradiction resolves if one additional condition is met: All analyzed images must be recorded at random positions in the x, y, and z dimensions in the sample. In this case, the results obtained with (many) 2-D images reflect a 3-D localization pattern with sufficient accuracy (Reed and Howard, 1999). Thus, the method works best with a confocal microscope because only sharp high-quality images should be analyzed, but it does not require the acquisition of confocal image stacks (z-stacks). We consider this an advantage, because recording z-stacks is a time-consuming task, and the image quality may suffer from photobleaching of the fluorochromes during prolonged exposition of a sample to the laser. One drawback of the Linear Dipole Algorithm is that not more than two populations can be analyzed simultaneously. Thus, several pairwise analyses are needed to infer the spatial arrangement patterns of three or more populations. Another caveat is the relatively high sensitivity of the algorithm to noise in the images, which could cause false-positive hits. Importantly, the biomass of different populations must not overlap in the analyzed images. Overlapping pixels can occur if biomass objects appear too large in the images due to nonoptimal detector settings during image acquisition. Such overlap causes many false hits for short linear dipole probes, leading to a strongly exaggerated coaggregation signal at short distances r. However, the most critical problem arises if the entire biomass covers only small regions of an image. In this case, the analyzed populations will always appear to coaggregate, because the algorithm analyzes the whole image and not only those regions that contain the biomass. Imagine that the linear dipole probes are thrown onto the entire image, including the empty parts. The resulting bias is illustrated in Fig. 8.3A: Although the objects are randomly distributed within the biomass-containing region of the image, the plot
195
Quantification of Spatial Localization Patterns
A
16 d
d
Pair correlation function, g(r)
14 12 10 8 2d
6 4
3d
2 0 0
2
4
6
8
10
12
Distance, r (mm)
B Pair correlation function, g(r)
6 5 4 3 2 1 0 0
2
4
6
8
10
12
Distance, r (mm)
Figure 8.2 Selected spatial arrangement patterns and g(r) plots. (A) The left image shows a simple localization pattern of four artificial objects, which are separated by the same distance d. The three peaks in the right plot represent coaggregation at the most frequent distance between the objects, d (highest peak), the second frequent distance, 2d, and the least frequent distance, 3d (smallest peak). Between the peaks g(r) ¼ 0, indicating absence of object pixels (biomass) at these distances. (B) Three clusters, which consist of six objects each, are separated by approximately the same distance from each other. The higher peak in the plot represents coaggregation at the most frequent distance in the image, which is the short distance between objects in the same cluster. The smaller peak represents coaggregation at the longer distance between the clusters. As the Linear Dipole Algorithm takes all pixels of each object into account, especially the right peak is broad: There is no discrete distance that would separate the clusters, but a range of distances between pixels belonging to different clusters.
indicates coaggregation over a wide range of distances. Indeed, the objects are clustered when the whole image is considered (Fig. 8.3A). Fortunately, this problem is solved by a modification of the algorithm that uses an
196
Holger Daims and Michael Wagner
4 Pair correlation function, g(r)
A
3
2
1
0 0
2
4
6 8 Distance, r (mm)
10
12
B
Pair correlation function, g(r)
4
3
2
1
0 0
2
4
6 8 Distance, r (mm)
10
12
Figure 8.3 Use of a mask image with the Linear Dipole Algorithm. (A) The left image shows randomly distributed small objects, which are restricted to a particular region of the image. The corresponding g(r) plot suggests coaggregation of the objects, although they are randomly distributed within this region. However, if the whole image is considered, the objects are indeed clustered. Ten artificial images were analyzed, which contained randomly distributed objects in the same region. See the legend of Fig. 8.1B for a description of the g(r) plot. (B) The lower left image is a mask defining the region that contains the objects in the upper left image. When the randomly distributed objects are analyzed in combination with this mask image, the g(r) plot correctly reflects the random distribution of the objects within their region of the image [g(r) 1]. The confidence intervals for larger distances are broader, because long linear dipole probes often extend beyond the borders of the mask and are ignored by the algorithm. Thus, only few of the long dipole probes can be evaluated. This effect increases the statistical uncertainty.
Quantification of Spatial Localization Patterns
197
additional “mask image,” which indicates the location of the biomass. Linear dipole probes are evaluated only if both ends fall into those regions, which are flagged as “biomass” in the mask image, whereas all other dipole probes are ignored (Fig. 8.3B). In practice, the mask images can be obtained by labeling the entire biomass with a general nucleic acid stain and by recording this signal in addition to the fluorescence conferred by population-specific probes. Alternatively, one could capture images showing the autofluorescence of the biomass and the biofilm matrix. Even if this obstacle can be overcome one limitation remains, which indeed restricts the use of the Linear Dipole Algorithm. The underlying stereological approach requires that the analyzed structures are not strongly anisotropic (i.e., that they do not change unequally in one of the three spatial dimensions). This condition is often met by floccular structures or nonstratified biofilms, and small deviations from isotropy are tolerated. However, strongly anisotropic samples such as strongly stratified biofilms may not be suitable for this approach, unless the analysis can be restricted to a single biofilm layer whose microstructure is less anisotropic. The following section describes an alternative approach, which overcomes this limitation and complements the Linear Dipole Algorithm.
2.2. The “Inflate Algorithm” The Linear Dipole Algorithm should not be used with strongly anisotropic samples, such as stratified biofilms. Stratification of biomass may reflect concentration gradients of substrates or gases and has commonly been observed in nitrifying biofilms (e.g., Lydmark et al., 2006; Okabe et al., 1999). Therefore, we developed an alternative approach that can analyze spatial arrangement patterns in such structures. Like the Linear Dipole Algorithm, this approach uses 2-D (confocal) images and does not make assumptions about the morphology of the organisms. Consider an image that contains two different microbial populations (1 and 2) that are labeled and clearly identified by FISH probes or other specific markers. From now on, we distinguish the “analyzed” from the “reference” population. For example, let population 1 be the analyzed population. The goal is to determine whether it coaggregates with population 2, which is the reference population. First, the total number of image pixels that belong to the analyzed population is counted. Then all biomass objects (cells, clusters, etc.) of the reference population are virtually enlarged, by a defined micrometer range, in each spatial direction (Fig. 8.4A). Depending on the localization of the two populations in the image, the enlarged biomass may now overlap with biomass of the analyzed population (population 1; Fig. 8.4A). The number of overlapping pixels is counted and stored in computer memory. In the next iteration, the reference population is further enlarged, by the same range as before, and all
198
Holger Daims and Michael Wagner
Inflated population 2 (one or two iterations)
B
Population 2 (reference) Population 1 (analyzed)
100
Cumulative fraction (%)
A
Overlapping pixels (after one or two iterations)
80 60 40 Nitrospira (analyzed), AOB (reference) Random distribution (control curve) 95 % confidence limits
20 0 0
10
20
30
40
50
Distance (mm)
D
6
Positional fraction (normalized)
Cumulative fraction (normalized)
C
Nitrospira (analyzed), AOB (reference) 95 % confidence limits
5 4 3 2 1 0
6 Nitrospira (analyzed), AOB (reference) 95 % confidence limits
5 4 3 2 1 0
0
10
20
30
Distance (mm)
40
50
0
10
20
30
40
50
Distance (mm)
Figure 8.4 Principle of the Inflate Algorithm. (A) Schematic illustration of two biomass objects that belong to different microbial populations. When the biomass of population 2 (reference) is iteratively enlarged, this object grows and overlaps with the population 1 (analyzed) biomass. The overlapping pixels are counted in each iteration of the algorithm. (B) Cumulative fractions of overlapping pixels plotted against the corresponding distances. This example shows an analysis of nitrifying bacteria (AOB, Nitrosomonas sp. and NOB, Nitrospira sp.) in activated sludge (see also Fig. 8.1B). Nitrospira were the analyzed and AOB the reference population. The curve obtained with the real populations is above the curve obtained with an artificial random analyzed population, indicating coaggregation of the nitrifiers. The solid curves show the mean fractions determined from 48 images. (C) and (D) Same analysis as in (B), but here the normalized fractions were plotted against the distances. Panel (C) shows normalized cumulative fractions and panel (D) normalized positional fractions. The horizontal stippled lines represent the null hypothesis of a random analyzed population. Both plots indicate strong coaggregation of the nitrifiers at short distances (< 10 mm), where the curves are high above the horizontal lines. The positional fraction plot (D) also shows that the nitrifiers avoid growing at far distances from each other.
pixels that overlap now with the analyzed population are counted again (Fig. 8.4A). Note that this number includes those pixels which overlapped in the previous iteration. This procedure is repeated until a stop condition is fulfilled, which may be a maximal size of the virtually enlarged biomass. All obtained numbers of overlapping pixels are finally converted to fractions of
Quantification of Spatial Localization Patterns
199
the known total pixel number of the analyzed population. Thus, for each iteration, the algorithm stores the number of micrometers, by which the reference population was enlarged, and the overlapping fraction of the analyzed population. Note that the micrometer ranges equal the distances to the surface of the original (not enlarged) biomass of the reference population (Fig. 8.4A). Now the further evaluation is straightforward. The closer the analyzed population coaggregates with the reference population, the higher is the fraction of overlapping biomass soon after the algorithm has started (i.e., when the reference population has been enlarged by a few micrometers only). This can be visualized by plotting the overlapping pixel fractions against the micrometers (Fig. 8.4B). Note that this curve becomes saturated at larger micrometer distances because the overlapping fractions are cumulative: The more the reference population is enlarged, the more pixels overlap with the analyzed population. Sooner or later, the enlarged biomass of the reference population overlaps with the entire biomass of the analyzed population, even if these populations do not actually coaggregate. Therefore, an additional criterion is needed to decide whether the two populations coaggregate, are randomly distributed, or avoid each other. To get this criterion, we declare the null hypothesis that the analyzed population would be randomly distributed in space. To test this hypothesis, the algorithm creates a second artificial image, which contains only the (not yet enlarged) biomass of the reference population. In addition, it places pixels in this image at random locations. These pixels represent a virtual and randomly distributed analyzed population. The number of these random pixels equals the number of biomass pixels of the real analyzed population, which was determined at the beginning (see above). Thus, the random pixels replace the real analyzed population and represent the same density of biomass. Here we refer to these pixels as the “random analyzed” population. Now the entire procedure is repeated with this artificial image (i.e., with the reference and the random analyzed population). The resulting curve is plotted in the same graph as the curve for the two real populations (Fig. 8.4B). A comparison of the two curves reveals whether the enlarged reference population overlapped earlier and more pronouncedly, with the real analyzed population than with the random analyzed population (Fig. 8.4B). In this case, the null hypothesis is rejected and the real analyzed population coaggregates with the reference population in the sample. A simpler graph is obtained by normalizing the cumulative fractions. The fractions obtained with the two real populations are divided by the fractions obtained with the random analyzed population at the same micrometer distances. This leads to a graph where the null hypothesis is represented by a horizontal line at value 1, and the normalized cumulative fractions obtained with the two real populations are plotted against the micrometers (Fig. 8.4C). A curve located above the horizontal line indicates coaggregation of the real analyzed with the reference
200
Holger Daims and Michael Wagner
population (Fig. 8.4C). Additional information on the spatial structure is obtained by determining “positional fractions.” This is the fraction of the analyzed population that overlaps in an iteration of the algorithm minus the sum of all fractions that overlapped in the previous iterations. Thus, the positional fraction reflects the actual increase in overlapping pixels when the reference population is enlarged. In each iteration, this increase depends on the spatial distribution of the analyzed population. For example, if the analyzed closely coaggregates with the reference population, the increase will be largest during the first few iterations (i.e., at positions close to the reference population). Like the cumulative fractions, the positional fractions can be normalized with the values obtained for the random analyzed population. The resulting graph shows, for each distance, whether the increase in overlapping pixels was larger (or smaller) with the real populations than with the random analyzed population (horizontal line at value 1; Fig. 8.4D). Notably, either graph (showing the “cumulative” or the “positional” fractions) can reveal not only coaggregation, but also random distribution or mutual avoidance of the analyzed relative to the reference population. In the case of random distribution, the curve obtained with the real populations is on the horizontal line (value 1) that represents the null hypothesis of a randomly distributed analyzed population. In the case of mutual avoidance, the curve is below that line. Because the method described in this section virtually enlarges one population, we named it the “Inflate Algorithm” (imagine that the objects, which belong to the reference population, are virtually inflated). Importantly, it quantifies only the spatial arrangement of the noninflated (analyzed) population relative to the inflated (reference) population, and not vice versa. Thus, if the results indicate coaggregation of the analyzed with the reference population it is possible that, nevertheless, much biomass of the reference does not coaggregate with the analyzed population. A biological example might be a heterotrophic commensal that closely coaggregates with an autotrophic nitrifier and uses organic carbon secreted by this autotroph. In contrast, much biomass of the autotrophic nitrifier may well grow far away from the heterotroph if the relationship is not mutualistic. The ability of the Inflate Algorithm to detect such differences in localization patterns is one fundamental difference to the Linear Dipole Algorithm, which treats both examined populations equally. Therefore, if more than two populations in the same sample must be investigated, it can make sense to choose always the same reference population and do the quantification with different analyzed populations. The Inflate Algorithm is less sensitive to strongly anisotropic structures than the Linear Dipole Algorithm and can be used with images of stratified biofilms, granules, or similar kinds of samples. For representative results, the algorithm should be applied to several images taken at random positions in the sample. If enough images have been analyzed, the means of the
Quantification of Spatial Localization Patterns
201
overlapping pixel fractions are reported along with confidence intervals (Fig. 8.4B–D). The algorithm is generally sensitive to noise in the images, but especially artifacts labeled by the same (fluorescence) marker as the reference population can cause dramatic biases, because they are inflated just like the biomass itself. If large parts of the images are empty, mask images should be used to define the regions containing biomass. Otherwise, the Inflate Algorithm may report false coaggregation just like the Linear Dipole Algorithm (Fig. 8.3). If a mask image is provided, the pixels of the random analyzed population are placed in the area of that mask only (but not on top of the reference population). When applied to the same images, the Inflate and the Linear Dipole Algorithm may report similar, but not identical, localization patterns. As mentioned in Section 2.1, the Linear Dipole Algorithm measures the likelihood to encounter an arbitrary pixel of one population at distance r from an arbitrary pixel of the other population. This analysis includes all biomass pixels of the two populations, regardless of their location. In contrast, the Inflate Algorithm measures the pixel overlap at defined distances away from the surface of the reference biomass. Internal pixels in cell aggregates formed by the reference population do not affect the results. Understanding this difference can be important for comparing the results of the two approaches.
3. Protocols for the Spatial Arrangement Quantification of Nitrifiers This section provides a basic protocol for analyzing the spatial localization patterns of nitrifying microorganisms in biofilm samples. The protocol uses FISH with rRNA-targeted oligonucleotide probes for the in situ detection of the target populations, confocal microscopy, and our digital image analysis software DAIME (Daims et al., 2006). The DAIME program can be downloaded free of charge at the website (www.microbial-ecology. net/daime). The currently published version (1.3.1) contains an implementation of the Linear Dipole Algorithm. The Inflate Algorithm will be included in the next version (1.4) to be released in the first quarter of the year 2011.
3.1. In situ detection of nitrifiers by FISH An encompassing set of well-evaluated FISH probes is available for the detection and visualization of ammonia and nitrite oxidizers in environmental samples. Table 8.1 lists a selection of probes targeting most known lineages of nitrifiers that usually occur in nitrifying biofilms, together with
Table 8.1 rRNA-targeted oligonucleotide probes commonly used to detect nitrifying microorganisms in biofilm samples
Reference
CGC CAT TGT ATT ACG TGT GA 35
None
Mobarry et al. (1996)
CGA TCC CCT GCT TTT CTC C
55
None
Mobarry et al. (1996)
TAT TAG CAC ATC TTT CGA T
5
None
Mobarry et al. (1996)
0
Probe name
Target
Sequence (5 –3 )
Nso1225
Betaproteobacterial ammonia-oxidizing bacteria Betaproteobacterial ammonia-oxidizing bacteria Genus Nitrosomonas, Nitrosococcus mobilis Genus Nitrosospira Most halophilic and halotolerant Nitrosomonas Nitrosococcus mobilis Nitrosomonas oligotropha lineage (Cluster 6a) Most Archaea
Nso190
Nsm156 Nsv443 NEU
NmV Cluster 6a192 Arch915 Cren512 Cren537 Ntspa712
Most Crenarchaeota Marine group I.1a Crenarchaeota Phylum Nitrospirae
FAa (%)
Competitor oligonucleotideb
0
CCG TGA CCG TTT CGT TCC G 30 CCC CTC TGC TGC ACT CTA 40c
None Mobarry et al. (1996) TTC CAT CCC Wagner et al. (1995) CCT CTG CCG
None Juretschko et al. (1998) CTT TCG ATC C Adamczyk et al. (2003) CC TGC TTC C GTG CTC CCC CGC CAA TTC CT 10–35 None Stahl and Amann (1991) CGG CGG CTG ACA CCA G 5 None Jurgens et al. (2000) TGA CCA CTT GAG GTG CTG 20 None Teira et al. (2004)
TCC TCA GAG ACT ACG CGG 35 CTT TCG ATC CCC TAC TTT CC 35
CGC CTT CGC CAC CGG CCT TCC
50d
CGC CTT CGC CAC CGG TGT TCC
Daims et al. (2001)
Ntspa662
Genus Nitrospira
GGA ATT CCG CGC TCC TCT
35
Ntspa1026
Nitrospira sublineages I and IIe Nitrospira sublineage I Nitrospira sublineage II
AGC ACG CTG GTA TTG CTA
NIT3
TTG GCT TGG GCG ACT TCA TTC TCC TGG GCA GTC TCT CC Nitrospira sublineage II CCC GTT CTC CTG GGC AGT Nitrospira marina-related GCC CCG GAT TCT CGT TCG Nitrospira Genus Nitrobacter CCT GTG CTC CAT GCT CCG
NTG840
Nitrotoga arcticaf
Ntspa1431 Ntspa1151 Nsr1156 Nspmar62
CTA AGG AAG TCT CCT CCC
Daims et al. (2001)
20
GGA ATT CCG CTC TCC TCT None
35 35
None None
Maixner et al. (2006) Maixner et al. (2006)
30 40
None None
Schramm et al. (1998) Foesel et al. (2008)
Juretschko et al. (1998)
CCT GTG CTC Wagner et al. (1996) CAG GCT CCG 10–20 None Alawi et al. (2007)
40
For more details about the probes please refer to the respective publications or to probeBase (Loy et al., 2003). a FA, formamide. b To ensure probe specificity, the unlabeled competitor must be used in equimolar amounts together with the fluorescently labeled probe. c NEU can also be used with 35% formamide. d Ntspa712 can also be used with 35% formamide, especially if combined with Ntspa662. e Ntspa1026 does not cover all members of these Nitrospira sublineages. f NTG840 is not fully specific as some nontarget bacteria have no 16S rRNA sequence mismatches at the probe binding site.
204
Holger Daims and Michael Wagner
the formamide concentrations that are needed in the hybridization buffers to ensure probe specificity. A detailed description of the entire FISH procedure including a list of required equipment, a hands-on protocol, and the recipes of all buffer solutions is provided by Daims et al. (2005). However, for quantitative spatial analyses the normal FISH protocol needs modification. Usually, the environmental samples are first dried on a glass slide and then dehydrated in a series of increasing ethanol concentrations (e.g., Daims et al., 2005). During this procedure, biofilm specimens tend to shrink and their original 3-D architecture is distorted. Therefore, we have developed a modified FISH protocol (3-D FISH) that preserves the 3-D structures by embedding the samples in polyacrylamide (PAA) gel pads (Daims et al., 2006). As PAA shows no or only little autofluorescence, the probe-labeled biomass is clearly visible in PAA gel pads of about 250 mm thickness. However, care is needed to ensure that excess oligonucleotide probes are removed from the gel pads during the washing step of the FISH protocol, as remaining probes would cause very strong background fluorescence. In our protocol, the samples are directly applied to silanized microscope cover slips because the silane covalently binds PAA (Rehman et al., 1999) and thus prevents detachment of the embedded samples during the hybridization and washing steps. We recommend that the embedded samples are observed with a confocal microscope and a long-distance objective. The following paragraphs describe the steps, which are required for PAAembedding of biofilm, and the differences to the normal FISH protocol. 1. Wash paraformaldehyde-fixed biofilm samples in phosphate-buffered saline (1 PBS) and store them at 20 C in a 1:1 mixture of 1 PBS and glycerol instead of the normally used PBS:ethanol mixture. This is important because ethanol can inhibit the polymerization of PAA. 2. Prepare the Bind-Silane working solution [1 ml Bind-Silane (Amersham Biosciences, Uppsala, Sweden), 3 ml 10% (v/v) glacial acetic acid, 296 ml double-distilled H2O]. Mix until the solution becomes clear. 3. Wash microscope cover slips (24 50 mm) in acidic ethanol (1% HCl, 70% ethanol) and dry. Dip the cover slips in the Bind-Silane working solution for 60 min at room temperature, then wash the cover slips once with double-distilled H2O and once with 96% (v/v) ethanol. After drying, the coated cover slips can be stored for several months. 4. Wash standard microscope slides in acidic ethanol and dry. Apply 50 ml of Repel-Silane (Amersham Biosciences, Uppsala, Sweden) to the slide surface and spread evenly using tissue paper. Incubate for 5 min at room temperature, then rinse the slides with 96% (v/v) ethanol and subsequently with double-distilled H2O. After drying, coated slides can be stored for several months. 5. Freshly prepare the PAA solution [20% (w/v) PAA (37.5:1 acrylamide: methylenebisacrylamide), 0.1% (w/v) ammonium persulfate, 1% (v/v)
Quantification of Spatial Localization Patterns
6. 7.
8.
9.
10.
11. 12. 13.
205
tetramethylethylenediamine]. Mix the solution by vortexing and use it immediately. Apply 10 ml of sample (suspended in PBS:glycerol) to a Bind-Silanecoated cover slip, then add 10 ml of PAA solution, and mix with the sample. Put a rectangular Teflon spacer of 0.25 mm thickness around the biomass onto the cover slip. Suitable Teflon spacers are those which have been used, for example, to separate the glass plates covering DNA sequencing gels. Now cover the assembly with a Repel-Silanecoated microscope slide. To obtain a flat gel pad, carefully put a small weight onto the top of the microscope slide. Let the PAA polymerize for 10–15 min at room temperature. Important: Air inhibits the polymerization of PAA. Therefore, be careful not to enclose any air bubbles when applying the microscope slide on top of the sample–PAA mixture. After polymerization, carefully remove the microscope slide. Due to the pretreatment with Bind-Silane, the gel pad will stick to the cover slip. The pretreatment with Repel-Silane ensures that the gel pad does not stick to the microscope slide. Let the gel pad dry for a few minutes at room temperature. Dehydrate the sample by dipping the cover slip in 50%, 80%, and 96% (v/v) ethanol for 5 min each. Dry the gel pad completely after the last dehydration step. The gel pad will become opaque during dehydration in the ethanol series, but it will again become transparent after rehydration in hybridization buffer. Carefully cover the gel pad with 50 ml of standard FISH hybridization buffer that contains the right amount of formamide for the FISH probes to be used (see Table 8.1). Ideally the buffer should stay on the top side of the gel pad. Add 2 ml of each oligonucleotide probe (probe concentrations in the working solutions are 30 ng/ml for Cy3and Cy5-labeled probes and 50 ng/ml for FLUOS-labeled probes). Carefully mix probes and hybridization buffer by pipetting up and down. Put the cover slip into a moist hybridization chamber (see Daims et al., 2005) and incubate at 46 C for 2–3 h. Transfer the cover slip into 50 ml of prewarmed standard FISH washing buffer and wash for 35–40 min in a water bath at 48 C. To remove remaining buffer salts from the gel pad, dip the cover slip for eight times in ice-cold double-distilled H2O and then dry it immediately for 1 min using pressurized air. Subsequently, air-dry the gel pad for additional 10 min at room temperature in the dark. Important: Do not overdry the gel pad or it may crack. Dried cover slips with gel pads can be stored at 4 C for at least 2 days until observation by confocal microscopy.
206
Holger Daims and Michael Wagner
3.2. Microscopy and image acquisition Prior to microscopy, the PAA gel pad (see 3-D FISH, Section 3.1) is covered with antifadent (Citifluor AF1, Citifluor, London, UK). In order to prevent bending of the cover slip during microscopy, the cover slip with the gel pad is laid upside down (i.e., gel pad on the bottom side) onto a microscope slide with a rectangular Teflon spacer of 0.25 mm thickness surrounding the gel pad. This assembly is suitable for observation with an inverse or upright confocal laser scanning microscope. In any case, the embedded sample is observed through the cover slip. For both algorithms described in Section 2, at least 30 images of each probe signal should be acquired at randomly chosen positions. For this purpose, move the object holder of the microscope to a random location and also change the focal plane. However, all recorded images should contain at least one of the populations to be analyzed. Therefore, we recommend to visually confirm that one of the probe signals is present in the randomly chosen field of view. However, one should not intentionally select fields of view that contain all target populations (this would bias the analysis). Prior to recording the images, the detector settings should be adjusted to ensure that each probe signal is within the dynamic range of the instrument. The confocal pinhole should be adjusted for a thickness of 1–2 mm of the optical sections to ensure that each image contains nearly one cell layer and no out-of-focus fluorescence. Subsequently, all images must be taken with the same detector and pinhole settings. The images can be recorded in multicolor mode (i.e., one image contains all probe signals) or as separate images for each probe signal. If mask images showing the entire biomass are needed (see Section 2 and Fig. 8.3), they should be taken separately for each field of view. All images should be stored in the TIFF format (8 bits per pixel, monochrome or 24 bits per pixel, RGB).
3.3. Digital image analysis As mentioned above, the algorithms for spatial arrangement analysis (see Section 2) are implemented in the image analysis program DAIME (Daims et al., 2006). The image analysis workflow consists of three main steps: (1) image import, (2) image segmentation, and (3) the actual quantification. Prior to image import into DAIME, the names of the image files must be adapted to indicate which of the images belong to the same field of view. For example, if separate images were taken for each probe signal, the software must know that these images represent the same spot in the biofilm specimen. This is achieved by appending index numbers to the file names. For instance, images containing AOB could be named AOB_1.tif, AOB_2. tif, and so forth, whereas images containing NOB could then be named NOB_1.tif, NOB_2.tif, and so on. The running index is the number of the
Quantification of Spatial Localization Patterns
207
field of view, so that AOB_1.tif and NOB_1.tif show the respective population at the same location. If all image files are stored in the same directory on disk, DAIME can import all “AOB” and all “NOB” images as two batches or “image series.” These images will be analyzed together in all subsequent steps. Alternatively, one can store multicolor images where one image contains the probe signals of both populations in a field of view. In this case, however, a running index at the end of the file name is also needed by the software to determine which images should be imported as one batch. DAIME understands several different file name indexing schemes that are described in detail in the user manual, which can be downloaded together with the program. To import the images into DAIME, follow the instructions in the user manual and on screen. Multicolor images can be imported in this format and will then be suitable for color-based image segmentation in the following step. Alternatively, they can be split into the individual color channels during image import and will then be suitable for segmentation based on intensity thresholding or edge detection (see below). The next step is the identification of the biomass (cells, microcolonies, etc.) to be analyzed. This process is called “image segmentation,” because it segments an image first into background and biomass and then into relevant objects (microbes) and irrelevant objects (e.g., autofluorescent debris). Image segmentation is a critical step, because it strongly influences the results of all downstream analyses. Therefore, one should carefully check the segmented images for problems such as noise that has been segmented as biomass or dark objects that have been overlooked by the segmentation algorithms. On the other hand, the quality of the source images determines the success of segmentation: Weak fluorescence signals in front of a strong autofluorescent background, or the presence of many artifacts, hamper image segmentation. Consequently, the preceding wet-lab labeling and microscopy procedures must be optimized in order to facilitate image analysis and achieve the best possible results. DAIME offers automatic image segmentation by intensity thresholding or edge detection. Thresholding identifies biomass based on the brightness of the fluorescence signal, whereas edge detection finds the borders of objects (this may work even if the background is relatively bright due to autofluorescence of the biofilm matrix). For thresholding, the program offers a selection of different algorithms which have their own (dis)advantages, so that the user should try which algorithm performs best on a particular set of images. For example, “local thresholding” (Daims and Wagner, 2007) is suitable for segmenting images that contain very bright and also dark fluorescence signals. The procedures for automatic segmentation are described in the DAIME user manual. Importantly, the images must be 2-D segmented for use with the algorithms described in this chapter. The software also offers 3-D segmentation, which is intended for confocal
208
Holger Daims and Michael Wagner
z-stacks only. After automatic segmentation an “object editor” appears on screen, which allows the user to check the results and to reject, for example, any artifacts that are not biomass but were identified as “objects” by the program. A special case is multicolor images that contain all probe-labeled populations. They cannot be segmented fully automatically by DAIME. However, the object editor has tools for semiautomated color-based segmentation that can achieve complete and correct segmentation of such images. Like all other features of the object editor these tools are described in the user manual. Note that all segmentation approaches, fully automatic or color based and semiautomatic, can process all images in the same image series at once. This batch processing minimizes the time needed for segmenting even large sets of more than 100 images. Once the images have been segmented, they are ready for analysis by the Linear Dipole or the Inflate Algorithm. In either case, the user can select two populations (for the Inflate Algorithm the analyzed and reference populations must also be identified). Subsequently, the program asks for the range of distances to be analyzed and whether mask images (Fig. 8.3) should be used. For the Linear Dipole Algorithm the user can also choose between two implementations that either evaluate randomly thrown dipole probes (faster but less precise) or scan all pixels of the images (slower but more precise; see also Section 2.1). When all settings are made, the software checks the input images for common sources of bias such as noise or overlapping pixels of different populations. If such problems are identified the user is warned. When the analyses are finished, the results are reported on screen as tables of values and graphs. At this stage, the results can be saved as text files for later import into third-party plotting software or other programs. Please refer to the DAIME user manual for a detailed description of all steps with screenshots of the program.
4. An Application Example: Spatial Analysis of Three Nitrifying Biofilm Populations NOB of the genus Nitrospira are the key nitrite oxidizers in wastewater treatment plants and are widely distributed in nature, but most Nitrospira are still uncultured. Interestingly, this genus can be subdivided into stable phylogenetic lineages that occur in specific habitats (Daims et al., 2001). For example, lineage 1 seems to be highly adapted to life in wastewater treatment systems, whereas lineage 2 occurs in a wide range of natural ecosystems and also in wastewater treatment plants (Daims et al., 2001). In a previous study (Maixner et al., 2006), we used FISH probes specific for either lineage 1 or 2 to detect these NOB in biofilm from a nitrifying reactor. Surprisingly, we found that these two lineages coexisted in the
Quantification of Spatial Localization Patterns
209
reactor although they should compete for the same substrates nitrite and oxygen. Visual inspection, by epifluorescence microscopy, left the impression that lineage 1 Nitrospira generally lived closer to the cell aggregates of AOB than lineage 2 Nitrospira (Fig. 8.5A). We assumed that such a difference in spatial arrangement, if true, might point at an important biological difference between the two Nitrospira populations. Therefore, we quantified the localization patterns of the two Nitrospira lineages and AOB by using the Linear Dipole Algorithm (see Section 2.1) and the software DAIME (see Section 3.3). For Nitrospira lineage 1, this analysis confirmed the close coaggregation with AOB (Fig.8.5B). The maximal coaggregation signal was obtained for very short distances below 10 mm (Fig.8.5B). The results also supported our previous notion that lineage 2 Nitrospira seemed to avoid the close neighborhood of AOB (Fig. 8.5C). Indeed, the curve indicated mutual avoidance of lineage 2 and AOB at distances up to 10 mm, whereas it suggested coaggregation at 20–50 mm away from AOB (Fig. 8.5C). For longer distances, no significant coaggregation signal was obtained for either Nitrospira lineage and AOB (Fig. 8.5B and C), indicating that biological interactions among these nitrifiers did not have long-range spatial effects. Meanwhile we have analyzed the same image data by using the Inflate Algorithm, which had not been available yet when the study (Maixner et al., 2006) was published. For this purpose, either Nitrospira lineage 1 or 2 was the analyzed and the AOB were the reference population. The cumulative fractions strongly suggested close coaggregation of lineage 1 Nitrospira with AOB at short distances, but indicated mutual avoidance of lineage 2 Nitrospira and AOB at the same spatial scale (Fig. 8.5D). Like the Linear Dipole Algorithm (Fig. 8.5B and C), the Inflate Algorithm showed coaggregation of lineage 2 Nitrospira with AOB at longer distances only (Fig. 8.5D). The positional fractions also showed that significantly more lineage 1 Nitrospira lived at short distances (< 20 mm) from AOB than one would expect for a randomly distributed population (Fig. 8.5E). Beyond 20 mm, however, the positional fractions of lineage 1 were below the level of the null hypothesis (Fig. 8.5E). This result indicates that, compared to a randomly distributed population, lineage 1 Nitrospira were rare at such long distances away from AOB. The positional fractions confirmed that lineage 2 Nitrospira avoided to grow very closely to AOB and coaggregated with AOB at longer distances than lineage 1 (Fig. 8.5E). However, also lineage 2 was rarer than a randomly distributed population far away from the AOB (Fig. 8.5E). In summary, the analysis by the Inflate Algorithm was generally consistent with the Linear Dipole Algorithm (Fig. 8.5B–E). Based on the different approach, however, the Inflate Algorithm provided more insight into the localization pattern at long distances away from AOB (Fig. 8.5E). When the visually observed localization patterns had been confirmed by image analysis using the Linear Dipole Algorithm (Maixner et al., 2006), we hypothesized that the biological difference might be an adaptation of
210
Holger Daims and Michael Wagner
A Nitrospira lineage 2
Ammonia oxidizers
Ammonia oxidizers
Nitrospira lineage 1
C Nitrospira lineage 1 95 % Confidence limits
4 3 2 1 0 0
Cumulative fraction (normalized)
D
Pair cross-correlation function, g(r)
5
20
40 Distance, r (mm)
60
Nitrospira lineage 1 Nitrospira lineage 2 95 % Confidence limits
2
1
0
Nitrospira lineage 2 95 % Confidence limits
4 3 2 1 0 0
E
4
3
5
80
Positional fraction (normalized)
Pair cross-correlation function, g(r)
B
20
40 Distance, r (mm)
60
80
4 Nitrospira lineage 1 Nitrospira lineage 2 95 % Confidence limits
3
2
1
0 0
20
40 Distance (mm)
60
80
0
20
40
60
80
Distance (mm)
Figure 8.5 Spatial analysis of three nitrifying biofilm populations. (A) Representative monochrome FISH images showing the localization of ammonia oxidizers and lineage 1 Nitrospira (left image) or lineage 2 Nitrospira (right image) in the same microscopic field of view. (B) and (C) Analysis of AOB and the two Nitrospira populations by the Linear Dipole Algorithm. For details please refer to the main text (Section 4). (D) and (E) Analysis of AOB and the two Nitrospira populations by the Inflate Algorithm. AOB were the reference and Nitrospira the analyzed populations. Panel (D) shows normalized cumulative fractions and panel (E) normalized positional fractions plotted against the distances. The horizontal stippled lines represent the null hypothesis of a random analyzed population. For details please refer to the main text (Section 4).
Quantification of Spatial Localization Patterns
211
Nitrospira lineage 1 to relatively high nitrite concentrations, whereas lineage 2 might prefer lower nitrite concentrations. In this scenario, the very close coaggregation of lineage 1 and AOB would ensure that these Nitrospira get access to most of the produced nitrite, whose local concentration should be highest directly at the AOB cell clusters. The remaining nitrite would then diffuse into the biofilm and could be consumed by lineage 2 Nitrospira living farther away from the AOB. This hypothesis was first tested by modeling the fluxes of nitrite in the biofilm. The model considered nitrite production, diffusion, and consumption and was based on known physiological parameters of nitrifiers (for details, see Maixner et al., 2006). Interestingly, the assumed small-scale nitrite concentration gradients were strongly supported by this biofilm model, which suggested high nitrite concentrations close to the AOB and much lower nitrite levels at the distances where lineage 2 Nitrospira were mainly found. Finally, we conducted a long-term competition experiment where a sample containing both Nitrospira populations was incubated with higher or lower nitrite concentrations. Indeed, this experiment confirmed that lineage 1 Nitrospira were better adapted to the higher nitrite concentration (Maixner et al., 2006). This biological difference between the two Nitrospira lineages was not previously known and was discovered because of the spatial localization patterns. We think that this example illustrates the high potential of spatial arrangement analyses for the discovery of novel ecophysiological features and interactions of poorly characterized and uncultured microorganisms.
ACKNOWLEDGMENTS We thank Sebastian Lu¨cker for contributing the 3-D FISH protocol and Robert Almstrand for fruitful discussions on the analysis of stratified nitrifying biofilms. The development and evaluation of the image analysis methods, which are described in this chapter, were partly funded by Grant I44-B06 of the Austrian Science Fund (FWF) and Grant LS09-40 of the Vienna Science and Technology Fund (WWTF).
REFERENCES Adamczyk, J., Hesselsoe, M., Iversen, N., Horn, M., Lehner, A., Nielsen, P. H., Schloter, M., Roslev, P., and Wagner, M. (2003). The isotope array, a new tool that employs substrate-mediated labeling of rRNA for determination of microbial community structure and function. Appl. Environ. Microbiol. 69, 6875–6887. Alawi, M., Lipski, A., Sanders, T., Pfeiffer, E.-M., and Spieck, E. (2007). Cultivation of a novel cold-adapted nitrite oxidizing betaproteobacterium from the Siberian Arctic. ISME J. 1, 256–264. Amann, R. I. (1995). In situ identification of micro-organisms by whole cell hybridization with rRNA-targeted nucleic acid probes. In “Molecular Ecology Manual,”
212
Holger Daims and Michael Wagner
(A. D. C. Akkeman, J. D. van Elsas, and F. J. de Bruigin, eds.), Vol. 3.3.6, pp. 1–15. Kluwer Academic Publishers, Dortrecht. Amann, R. I., Ludwig, W., and Schleifer, K.-H. (1995). Phylogenetic identification and in situ detection of individual microbial cells without cultivation. Microbiol. Rev. 59, 143–169. Augspurger, C., Karwautz, C., Mußmann, M., Daims, H., and Battin, T. J. (2010). Drivers of bacterial colonization patterns in stream biofilms. FEMS Microbiol. Ecol. 72, 47–57. Beyenal, H., Donovan, C., Lewandowski, Z., and Harkin, G. (2004). Three-dimensional biofilm structure quantification. J. Microbiol. Methods 59, 395–413. Briones, A. M., Okabe, S., Umemiya, Y., Ramsing, N. B., Reichardt, W., and Okuyama, H. (2002). Influence of different cultivars on populations of ammonia-oxidizing bacteria in the root environment of rice. Appl. Environ. Microbiol. 68, 3067–3075. Christensen, B. B., Sternberg, C., Andersen, J. B., Eberl, L., Moller, S., Givskov, M., and Molin, S. (1998). Establishment of new genetic traits in a microbial biofilm community. Appl. Environ. Microbiol. 64, 2247–2255. Daims, H., and Wagner, M. (2007). Quantification of uncultured microorganisms by fluorescence microscopy and digital image analysis. Appl. Microbiol. Biotechnol. 75, 237–248. Daims, H., Nielsen, J. L., Nielsen, P. H., Schleifer, K. H., and Wagner, M. (2001). In situ characterization of Nitrospira-like nitrite-oxidizing bacteria active in wastewater treatment plants. Appl. Environ. Microbiol. 67, 5273–5284. Daims, H., Stoecker, K., and Wagner, M. (2005). Fluorescence in situ hybridisation for the detection of prokaryotes. In “Molecular Microbial Ecology,” (A. M. Osborn and C. J. Smith, eds.), pp. 213–239. Bios-Garland, Abingdon, UK. Daims, H., Lu¨cker, S., and Wagner, M. (2006). daime, a novel image analysis program for microbial ecology and biofilm research. Environ. Microbiol. 8, 200–213. DeLong, E. F., Wickham, G. S., and Pace, N. R. (1989). Phylogenetic stains: Ribosomal RNA based probes for the identification of single cells. Science 243, 1360–1363. Fike, D. A., Gammon, C. L., Ziebis, W., and Orphan, V. J. (2008). Micron-scale mapping of sulfur cycling across the oxycline of a cyanobacterial mat: A paired nanoSIMS and CARD-FISH approach. ISME J. 2, 749–759. Foesel, B. U., Gieseke, A., Schwermer, C., Stief, P., Koch, L., Cytryn, E., de la Torre, J. R., van Rijn, J., Minz, D., Drake, H. L., and Schramm, A. (2008). Nitrosomonas Nm143-like ammonia oxidizers and Nitrospira marina-like nitrite oxidizers dominate the nitrifier community in a marine aquaculture biofilm. FEMS Microbiol. Ecol. 63, 192–204. Fung, D. C., and Theriot, J. A. (1998). Imaging techniques in microbiology. Curr. Opin. Microbiol. 1, 346–351. Gantner, S., Schmid, M., Du¨rr, C., Schuhegger, R., Steidle, A., Hutzler, P. C. L., Eberl, L., Hartmann, A., and Dazzo, F. B. (2006). In situ quantitation of the spatial scale of calling distances and population density-independentN-acylhomoserine lactone-mediated communication by rhizobacteria colonized on plant roots. FEMS Microbiol. Ecol. 56, 188–194. Gieseke, A., Bjerrum, L., Wagner, M., and Amann, R. (2003). Structure and activity of multiple nitrifying bacterial populations co-existing in a biofilm. Environ. Microbiol. 5, 355–369. Hatzenpichler, R., Lebedeva, E. V., Spieck, E., Stoecker, K., Richter, A., Daims, H., and Wagner, M. (2008). A moderately thermophilic ammonia-oxidizing crenarchaeote from a hot spring. Proc. Natl. Acad. Sci. USA 105, 2134–2139. Heydorn, A., Nielsen, A. T., Hentzer, M., Sternberg, C., Givskov, M., Ersboll, B. K., and Molin, S. (2000). Quantification of biofilm structures by the novel computer program COMSTAT. Microbiology 146, 2395–2407. Hoshino, T., and Schramm, A. (2010). Detection of denitrification genes by in situ rolling circle amplification-fluorescence in situ hybridization to link metabolic potential with identity inside bacterial cells. Environ. Microbiol. 12, 2508–2517.
Quantification of Spatial Localization Patterns
213
Hovanec, T. A., Taylor, L. T., Blakis, A., and DeLong, E. F. (1998). Nitrospira-like bacteria associated with nitrite oxidation in freshwater aquaria. Appl. Environ. Microbiol. 64, 258–264. Huang, W. E., Stoecker, K., Griffiths, R., Newbold, L., Daims, H., Whiteley, A. S., and Wagner, M. (2007). Raman-FISH: Combining stable-isotope Raman spectroscopy and fluorescence in situ hybridization for the single cell analysis of identity and function. Environ. Microbiol. 9, 1878–1889. Juretschko, S., Timmermann, G., Schmid, M., Schleifer, K.-H., Pommerening-Ro¨ser, A., Koops, H.-P., and Wagner, M. (1998). Combined molecular and conventional analyses of nitrifying bacterium diversity in activated sludge: Nitrosococcus mobilis and Nitrospiralike bacteria as dominant populations. Appl. Environ. Microbiol. 64, 3042–3051. Jurgens, G., Glo¨ckner, F., Amann, R., Saano, A., Montonen, L., Likolammi, M., and Mu¨nster, U. (2000). Identification of novel Archaea in bacterioplankton of a boreal forest lake by phylogenetic analysis and fluorescent in situ hybridization. FEMS Microbiol. Ecol. 34, 45–56. Ko¨nneke, M., Bernhard, A. E., de la Torre, J. R., Walker, C. B., Waterbury, J. B., and Stahl, D. A. (2005). Isolation of an autotrophic ammonia-oxidizing marine archaeon. Nature 437, 543–546. Koops, H. P., and Pommerening-Ro¨ser, A. (2001). Distribution and ecophysiology of the nitrifying bacteria emphasizing cultured species. FEMS Microbiol. Ecol. 37, 1–9. Kuehn, M., Hausner, M., Bungartz, H.-J., Wagner, M., Wilderer, P. A., and Wuertz, S. (1998). Automated confocal laser scanning microscopy and semiautomated image processing for analysis of biofilms. Appl. Environ. Microbiol. 64, 4115–4127. Lawrence, J. R., Korber, D. R., Hoyle, B. D., Costerton, J. W., and Caldwell, D. E. (1991). Optical sectioning of microbial biofilms. J. Bacteriol. 173, 6558–6567. Lebedeva, E. V., Alawi, M., Fiencke, C., Namsaraev, B., Bock, E., and Spieck, E. (2005). Moderately thermophilic nitrifying bacteria from a hot spring of the Baikal rift zone. FEMS Microbiol. Ecol. 54, 297–306. Lechene, C. P., Luyten, Y., McMahon, G., and Distel, D. L. (2007). Quantitative imaging of nitrogen fixation by individual bacteria within animal cells. Science 317, 1563–1566. Lee, N., Nielsen, P. H., Andreasen, K. H., Juretschko, S., Nielsen, J. L., Schleifer, K.-H., and Wagner, M. (1999). Combination of fluorescent in situ hybridization and microautoradiography—A new tool for structure-function analyses in microbial ecology. Appl. Environ. Microbiol. 65, 1289–1297. Liu, J., Dazzo, F. B., Glagoleva, O., Yu, B., and Jain, A. K. (2001). CMEIAS: A computeraided system for the image analysis of bacterial morphotypes in microbial communities. Microb. Ecol. 41, 173–194. Loy, A., Horn, M., and Wagner, M. (2003). probeBase: An online resource for rRNAtargeted oligonucleotide probes. Nucleic Acids Res. 31, 514–516. Lu¨cker, S., Wagner, M., Maixner, F., Pelletier, E., Koch, H., Vacherie, B., Rattei, T., Damste´, J. S., Spieck, E., Le Paslier, D., and Daims, H. (2010). A Nitrospira metagenome illuminates the physiology and evolution of globally important nitrite-oxidizing bacteria. Proc. Natl. Acad. Sci. USA 107, 13479–13484. Lydmark, P., Lind, M., Sorensson, F., and Hermansson, M. (2006). Vertical distribution of nitrifying populations in bacterial biofilms from a full-scale nitrifying trickling filter. Environ. Microbiol. 8, 2036–2049. Magalhaes, C., Bano, N., Wiebe, W. J., Hollibaugh, J. T., and Bordalo, A. A. (2007). Composition and activity of beta-Proteobacteria ammonia-oxidizing communities associated with intertidal rocky biofilms and sediments of the Douro River estuary. Portugal. J. Appl. Microbiol. 103, 1239–1250. Maixner, F., Noguera, D. R., Anneser, B., Stoecker, K., Wegl, G., Wagner, M., and Daims, H. (2006). Nitrite concentration influences the population structure of Nitrospira-like bacteria. Environ. Microbiol. 8, 1487–1495.
214
Holger Daims and Michael Wagner
Martiny, A. C., Albrechtsen, H. J., Arvin, E., and Molin, S. (2005). Identification of bacteria in biofilm and bulk water samples from a nonchlorinated model drinking water distribution system: Detection of a large nitrite-oxidizing population associated with Nitrospira spp. Appl. Environ. Microbiol. 71, 8611–8617. Merod, R. T., Warren, J. E., McCaslin, H., and Wuertz, S. (2007). Toward automated analysis of biofilm architecture: Bias caused by extraneous confocal laser scanning microscopy images. Appl. Environ. Microbiol. 73, 4922–4930. Minz, D., Fishbain, S., Green, S. J., Muyzer, G., Cohen, Y., Rittmann, B. E., and Stahl, D. A. (1999). Unexpected population distribution in a microbial mat community: Sulfate-reducing bacteria localized to the highly oxic chemocline in contrast to a eukaryotic preference for anoxia. Appl. Environ. Microbiol. 65, 4659–4665. Mobarry, B. K., Wagner, M., Urbain, V., Rittmann, B. E., and Stahl, D. A. (1996). Phylogenetic probes for analyzing abundance and spatial organization of nitrifying bacteria. Appl. Environ. Microbiol. 62, 2156–2162. Model, M. A., Fang, J., Yuvaraj, P., Chen, Y., and Zhang Newby, B. M. (2010). 3D deconvolution of spherically aberrated images using commercial software. J. Microsc. 241, 94–100. Moraru, C., Lam, P., Fuchs, B. M., Kuypers, M. M., and Amann, R. (2010). GeneFISH— An in situ technique for linking gene presence and cell identity in environmental microorganisms. Environ. Microbiol. 12, 3057–3073. Mueller, L. N., de Brouwer, J. F., Almeida, J. S., Stal, L. J., and Xavier, J. B. (2006). Analysis of a marine phototrophic biofilm by confocal laser scanning microscopy using the new image quantification software PHLIP. BMC Ecol. 6, 1. Okabe, S., Satoh, H., and Watanabe, Y. (1999). In situ analysis of nitrifying biofilms as determined by in situ hybridization and the use of microelectrodes. Appl. Environ. Microbiol. 65, 3182–3191. Ramsing, N. B., Ferris, M. J., and Ward, D. M. (2000). Highly ordered vertical structure of Synechococcus populations within the one-millimeter-thick photic zone of a hot spring cyanobacterial mat. Appl. Environ. Microbiol. 66, 1038–1049. Reed, M. G., and Howard, C. V. (1999). Stereological estimation of covariance using linear dipole probes. J. Microsc. 195, 96–103. Rehman, F. N., Audeh, M., Abrams, E. S., Hammond, P. W., Kenney, M., and Boles, T. C. (1999). Immobilization of acrylamide-modified oligonucleotides by co-polymerization. Nucleic Acids Res. 27, 649–655. Rodenacker, K., Bru¨hl, A., Hausner, M., Ku¨hn, M., Liebscher, V., Wagner, M., Winkler, G., and Wuertz, S. (2000). Quantification of biofilms in multi-spectral digital volumes from confocal laser scanning microscopes. Image Anal. Stereol. 19, 151–156. Schramm, A., Larsen, L. H., Revsbech, N. P., Ramsing, N. B., Amann, R., and Schleifer, K.-H. (1996). Structure and function of a nitrifying biofilm as determined by in situ hybridization and the use of microelectrodes. Appl. Environ. Microbiol. 62, 4641–4647. Schramm, A., de Beer, D., Wagner, M., and Amann, R. (1998). Identification and activities in situ of Nitrosospira and Nitrospira spp. as dominant populations in a nitrifying fluidized bed reactor. Appl. Environ. Microbiol. 64, 3480–3485. Schramm, A., de Beer, D., van den Heuvel, J. C., Ottengraf, S., and Amann, R. (1999). Microscale distribution of populations and activities of Nitrosospira and Nitrospira spp. along a macroscale gradient in a nitrifying bioreactor: Quantification by in situ hybridization and the use of microsensors. Appl. Environ. Microbiol. 65, 3690–3696. Stahl, D. A., and Amann, R. (1991). Development and application of nucleic acid probes. In “Nucleic Acid Techniques in Bacterial Systematics,” (E. Stackebrandt and M. Goodfellow, eds.), pp. 205–248. John Wiley & Sons Ltd., Chichester.
Quantification of Spatial Localization Patterns
215
Stein, L. Y., and Arp, D. J. (1998). Loss of ammonia monooxygenase activity in Nitrosomonas europaea upon exposure to nitrite. Appl. Environ. Microbiol. 64, 4098–4102. Teira, E., Reinthaler, T., Pernthaler, A., Pernthaler, J., and Herndl, G. J. (2004). Combining catalyzed reporter deposition-fluorescence in situ hybridization and microautoradiography to detect substrate utilization by bacteria and Archaea in the deep ocean. Appl. Environ. Microbiol. 70, 4411–4414. Teissier, S., and Torre, M. (2002). Simultaneous assessment of nitrification and denitrification on freshwater epilithic biofilms by acetylene block method. Water Res. 36, 3803–3811. Wagner, M. (2009). Single-cell ecophysiology of microbes as revealed by Raman microspectroscopy or secondary ion mass spectrometry imaging. Annu. Rev. Microbiol. 63, 411–429. Wagner, M., Aßmuss, B., Hartmann, A., Hutzler, P., and Amann, R. (1994). In situ analysis of microbial consortia in activated sludge using fluorescently labelled, rRNA-targeted oligonucleotide probes and confocal laser scanning microscopy. J. Microsc. 176, 181–187. Wagner, M., Rath, G., Amann, R., Koops, H.-P., and Schleifer, K.-H. (1995). In situ identification of ammonia-oxidizing bacteria. Syst. Appl. Microbiol. 18, 251–264. Wagner, M., Rath, G., Koops, H.-P., Flood, J., and Amann, R. (1996). In situ analysis of nitrifying bacteria in sewage treatment plants. Water Sci. Tech. 34, 237–244. Wagner, M., Horn, M., and Daims, H. (2003). Fluorescence in situ hybridization for the identification of prokaryotes. Curr. Opin. Microbiol. 6, 302–309. Walker, C. B., de la Torre, J. R., Klotz, M. G., Urakawa, H., Pinel, N., Arp, D. J., BrochierArmanet, C., Chain, P. S., Chan, P. P., Gollabgir, A., Hemp, J., Hugler, M., et al. (2010). Nitrosopumilus maritimus genome reveals unique mechanisms for nitrification and autotrophy in globally distributed marine crenarchaea. Proc. Natl. Acad. Sci. USA 107, 8818–8823. Weidler, G. W., Gerbl, F. W., and Stan-Lotter, H. (2008). Crenarchaeota and their role in the nitrogen cycle in a subsurface radioactive thermal spring in the Austrian Central Alps. Appl. Environ. Microbiol. 74, 5934–5942. Winogradsky, S. (1892). Contributions a la morphologie des organisms de la nitrification. Arch. Sci. Biol. (St. Petersb.) 1, 88–137.
C H A P T E R
N I N E
Investigating Nitrosomonas europaea Stress Biomarkers in Batch, Continuous Culture, and Biofilm Reactors Tyler S. Radniecki and Ellen G. Lauchnor Contents 1. Introduction 2. Identifying Stress Responses in Batch Bioreactors 2.1. Preventing O2 and NH3 limitations 2.2. Experimental protocol and physiological measurements 2.3. Transcriptional assays and sentinel gene expression 3. Identifying Stress Responses in Continuous Growth Systems 3.1. Batch growth assays 3.2. Fill and draw reactors 3.3. Continuous growth reactors 4. Identifying Stress Responses in Biofilms 5. Conclusions References
219 222 222 223 227 233 233 234 237 239 242 244
Abstract The understanding of nitrification inhibition in ammonia oxidizing bacteria (AOB) by priority pollutants and emerging contaminants is critical in managing the nitrogen cycle to preserve current water supplies, one of the National Academy of Engineers Grand Challenges in Engineering for the twenty-first century. Nitrosomonas europaea is an excellent model AOB for nitrification inhibition experimentation due to its well-defined NH3 metabolism and the availability of a wide range of physiological and transcriptional tools that can characterize the mechanism of nitrification inhibition and probe N. europaea’s response to the inhibitor. This chapter is a compilation of the physiological and transcriptional methods that have been used to characterize nitrification inhibition of N. europaea under a wide variety of growth conditions including batch, School of Chemical, Biological and Environmental Engineering, Oregon State University, Corvallis, Oregon, USA Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00009-9
#
2011 Elsevier Inc. All rights reserved.
217
218
Tyler S. Radniecki and Ellen G. Lauchnor
continuously cultured, and in biofilms. The protocols presented here can be applied to other AOB, and may be readily adapted for other autotrophic bacteria (e.g., nitrite oxidizing bacteria).
Abbreviations 2 DDCt AMO AMO-SOUR AOB ATU b BLAST bp cDNA CT D DART-PCR DFR Dmax DNA DNRA dO2 EDTA FDR GC GFP HAO HAO-SOUR HEPES ICP-OES Ka Ks pKa Q qRT-PCR R0 con
delta–delta Ct method ammonia monooxygenase ammonia monooxygenase specific oxygen uptake rate ammonia oxidizing bacteria allylthiourea specific decay coefficient basic local alignment search tool base pairs complementary DNA critical threshold dilution ratio data analysis of real-time polymerase chain reactions drip flow biofilm reactor the theoretical maximum dilution ratio that will not cause washout within a continuous growth reactor deoxyribonucleic acid dissimilarly nitrite reduction to ammonium dissolved oxygen ethylenediaminetetraacetic acid fill and draw reactors guanine and cytosine base pairs green fluorescent protein hydroxylamine oxidoreductase hydroxylamine oxidoreductase specific oxygen uptake rate 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid inductively coupled plasma optical emission spectroscopy acid dissociation constant half-saturation constant log10Ka media volumetric flow rate quantitative real-time polymerase chain reaction the calculated expression value of the gene of interest in the control cells
N. europaea, Inhibition and Bioreactors
R0 trt R16S con R16S trt RNA S TE Tm v V vmax WWTP yH m mmax
219
the calculated expression value of the gene of interest in the treated cells the calculated expression value of the 16S rRNA gene in the control cells the calculated expression value of the 16S rRNA gene in the treated cells ribonucleic acid substrate concentration tris-EDTA melting temperature specific NH3 oxidation rate cell culture volume maximum specific NH3 oxidation rate wastewater treatment plant hydraulic retention time specific growth rate maximum specific growth rate
1. Introduction Ammonia oxidizing bacteria (AOB) play a critical role in the global nitrogen cycle and the removal of nitrogen from wastewater treatment plants (WWTPs) through their oxidization of ammonia (NH3) to nitrite (NO2) (Fig. 9.1). The oxidation of NH3 is a two-step process in which NH3 is oxidized, via the ammonia monooxygenase (AMO) enzyme, to hydroxylamine (NH2OH), which is further oxidized to NO2, via the hydroxylamine oxidoreductase (HAO) enzyme. The oxidation of NH3 to NO2 yields a net gain of two electrons (Fig. 9.2) and is the sole source of energy for the growth and cell maintenance of AOB (Arp et al., 2002). Due to the low net energy gain from NH3 oxidation, the nonspecificity of the AMO enzyme and their requirement to fix CO2 for biosynthesis, AOB are widely considered to be the most sensitive microorganisms in the natural environment and WWTPs (U.S.EPA, 1993). Their inhibition in WWTP may result in weeks to months of nitrogen removal downtime, due to their slow growth rates, and can lead to fines from regulation agencies and cause the eutrophication of the body of water receiving the WWTP effluent. AOB are vulnerable to disturbance by a wide variety of contaminants including heavy metals (Park and Ely, 2008a), pH shifts (Stein et al., 1997), salts (Moussa et al., 2006), organic solvents (Radniecki et al., 2008), chlorinated hydrocarbons (Gvakharia et al., 2007), copper chelators, such as cyanide (Park and Ely, 2009), and emerging contaminants, including silver nanoparticles (Choi and Hu, 2008).
220
Tyler S. Radniecki and Ellen G. Lauchnor
NO3– Nitrate respiration NO2– Nitrification
Denitrification
N2O
DNRA
Ana mm ox
NO NH2OH
Atmosphere N2
NH3
NH4+ Assimilation
Ammonification
Wastewater influent (organic N)
Figure 9.1 The biological removal of nitrogen from WWTPs.
H2O
O2
H2O
AMO NH3
HAO NO2–
NH2OH 2e– + 2H+
2 e– + 3 H+
Terminal electron acceptor
Figure 9.2 The oxidation of NH3 to NO2 by N. europaea.
Understanding how these contaminants inhibit ammonia oxidation at the physiological and transcriptional levels is critical toward developing a greater understanding of their impact on the global nitrogen cycle, creating
N. europaea, Inhibition and Bioreactors
221
gene expression-based biosensors to detect these inhibitors in complex natural and engineered environments, and in developing better WWTP operational protocols upon the detection of a nitrification inhibitors (e.g., increasing the aeration upon detection of aromatic hydrocarbons or the addition of Ca2þ/Mg2þ upon the detection of heavy metals). Nitrosomonas europaea, a model AOB, has been found to be a key AOB in terrestrial and freshwater habitats, especially those containing high levels of NH4þ, including WWTPs (Kowalchuk and Stephen, 2001; Mobarry et al., 1996), and has been used in pure culture studies to gain a greater understanding of how various chemicals inhibit NH3 oxidation. In general, NH3 oxidation is most commonly disrupted in one of the following ways: (1) energy drain through the cometabolism of non-electron generating substrates (e.g., hydrocarbons), (2) direct interference with the AMO or HAO enzymes, (3) interference with cytochromes in the electron transport chain, (4) disruption of outer membrane stability, or (5) general oxidative stress damage. The method by which a chemical inhibits NH3 oxidation can either be directly measured (e.g., measuring AMO activity or cell membrane integrity), indirectly measured (e.g., detecting cometabolized products), or inferred (e.g., identifying the upregulation of oxidative stress genes). Nitrification inhibition tests have traditionally been conducted in shortterm batch assays lasting minutes to several hours. The advantages of this method are that it is fast, requires relatively small volumes (2–50 mL), and allows a large range of conditions to be tested simultaneously. However, this method does not lend itself well to examining the effects of long-term exposure to nitrification inhibitors, including the ability of AOB to recover growth and activity after the initial inhibition. To examine the effects of long-term exposure (days to weeks) to nitrification inhibitors, batch growth assays, fill and draw reactors, and continuous growth reactors are more suitable test methods. While conducting nitrification inhibition assays on planktonic cells is the most common method used, AOB are generally found in biofilms in natural and engineered systems. Drip flow biofilm reactors used to grow pure culture N. europaea biofilms allow for the determination of how the unique properties and conditions of biofilm cells (e.g., heterogeneity of cell age, the existence of pH, O2, and NH3 gradients across the thickness of the biofilm, etc.) influences nitrification inhibition. This chapter describes the methodology of various batch, continuous growth, and biofilm reactors used to characterize the physiological and transcriptional responses of pure cultures of N. europaea to nitrification inhibitors. The methods in this chapter aim to help researchers overcome some of the most common difficulties encountered in cultivating pure N. europaea cultures in these reactors and they may be directly applicable to cultivating other AOB as well as other aerobic autolithotrophs, including nitrite oxidizing bacteria.
222
Tyler S. Radniecki and Ellen G. Lauchnor
2. Identifying Stress Responses in Batch Bioreactors Batch bioreactors are the most common method employed for evaluating the stress responses of N. europaea to various nitrification inhibitors due to their relative ease of use, short test time spans, moderate volumes, and ability to test a wide range of conditions simultaneously. In general, a batch bioreactor used for nitrification inhibition studies consists of a sealed vessel, partially filled with test media and cells, leaving ample headspace to provide O2 for the cells, being shaken or stirred vigorously to eliminate mass transfer limitations. Using this configuration, researchers can easily measure NO2 production, O2 consumption, and the production of cometabolic products, and can harvest cells for further microscopy, proteomic, and genomic analyses. An advantage of batch bioreactor experiments is the short-time duration of the tests. Due to the slow growth of N. europaea (8–12 h doubling time), batch bioreactors allow for measurement of ammonia oxidation rates without significant cell growth during the length of the experiment. With this in mind, however, cell density measurements should be checked at the beginning and end of the batch inhibition tests to verify that cell growth is negligible.
2.1. Preventing O2 and NH3 limitations While the size of the batch bioreactor (2 mL to 2 L) and the length of the inhibition test (2 min to 4 h) can vary, certain parameters must be accounted for in every batch bioreactor used to examine nitrification inhibition. Typical maximum observed rates of NH3 oxidation to NO2 by N. europaea in batch bioreactors range from 1.8 to 2.2 mmol NO2 mg protein-min 1 (Radniecki et al., 2011) with N. europaea protein concentrations, measured using the biuret assay (Gornall et al., 1949), typically ranging from 5 to 8 mg protein L 1. With 1.5 mmol of O2 being consumed with every mmol of NO2 produced (Fig. 9.2), these rates and concentrations lead to an O2 utilization rate of 22–26 mM O2 min 1. The solubility of O2 at 25 C, the typical temperature for nitrification inhibition assays, is 253 mM (Lide, 1996). Thus, O2 would become limiting within 10 min. For this reason, it is vital to have adequate headspace, typically one to two times the batch bioreactor’s liquid volume, and mixing, typically either shaking at 250 rpm or mixed via stir bar and stir plate at 700 rpm, to ensure an adequate O2 supply for the cells during the experiment. In addition to O2, NH3 may also become limiting during batch bioreactor experiments. It has been well documented that NH3, not NH4þ, is the
223
N. europaea, Inhibition and Bioreactors
sole energy producing substrate for N. europaea (Suzuki et al., 1974). The amount of NH3 present in any given aquatic system is in equilibrium with NH4þ and is dependent on the pH of the system. With a pKa of 9.3, it is advantageous to keep the system as alkaline as possible without causing harm to the cells to maximize the concentration of NH3. For this reason, a pH of 7.8 is often chosen for nitrification inhibition experiments. However, to maintain this pH throughout the experiment, it is vital to properly buffer the system, either with 40 mM KH2PO4 or 30 mM HEPES (4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid—a nonchelating buffer used when examining heavy metal toxicity), as N. europaea acidifies its environment by generating 3 net moles of Hþ for every mole of NH3 oxidized to NO2 (Fig. 9.2). In batch bioreactor experiments lasting 3 h, with the typical cell densities and NH3 oxidation rates listed above, around 2 mM NH3 is consumed. To minimize decreases in NH3-dependent oxidation rates over the course of the experiment, excess NH3 should be provided to the batch reactors in the form of at least 2.5 mM (NH4)2SO4 (173 mM NH3 at pH 7.8). At the end of the 3 h experiment, roughly 3 mM NH4þ (104 mM NH3) will remain, resulting in only a mild decrease in NH3 oxidation rates (Fig. 9.3).
2.2. Experimental protocol and physiological measurements The general protocol for testing the inhibitory affects of any given chemical in batch bioreactors uses the following format. A 1% (v/v) inoculum of pure N. europaea culture is grown in batch using a minimal growth media containing 25 mM (NH4)2SO4, 40 mM KH2PO4, 3.8 mM Na2CO3,
NH3 oxidation rate (mmol NH3 mg protein-min–1)
3.5 3.0 2.5 2.0 1.5 1.0 0.5 0.0 0
Ks
125
250 NH3 (mM)
375
500
Figure 9.3 The Monod curve of NH3 oxidation to NO2 by N. europaea as defined by the following equation: v ¼ (vmaxS)/(Ks þ S). v, specific NH3 oxidation rate; vmax, maximum specific NH3 oxidation rate (3.27 mmol NH3 (mg protein-min) 1); Ks, halfsaturation constant (40 mM NH3); and S, substrate concentration (mM NH3).
224
Tyler S. Radniecki and Ellen G. Lauchnor
730 mM MgSO4, 200 mM CaCl2, 9.9 mM FeSO4 (with 16.5 mM EDTA (ethylenediaminetetraacetic) free acid, pH 9), and 0.65 mM CuSO4. The cultures are shaken in the dark at 100 rpm at 30 C until they are in their late-exponential/early-stationary phase (0.07–0.1 OD600 nm) after about 3 days. The cells are harvested via centrifugation, washed once with either 40 mM KH2PO4 (pH 7.8) or 30 mM HEPES (pH 7.8) to remove residual NH4þ, NO2, and trace metals, pelleted again via centrifugation, and suspended a final time in 30 mL of either the KH2PO4 or HEPES buffer. The cells are kept on ice until they are ready to be used in the batch bioreactors. The batch bioreactors are filled with the test media of choice containing 2.5 mM (NH4)2SO4 and either 40 mM KH2PO4 (pH 7.8), suitable for all nonmetal contaminants, or 30 mM HEPES (pH 7.8), suitable for all contaminants including metals, being mindful to leave adequate headspace for O2 transfer as discussed above. The addition of the trace metals found in the growth media to the test media is optional as it does not alter the nitrification activity of N. europaea during the 3 h test due to the limited growth of the cells over this time frame. However, the presence or absence of these trace metals has been shown to have a large influence on the sensitivity of N. europaea to heavy metals contaminants (Radniecki et al., 2009a,b). The batch bioreactors are sealed with either bottle caps containing tert-butyl rubber septa caps, best if the bottles are going to be shaken, or a multiport bottle cap containing a sampling tube, best if the bottles are going to be stirred. Once sealed, the inhibitor being tested is added and the batch bioreactors are either shaken or stirred for 1 h to allow the partitioning of the inhibitor to reach equilibrium. After 1 h, the washed and concentrated N. europaea cells are injected into the batch bioreactors to their desired concentration (5–8 mg protein L 1) and are immediately shaken (250 rpm) or stirred (700 rpm) to begin the experiment. All conditions, controls and treatments, should be run in triplicate batch bioreactors. Measuring the accumulation of NO2 within the batch bioreactor over time is one of the most common methods used to determine N. europaea nitrification activity. The concentrations of NO2 within the bioreactors are quantified using a colorimetric assay (Lide, 1996) in which 10 mL of sample from the reactor is added to 890 mL of 1% (w/v) sulphanilamide in 1 M HCl and 100 mL of 0.2% (w/v) N-(1-naphthyl)ethylenediamine dihydrochloride. The presence of NO2 will cause a pink hue to form and can be quantified by measuring its absorbance at 540 nm. The creation of a standard curve from stock NO2 solutions is necessary to complete this assay. This colorimetric assay is extremely sensitive, (0.01 mM lower detection limit), robust, and linear from 0 to 3 mM NO2. While measuring the accumulation of NO2 is a reliable and rapid measure of nitrification activity and inhibition, it provides limited information as to how or why the nitrification activity may be inhibited. However,
N. europaea, Inhibition and Bioreactors
225
measuring the activities of the AMO and HAO enzymes through their AMO and HAO specific oxygen uptake rates (AMO-SOUR and HAO-SOUR, respectively) will provide further clues as to how and why nitrification inhibition is occurring. AMO-SOURs measure the total O2 consumption by N. europaea, not just by AMO as the name may imply. Theoretically, the AMO-SOURs should match the NO2 production rates by a 1.5 ratio. To measure AMOSOURs, N. europaea cells are removed from the batch bioreactor and are placed immediately into a sealed 1.8 mL O2 electrode chamber. This chamber contains a micro-stir bar, to prevent mass transfer issues, and a Clark O2 electrode probe (Yellow Springs Instrument Co., Model # 5331, Yellow Springs, OH) and is water-jacketed at 30 C. The cells continue to oxidize the residual NH3 in their test media and the rate at which they consume O2 during this process is recorded using an YSI model 5300 biological oxygen monitor (Yellow Springs Instrument Co.) and a strip chart recorder or other data acquisition device. The assay typically lasts from 2 to 5 min depending on the level of the cells’ nitrification activity. Once the AMO-SOUR has been completed, 40 mL of 20 mM allylthiourea (ATU) is added (444 mM final concentration) to the microelectrode chamber. ATU is a copper-specific chelator and will inhibit all AMO-SOUR activity. Once AMO activity has ceased, 100 mL of 75 mM NH2OH (4.2 mM final concentration) is added. The addition of NH2OH to the AMO-blocked cells will result in O2 consumption by HAO and cellular processes independent of AMO, although generally at a slower rate. The HAO-SOUR assay generally takes 5–8 min to complete. The comparison of the AMO-SOURs and HAO-SOURs of control and inhibited cells can begin to determine if the inhibitor is affecting the AMO enzyme directly or process further downstream, such as the electron transport chain or membrane stability (Fig. 9.4). If a nitrification inhibitor affects only the AMO-SOURs and not the HAO-SOURs, it can be concluded that the AMO enzyme is being inhibited directly, possibly through either competition for its active site or through interactions with AMO that changes its redox state or morphology, and that is what is blocking the flow of electrons to the terminal acceptor. If the inhibitor affects both AMO-SOURs and HAO-SOURs, it can be concluded that further downstream process are being affected, thus blocking the flow of electrons to the terminal acceptor, and that the AMO enzyme may or may not be affected. Once it has been determined if the inhibitor is affecting AMO alone or other down-stream processes, other assays may be employed to further detail the mechanisms of inhibition. For instance, if the inhibitor is AMO-specific and energy drain is suspected due to cometabolism, the inhibitor can be removed through a series of washes in which cells are harvested via centrifugation and suspended into fresh buffer a total of five
226
Tyler S. Radniecki and Ellen G. Lauchnor
Control Treatment
HAO-SOUR
AMO-SOUR
A
Time
Control and Treatment
Time
Control
Treatment
Time
HAO-SOUR
AMO-SOUR
B Control Treatment
Time
Figure 9.4 (A) Only AMO-SOURs are decreased, suggesting that the nitrification inhibitor affects only the AMO enzyme. (B) Both AMO-SOURs and HAO-SOURs decrease suggesting that the nitrification inhibitor affects processes down-stream from AMO (e.g., membrane integrity) and may or may not be affecting the AMO enzyme directly.
times before being placed into fresh test media. If full activity is restored, energy drain due to cometabolism is a likely culprit for the inhibition (e.g., aromatic hydrocarbons) (Radniecki et al., 2008). If activity is not restored, it is likely that the inhibitor is either permanently bound to the AMO enzyme (e.g., acetylene) (Hyman and Arp, 1992) or has displaced AMO’s metal core (e.g., Zn2þ) (Radniecki et al., 2009a). A reduction in HAO-SOURs suggests that the inhibitor has disrupted the electron transport chain through either direct interactions with the cytochromes (e.g., CN) (Park and Ely, 2009), general damage from oxidative stress (e.g., Cd2þ) (Radniecki et al., 2009b), or the compromise of outer-membrane integrity (e.g., Cu2þ and Agþ) (Park and Ely, 2008a). The integrity of N. europaea’s outer-membrane can be measured by the release of intracellular Kþ. All prokaryotic cells maintain a high intercellular Kþ gradient through the active transport of Kþ via Naþ/Kþ pumps found in the outer-membrane. The release of this intracellular Kþ is a sign of outer-membrane instability and can be measured in the supernatant of pelleted cells through inductively coupled plasma optical emission spectroscopy (ICP-OES) (Radniecki and Ely, 2011). Additionally, the disappearance of intracellular Kþ can be measured from the cell pellet by first dissolving the cell pellet in 3 N HNO3 overnight before using ICP-OES to measure the Kþ concentration. It should be noted that to use the
N. europaea, Inhibition and Bioreactors
227
intracellular Kþ assay, it is necessary to use a non-potassium containing buffer (e.g., Na–HEPES) and to increase the N. europaea cell concentration to at least 25 mg protein L 1 to have Kþ levels significantly higher than background levels.
2.3. Transcriptional assays and sentinel gene expression The N. europaea genome is fully sequenced and annotated (Chain et al., 2003) making genomic tools, including microarrays and quantitative realtime polymerase chain reaction (qRT-PCR), powerful approaches toward understanding how certain chemicals inhibit NH3 oxidation and how N. europaea cells respond to the inhibition. Additionally, these molecular tools allow for the identification and quantification of “sentinel genes”, genes that are only up-regulated in the presence of a specific inhibitor or class of inhibitors (e.g., NE1545—phenol, mbla—chloroform, moeZ— CN, and merA—heavy metals) (Gvakharia et al., 2007; Park and Ely, 2008a,b, 2009; Radniecki et al., 2008), which may prove useful in biosensors applications to detect these contaminants in complex environmental samples. Table 9.1 summarizes some of the recent research conducted on identifying N. europaea sentinel genes for various inhibitors. Microarrays are a useful tool to monitor global gene expression patterns but require large quantities of Total RNA, usually around 10 mg. With a typical cell density of 5–8 mg protein L 1, this requires the harvesting of Total RNA from 120 mL of cell culture. Due to the large volume required to harvest enough Total RNA, batch bioreactors containing at least 1 L of test media are recommended. To harvest high quality Total RNA that has not undergone degradation, it is necessary to use an RNase inhibitor, such as Trizol (Invitrogen, Co., Carlsbad, CA), to stabilize and preserve the Total RNA. To isolate Total RNA, N. europaea cell are harvested via centrifugation and washed in 1 mL of either 40 mM KH2PO4 or 30 mM HEPES buffer (pH 7.8). This wash step removes any trace metals, NH4þ or NO2 that may inhibit downstream extraction processes and increases Total RNA yields up to 10-fold. The cells are once again harvested via centrifugation for 1 min, decanted, and suspended in 500 mL of Trizol reagent and are aggressively mixed for 1 min using a vortexer. The cells and Trizol mixture is then stored at 80 C for further processing. For Total RNA extraction, the cell and Trizol mixture is thawed at room temperature and an additional 500 mL of Trizol reagent is added and mixed. The cells are lysed through shearing by rapidly passing the Trizol mixture through a 20-gauge needle 20 times, which we found to be the optimal number of passes to increase Total RNA extraction yield. At this point, 200 mL of chloroform is added and the Trizol–chloroform mixture is shaken by hand for 15 s. The mixture is incubated at room temperature for
Table 9.1 Summary of N. europaea stress responses to selected inhibitors
Inhibitor
Sentinel gene
Primer sequences 0
Changes in sentinel gene expressiona d,e
16-fold
AMOspecific inhibition onlyb
Yes
Mode of inhibition
Changes in amoA expressionc
Changes in hao expressionc
Energy drain
None
None
Batch/ Biofilm
Radniecki et al. (2008, 2011), Lauchnor et al. (2011)
Energy drain None (both)/ irreversible Inactivation of AMO (CF only)/ General cell cytotoxicity
None
Batch
Gvakharia et al. (2007, 2009)
8-fold (Cd2þ) 6-fold (Zn2þ)
3-fold (Cd2þ) None (Zn2þ)
Batch/ Park and Ely Chemostat (2008a,b), Radniecki et al. (2009a,b)
2-fold
2.5-fold
Batch
Phenol/Aniline/ p-Cresol
NE 1545 For 5 -GGATGATCTG (DUF209) ACGCAAGTGA-30 Rev 50 -CTGCGACAAA GTCGAAAGTG-30
Chloroform (CF)/ Chloromethane (CM)
NE2402 (clpB)
For 50 -TGACGCAAAG CCTCAAACTTCTG-30 Rev 50 -AGCACGTGTC GCTCCATATTGT-30
4-foldd (CF) No 8-foldd (CM)
Cd2þ/Zn2þ
NE0839 (merA)
For 50 -GCTTTATCAAG CTGGTCATC-30 Rev 50 -ACATCCTTGTT GAAGGTCTG-30
25-foldf to 277-foldd (Cd2þ) 48-foldd,f (Zn2þ)
Yes AMO core (Zn2þ) interation (both)/ No (Cd2þ) Oxidative Stress (Cd2þ only)
CN
NE2353 (moeZ)
For 50 -AGATCGGCAGC GATTGGTCG-30 Rev 50 -TTCACGTGATG TGCTGCTCG-30
35-foldd
Yes
Cu2þ-chelation of AMO
Culturing conditions
References
Park and Ely (2009)
a b c d e f
Housekeeping gene
RNA_45 (16S rRNA)
For 50 -GGCTTCACACG TAATACAATGG-30 Rev 50 -CCTCACCCCAGT CATGACC-30
Radniecki et al. (2008, 2011), Lauchnor et al. (2011), Radniecki et al. (2009a,b)
Metabolic enzyme (AMO)
NE0944 (amoA)
For 50 -TGGCGACATAC CTGTCACAT-30 Rev 50 -ACAATGCATCTT TGGCTTCC-30
Radniecki et al. (2008, 2011), Lauchnor et al. (2011), Radniecki et al. (2009a,b)
Metabolic enzyme (HAO)
NE2044 (hao) For 50 -CAAACTTGCCGA AATGAACC-30 Rev 50 -GCTGGTGATGTT CTCTGCAA-30
Radniecki et al. (2008, 2011), Lauchnor et al. (2011), Radniecki et al. (2009a,b)
Maximum relative gene expression observed. Yes, only AMO-SOURs were affected by the inhibitor; No, both AMO and HAO-SOURs were affected by the inhibitor. Maximum relative gene expression observed. Observed in batch reactors. Observed in biofilm reactors. Observed in continuous growth reactors.
230
Tyler S. Radniecki and Ellen G. Lauchnor
2–3 min to allow for the formation of a clear aqueous phase top layer. This top clear aqueous layer is removed and placed into an RNase-free 1.5 mL microcentrifuge tube, taking care to avoid transferring proteins from the thin layer directly underneath. An equal volume of RNase-free 70% ethanol is added to the 1.5 mL microcentrifuge tube and mixed via pipetting. This mixture is placed directly onto a Qiagen RNeasy Mini-Kit column (Qiagen, Valencia, CA) and the Total RNA is purified following the manufacturer’s instructions. Once purified, the purity and quantity of the isolated Total RNA can be measured using a cuvette-free spectrophotometer, such as a NanodropÒ ND-1000 UV/vis spectrophotometer (Thermo Fischer Scientific, Waltham, MA), in which 1 mL of sample is scanned from wavelengths ranging from 220 to 350 nm. The quantity of Total RNA is calculated by the absorbance at 260 nm using the following equation: Total RNA concentration (mg/mL) ¼ Abs260 40 (Ausubel et al., 2002). The purity of the Total RNA is determined by examining the Abs260/Abs280 and the Abs260/Abs230 ratios. Pure Total RNA will have an Abs260/Abs280 ratio between 1.8 and 2 and Abs260/ Abs230 above 1.8. Total RNA with Abs260/Abs280 ratios below 1.8 indicates the presence of contaminating DNA, proteins, phenol, or chaotropic salts and must be repurified before further use. For additional verification of RNA quality, an Agilent 2100 Bioanalyzer (Agilent Technologies, Santa Clara, CA) can be used determine if RNA degradation is present. Once the Total RNA has been quantified and determined to be of high quality, it should be kept at 80 C or on dry ice until the samples can be handled by either an in-house microarray user facility, if available, or shipped to a commercial microarray facility. These facilities will process the Total RNA further by creating fluorescently labeled cDNA, hybridizing this labeled cDNA to the microarrays, in which the labeled cDNA will bind to probes representing the gene that encodes the cDNA, and determine the level of gene expression for each probe on the microarray by quantifying the observed fluorescence of the hybridized cDNA when the microarray is scanned with a laser. By comparing the fluorescence of a given probe between control and treatment samples, it is possible to determine if the gene that probe represents changed its expression, either up-regulated or down-regulated, upon exposure to the inhibitor (Schulze and Downward, 2001). After a gene of interest has been identified using microarrays, it is important to verify that gene’s expression with a second method (e.g., qRT-PCR) due to the many inherent problems that may occur within a protocol as complex as microarrays which may lead to false-positive results (e.g., poor labeling of cDNA, improper hybridization conditions, mismatched probe-target binding, poor quality Total RNA, fluorescence bleaching, etc.) (Murphy, 2002). qRT-PCR uses PCR to amplify genes of interest and quantifies their abundance through the use of a double stranded DNA-specific fluorophore
N. europaea, Inhibition and Bioreactors
231
(e.g., SYBR green). The level of fluorescence, which indicates the relative abundance of each gene of interest, is measured after each PCR cycle. By determining how long it takes for a given gene of interest from both control and treatment samples to reach an arbitrarily set critical threshold of fluorescence (CT), selected to intersect the fluorescent curves during their linear exponential phase (usually between cycle 15 and 25), it is possible to determine if the gene of interest was upregulated or downregulated in response to the treatment condition. There are two main methods for analyzing qRT-PCR data. The delta– delta Ct (2 DDCt) method assumes an amplification efficiency of 1 and requires that all amplification efficiencies be equal and very close to 1, which may require additional optimization of amplification conditions (Livak and Schmittgen, 2001). The data analysis of real-time polymerase chain reaction method (DART-PCR) accounts for amplification efficiencies that are less than 1 and uses a correction factor based on the amplification efficiency to adjust the raw data accordingly (Peirson et al., 2003). While this method requires less optimization of amplification conditions, it may cause large errors if the amplification efficiencies are low (e.g., <70%). To date, neither method has been chosen as superior to the other and both are widely used in the literature (Cikos et al., 2007; Skern et al., 2005). In both methods, all gene expression data is normalized to a constitutively expressed housekeeping gene (e.g., 16S rRNA gene) to adjust for any pipetting errors that may have occurred and uses the following formula for calculating relative gene expression: fold change ¼ ((R0 trt)/(R16S trt))/ ((R0 con)/(R16S con)) where R0 trt is the calculated expression value of the gene of interest in the treated cells, R16S trt is the calculated expression value of the 16S rRNA gene in the treated cells, R0 con is the calculated expression value of the gene of interest in the control cells and R16S con is the calculated expression value of the 16S rRNA gene in the treated cells. If fold change > 1, the gene of interest is upregulated, if fold change ¼ 1, there is no change in gene expression and if fold change is <1, the gene is downregulated and should be expressed as 1/fold change. To conduct qRT-PCR, it is necessary to design primers to target the genes of interest using one of many available primer design software programs (e.g., Primer3 or Primer-BLAST). When designing qRT-PCR primers, there are several guidelines that should be kept in mind. The length of the primers should be between 20 and 25 base pairs (bp), the primer should have a GC content of 55% or less, the primer sequence should avoid having GC sequences on their ends and avoid having a nucleotide base repeated more than three times in a row. Additionally, the forward and reverse primers should have similar melting temperatures (Tm) to each other and to primers of all other genes of interest examined during the study, usually around 60 C, and the sequence amplified by the primers should be short, ideally between 150 and 300 bp. Finally, a BLAST search of the primer
232
Tyler S. Radniecki and Ellen G. Lauchnor
sequences against the N. europaea genome should be done to ensure that they only will hybridize to the gene of interest and not to other sequences found within the genome. Table 9.1 lists the primer sequences used for several recently identified N. europaea sentinel genes, the housekeeping 16S rRNA gene, and the major metabolic pathway genes, amoA and hao. The template for qRT-PCR assays, cDNA, is synthesized from 1 mg of Total RNA using random hexameric primers contained within the iScript cDNA Synthesis kit (Bio-Rad, Hercules, CA) per manufacturer’s instructions. Once synthesized, the cDNA should be diluted 100-fold in TE buffer (pH 8) to a final concentration of 2 ng/mL. The diluted cDNA should be immediately frozen at 20 C before use in qRT-PCR experiments. The freezing and thawing of cDNA (and PCR primers) when making new dilutions and stock solutions enhances their mixing and improves the repeatability of the qRT-PCR results. Before qRT-PCR experiments can begin, it is necessary to optimize the primer and cDNA concentrations as well as the annealing temperature. In general, the annealing temperature is set to 5 C below the Tm of the primers selected, usually resulting in an annealing temperature of about 55 C. cDNA template concentrations can vary widely depending on the abundance of the selected template and may be a little as 1 ng per reaction for the very abundant 16S rRNA gene to as much as 20 ng per reaction for more rare transcripts such as merA. Optimal primer concentrations can also vary significantly typically ranging from 125 to 500 nM. The following cycle conditions are used for qRT-PCR; 2 min at 95 C, then 50 cycles at 95 C for 30 s, Tm (e.g. 55 C) for 45 s, and 72 C for 45 s. At the end of the reaction, dissociation curves of the products are generated by bringing the temperature to 60 C and then raising the temperature by 0.5 C every 20 s until a final temperature of 95 C is attained. The qRTPCR parameters are considered optimized if they produce a high amplification efficiency that enters into its linear exponential phase between cycles 12 and 25 and results in only a single product (i.e., a single narrow peak) being produced as determined by the dissociation curve of the product. If multiple products are present, there will be multiple peaks that will form at varying temperatures depending on the base-content of the doublestranded DNA. It should be noted that for any given gene for any given condition up to nine replicates will be conducted (three biological replicates with three technical replicates being conducted for each biological replicate). To minimize pipetting errors, it is highly recommended to create mastermixes containing all iQ SYBR Green Supermix kit components (Bio-Rad), primers and water at 110% volumes whenever possible. For example, for three biological replicates with three technical triplicates, create a single mastermix containing 990%, by volume, of the SYBR Green kit components (Bio-Rad), primers and water needed for a single qRT-PCR well.
N. europaea, Inhibition and Bioreactors
233
Thoroughly mix and split into three mastermixes and add 330%, by volume, of the cDNA needed for a single qRT-PCR well. Thoroughly mix and add the appropriate volume to each qRT-PCR well.
3. Identifying Stress Responses in Continuous Growth Systems While batch assays are a common method used to examine the affects of nitrification inhibitors on N. europaea, to examine the effects of long-term exposure (days to weeks) to nitrification inhibitors, batch growth assays, fill and draw reactors (FDRs), and continuous growth reactors are more suitable test methods. Batch growth assays are the simplest of the test methods allowing for the operation of numerous reactors simultaneously, but numerous variables change over the course of the experiment (e.g., accumulation in cell and NO2 concentrations and decreases in NH4þ concentrations and pH). FDRs maintain a pseudo-steady-state in regard to cell, NH4þ and NO2 concentration and pH but are relatively labor intensive and still have changes in these variables between sampling and feeding times. Finally, continuous growth reactors achieve true-steady state and allow for the greatest control over all variables. However, continuous growth reactors are complex and expensive which limits the number of reactors that can be operated simultaneously.
3.1. Batch growth assays The general protocol for testing the inhibitory affects of any given nitrification inhibitor in batch growth reactors uses the following format. A 1% (v/v) inoculum of late-exponential/early-stationary N. europaea cells (OD600 0.07–0.1) are added to 155 mL batch reactors (as described in Section 2.2) containing 50 mL of fresh sterile growth media (pH 7.8) with a composition of 25 mM (NH4)2SO4, 3.8 mM Na2CO3, 730 mM MgSO4, 200 mM CaCl2, 9.9 mM FeSO4 (with 16.5 mM EDTA free acid, pH 9), 0.65 mM CuSO4, and either 30 mM HEPES and 10 mM KH2PO4 (if examining heavy metal inhibition) or 40 mM KH2PO4. The reactors may be sealed with either a foam stopper, which allows for gas transfer and is suitable for the examination of nonvolatile inhibitors (e.g., heavy metals) or a tert-butyl rubber septa screw cap, suitable for the examination of volatile inhibitors (e.g., aromatic hydrocarbons). The batch growth reactors are gently agitated at 100 rpm in the dark at 30 C. All batch growth reactor conditions should be tested in triplicate batch growth reactors. If the batch growth reactors are sealed with a tert-butyl rubber cap, it is necessary to supply additional O2 to the system daily. This is best achieved
234
Tyler S. Radniecki and Ellen G. Lauchnor
by filling a sterile gas-tight syringe with filter-sterilized O2 and placing the syringe into the septum of the reactor. If the cells have consumed O2 within the reactor, a vacuum will have been created and this will draw down the syringe thus replenishing the O2 within the reactor. If the syringe does not draw down but O2 consumption is expected, it is advisable to force 0.5– 1 mL of fresh O2 into the system. Reasons for the consumption of O2 but a lack of a draw down may include high friction between the syringe plunger and the syringe side walls or a release of vacuum due to a leaking septum. To prevent the latter, it is recommended to conduct the O2 replacement before withdrawing samples for cell and NO2 measurements. General nitrification activity of the cells is monitored by measuring the daily cell and NO2 accumulation in the reactor. Cell accumulation is monitored by removing a 1 mL aliquot from the reactor and measuring its OD600. This reading is entered into a previously created standard curve equation relating OD600 to protein concentrations. The standard curve is created by measuring the protein content (as described in Section 2.2) and the OD600 of N. europaea cultures at various cell densities. This standard curve is linear for OD600 readings ranging from 0 to 0.14 (higher densities have not been tested). During these experiments, N. europaea converts the vast majority of the total NH4þ to NO2 (ranging from 25 to 40 mM NO2) and lowers the pH to around 5.5. This decrease in pH sharply shifts the NH4þ/NH3 equilibrium so that 99.98% of the remaining ammonia is the ionized NH4þ, the nonsubstrate species of ammonia for N. europaea, thus slowing or ceasing ammonia oxidation in the reactor (Fig. 9.5). The NO2 concentrations observed in these reactors far exceed the 3 mM maximum of the colorimetric method used to measure NO2 (described in Section 2.2). For this reason, it is advised to measure the NO2 concentration by measuring the absorbance of a 1 mL aliquot at 352 nm (Abs352) and 400 nm (Abs400) and use the following equation: NO2 (mM) ¼ (Abs352 Abs400)/0.0225. AMO-SOURs and HAO-SOURs can be measured as described in Section 2.2. However, if it is desired to monitor the expression of select genes via qRT-PCR, it is highly recommended to either increase the batch reactor size or run additional batch reactors that can be sacrificed for gene expression at the desired time points. This is due to the recommendation of harvesting at least 75 mg of protein for Total RNA extraction, which should yield about 1 mg of Total RNA for qRT-PCR assays.
3.2. Fill and draw reactors Fill and draw reactors (FDRs) hold several advantages over batch growth reactors in that the pH, cell, NH4þ, and NO2 concentrations remain in pseudo-steady state with their concentrations varying slightly with each fill and draw event but always returning quickly to steady-state levels (Fig. 9.5).
235
24
12
16
8
8
4
0
NO2– (mM)
B
25
50 Hours
75
0 100
48
12
32
8
16
4
0
0 0
5
10 Days
15
20
C
NO2– (mM)
Protein (mg/L)
0
60
30
40
20
20
10
0
Protein (mg/L)
NO2– (mM)
A
Protein (mg/L)
N. europaea, Inhibition and Bioreactors
0 0
20
40
60
Days
Figure 9.5 The accumulation of NO2 (■) and cells (△) (A) in a batch growth reactor, (B) at pseudo-steady state in a fill and draw reactor, and (C) at true-steady state in a continuous growth reactor.
Additionally, the specific growth rate (m) of the cells can be manipulated as desired by adjusting the dilution ratio (D). D is the ratio of the media flow rate (Q), in this case the daily bulk removal of old media and addition of fresh growth media, and the cell culture volume (V) and is represented by the following equation: D ¼ Q/V. D is also the reciprocal of the hydraulic
236
Tyler S. Radniecki and Ellen G. Lauchnor
residence time (yH), the average length of time a water molecule or suspended cell is present in the reactor. At steady state, m ¼ D þ b (specific decay coefficient) and will decrease as D decreases and will increase as D increases until the maximum specific growth rate (mmax) is achieve. As D increases above mmax, cells are being replaced more quickly than they are growing and cell concentrations will decrease until complete washout of the cells occurs. Simultaneously, as D increases above mmax, NH4þ will begin to accumulate within the reactor and NO2 will washout of the reactor due to a smaller concentration of cells within the reactor and those cells having less contact time (i.e., shorter yH) with which to oxidize the NH3. With an observed doubling time of 8–12 h, the theoretical maximum D that will not cause washout (Dmax) is 1.4–2.1 day 1. However, the washout curve for N. europaea is extremely steep and minor permutations in m near mmax may cause rapid washout of the system. This is especially true when the system is designed to characterize inhibition and potential recovery from the inhibition. For this reason, a more conservative D of 0.14 day 1, resulting in a more stable system, even upon inhibition, is suggested for examining nitrification inhibition of continuously cultured N. europaea. The general protocol for testing the inhibitory affects of any given nitrification inhibitor in FDRs uses the following format. A 1% (v/v) inoculum of late-exponential/early-stationary N. europaea cells (OD600 0.07–0.1) is added to triplicate 155 mL batch reactors (as described in Section 2.2) containing 50 mL of fresh sterile growth media (pH 7.8) and is sealed with either a foam stopper or rubber-butyl septa screw cap. The FDRs are gently agitated at 100 rpm in the dark at 30 C. Fresh O2 should be supplied daily to sealed FDRs as described in Section 3.1. Throughout the experiment, the accumulation of NO2 and cell concentrations should be monitored daily (as described in Section 3.1) and the pH of each FDR should be adjusted daily to 7.8 through the addition of sterile 0.5 M Na2CO3. The volumes of Na2CO3 to add to the FDR can be calculated based on Na2CO3 titration curves of the FDR media. Once the cells reach late-exponential/early stationary phase (OD600 0.1 and a leveling of NO2 concentration, 4 days), media with suspended cells should be aseptically removed from the FDRs and replaced daily with fresh growth media at volumes that achieve the desired D. The removed cell culture can be used to monitor AMO-SOURs and HAO-SOURs, as described in Section 2.2, with the following modification. Excess NH4þ (typically 5 mM final concentration) must be provided for the AMOSOUR measurements due to the limited NH4þ found in the FDRs at steady-state levels. This will measure the maximum potential AMOSOURs of the cultures. Additionally, Total RNA can be isolated from the removed cell culture for qRT-PCR analysis, as described in Section 2.3. After pseudo-steady state has been achieved in the FDRs, the nitrification inhibitor can be added in one of three ways: (1) Progressive addition—the
237
N. europaea, Inhibition and Bioreactors
inhibitor is added to the FDR with each addition of fresh media, gradually building in concentration until a steady state has been achieved, (2) Spike addition—the inhibitor is spiked into the FDR directly to the desired concentration and is allowed to gradually wash out of the FDR with its removal and the addition of inhibitor-free fresh media, and (3) Steady-state addition—the inhibitor is both spiked into the FDR directly and the concentration is maintained with additional inhibitor added with the fresh media addition. FDRs have been successfully operated in our lab for over 3 months using the above protocol. The biggest advantage toward using FDRs is the ability to achieve pseudo-steady state and operate many reactors simultaneously allowing for the rapid examination of several parameters at once. However, the operation of FDRs is labor intensive and lacks the true steady-state that can be achieved with continuous growth reactors.
3.3. Continuous growth reactors Continuous growth reactors operate under the same principles as FDRs, as described in Section 3.2. However, unlike FDRs, where media and O2 additions and pH adjustments are made once a day leading to a pseudosteady state, continuous growth reactors achieve a true steady state (Fig. 9.5) through the continuous flow of media in and out of the reactor, the automated adjustment of pH and the continuous supply of O2 (Fig. 9.6). N. europaea cells cultured in continuous growth reactors have been Filtered air addition Addition of media and base Removal of media and cells
Media
Scale
Figure 9.6
Base
Spent media
Scale
Schematic of a N. europaea continuous culture bioreactor design.
238
Tyler S. Radniecki and Ellen G. Lauchnor
successfully used to identify the inhibition mechanisms of long-term exposure to Zn2þ and Cd2þ, identify the defense and recovery mechanisms employed by N. europaea upon exposure to these metals and correlate the expression of sentinel genes to the concentration of these metals found within the reactor (Chandran and Love, 2008; Radniecki et al., 2009a,b). Continuous growth reactors have been used to characterize the inhibition of N. europaea by extreme NH4þ, NO2 and salt concentrations (Hunik et al., 1992), changes in pH and temperature (Groeneweg et al., 1994), and xanthate-based fertilizer amendments (Underhill and Prosser, 1987). Additionally, continuous growth reactors have been used to identify N. europaea’s production of the quorum sensing signal molecule acyl-homoserine lactone (Burton et al., 2005) and the production of the green house gases nitrous oxide and nitric oxide (Yu et al., 2010). N. europaea cells are continuously cultured by adding a 1% (v/v) inoculum to a 7 L water-jacketed Bioflo 110 bioreactor (New Brunswick Scientific, Edison, NJ) containing 3 L of continuous growth media (12.5 mM (NH4)2SO4, 25 mM NH4OH, 30 mM HEPES (pH 7.8), 10 mM KH2PO4, 730 mM MgSO4, 200 mM CaCl2, 9.9 mM FeSO4 (with 16.5 mM EDTA free acid, pH 9), and 0.65 mM CuSO4) and operated in batch mode at 30 C in the dark with agitation set to 500 rpm. Dissolved O2 (dO2) levels are kept at air saturation (8 mg dO2 L 1) through the metered addition of filtered compressed air at 200 mL min 1. The pH is maintained at 7.8 with the automated addition of 0.5 M Na2CO3. Theoretically, Na2CO3 can be added directly to the growth media and the pH be maintained with NaOH. However, successfully continuous culture of N. europaea cells using any base addition other than Na2CO3 has not been achieved to our knowledge. It should also be noted that continuous culture reactors are expensive and time-consuming and are often run in singlet. For this reason, all analytical measurements (e.g., NH4þ and NO2 concentrations, AMO-SOURs and HAO-SOURs, etc.) should be conducted in technical triplicates. Additionally, whenever possible, the conditions should be repeated within the same reactor (e.g., expose the cells to the same concentration of the selected inhibitor multiple times), or, if the inhibitor is added at progressively higher concentrations and allowed to washout of the reactor, the cellular responses should be measured when the inhibitors reach the same concentrations in the reactor in addition to the initial peak concentration. Ammonium concentrations are measured daily from a 3 mL sample extracted from the bioreactor using a VWR SympHony Ammonia Concentration Electrode (VWR International Inc., West Chester, PA) per manufacturer’s instruction. Nitrite and cell concentrations are measured daily as described in Section 3.1. Once the N. europaea cells reduces the NH4þ concentration below 5 mM, the bioreactor is switched to a continuous culturing reactor by increasing the agitation to 700 rpm and setting the dilution rate to 0.14 day 1 using an influent feed rate of 432 mL day 1.
N. europaea, Inhibition and Bioreactors
239
The composition of the influent feed is the same as the continuous growth media and is stored in 10 L bottles. An empty and sterile 10 L bottle serves as the waste container for the effluent feed. The influent and effluent feeds can be pumped using an external peristaltic pump to allow for the finetuning of the flow rates. The influent and effluent bottles are placed on large capacity scales to allow for flow rates to be calculated based on the absolute value of the change in weight of the bottles (1 g ¼ 1 mL of water) over a measured time span (generally 15–24 h). Once steady-state has been achieved in the continuous culture reactor, as determined by constant cell, NO2 and NH4þ concentrations, and consistent AMO and HAO-SOURs (as described in Section 2.2), a nitrification inhibitor can be added either progressively, spiked, or continuously (as described in Section 3.2). However, it should be noted that, to date, we have been unable to add even slightly volatile inhibitors (e.g., phenol) due to their stripping from the liquid medium in the reactor by the high air flow rates necessary to maintain adequate dO2 levels. This remains one of the biggest obstacles in testing batch or continuously cultured N. europaea cells aerated by bubbled air or O2. qRT-PCR can be used to measure the expression of selected genes of interest in continuously cultured N. europaea cells by aseptically harvesting cells through a sampling port and processing the Total RNA as described in Section 2.3. It is recommended that Total RNA be isolated from continuously cultured cells sample multiple times (e.g., daily) over the course of 1 yH during steady-state operation before the addition of the inhibitor to serve as the control gene expression levels for the experiment. Contamination is one of the biggest concerns when operating a continuous culture bioreactor. For that reason, all ports in the top of the bioreactor are covered in aluminum foil where possible, a small pool of 70% ethanol is left on top of all septum ports and when changing buffer, feed, or waste containing bottles, a liberal amount of 70% ethanol is sprayed on the tubing removed from the empty bottles but still connected to the continuous culture bioreactor, and is also sprayed on the connections to the new media bottles. In addition, the sample port should be immersed in 70% ethanol after the removal of each sample before a clean and sterilized sample vial is reattached.
4. Identifying Stress Responses in Biofilms AOB, including N. europaea, typically exist as part of biofilm communities in both natural environments and WWTP. Detailed studies identifying AOB species and characterizing their activity in the biofilms have been performed on mixed biofilm communities in these environments (Gieseke
240
Tyler S. Radniecki and Ellen G. Lauchnor
et al., 2003; Kindaichi et al., 2006). The following describes the methods for investigating nitrification inhibition of single species N. europaea biofilms cultured in Drip Flow Biofilm Reactors (BioSurface Technologies, Inc., Bozeman, MT). The drip flow biofilm reactor (DFR) consists of four isolated rectangular channels that contain a removable coupon the size of a glass microscope slide for attached growth of the organisms (Fig. 9.7). The material of the coupon may vary (e.g., glass or steel), but should have adequate texture, as in the case of frosted glass, to promote cell attachment to the surface. During operation, the DFR is placed at an incline and fresh media (as defined in Section 3.3) is pumped into each channel and flows down the slide’s surface by gravity. The DFR creates a laminar film flow that results in little shear stress and the high surface area to volume ratio minimizes O2 transfer limitations without need for stirring or creating additional shear forces. Details on the setup and operation of the DFR are found in the operator’s manual and standard protocol (Goeres et al., 2009). Deviations from the standard protocol for inoculation of N. europaea biofilms and long-term operation are described below. Each channel of the DFR is inoculated with 0.3 mg protein of concentrated late exponential/early stationary batch cultures of N. europaea suspended in 15 mL of spent batch growth media. The DFR is placed in the dark at 30 C and is neither shaken nor has media flow occurring for the first 1–3 days to allow for initial attachment of the cells to the frosted microscope slides (coupons) located in each channel. The length of this phase within this range has not been shown to significantly influence the growth of the biofilms.
Influent media
Needle and septum
Directi
on of fl ow
Biofilm
Removable legs
Figure 9.7
Effluent Glass slide
Schematic of a N. europaea drip flow biofilm reactor design.
N. europaea, Inhibition and Bioreactors
241
Upon starting flow, the biofilm growth medium is pumped through the DFR at a rate of 15 mL h 1 per channel using a peristaltic pump. The biofilm growth medium consists of 2.5 mM (NH4)2SO4, 20 mM HEPES (pH 7.8), 3.8 mM Na2CO3, 10 mM KH2PO4, 730 mM MgSO4, 200 mM CaCl2, 9.9 mM FeSO4 (with 16.5 mM EDTA free acid, pH 9), and 0.65 mM CuSO4. The medium is prepared without Na2CO3 and is added from a sterile 0.5 M stock solution after autoclaving, at which time sterile NaOH is added to adjust the pH to 7.8. At the specified flow rate and activity, 2–3 mM of total NH4þ, or about half of the influent concentration, is consumed in the DFR, the pH does not typically drop below 7.5 and about 10 L of medium is consumed per week of DFR operation. Quick-release valves in the tubing connecting the 10 L media feed and waste containers are essential for quick and sterile replacement of fresh medium during long-term continuous operation. Nitrite production is monitored, using the colorimetric assay described in Section 2.2, by sampling effluent liquid from each of the four reactor channels through quick release connectors in the effluent tubing. A clamp can be used to block the tubing above the connectors for 10 min to allow for enough fluid to accumulate for NO2 analyses and to measure flow rates by weighing the collected fluid. A biofilm is considered to be fully mature once it reaches a maximum rate of NO2 production, typically in the range of 0.03–0.04 mmol NO2 h 1, and may take up to 4 weeks to achieve these rates. Care should be taken to keep the DFR, medium, and tubing from contamination during long-term cultivation of N. europaea biofilms. Liberal use of 70% ethanol during all sampling procedures and media replacement is usually sufficient to avoid contamination. With long periods of operation N. europaea biofilm growth may spread to the DFR tubing. Colonized tubing may be replaced with fresh, autoclaved tubing if care is taken to maintain sterility with use of ethanol or working in a laminar flow hood. Accurate measurement of biomass in the biofilms can only be obtained by destructive sampling of the entire slide. This is done by removing the biomass from the slide by scraping the surface with a razorblade and flushing cells into a solution of HEPES buffer. In the liquid, the cells are homogenized by vortexing and samples can be removed for protein measurement using the biuret assay, as described in Section 2.1, or further processed for Total RNA extraction and transcriptional analysis, as described in Section 2.3. Nitrification inhibition experiments are conducted during continuous flow operation of the DFR through the addition of inhibitors directly into the media influent, via syringe pump. Since the DFR has four isolated channels each containing a biofilm coupon, typically one inhibitor condition at a time can be tested in a single DFR with duplicate controls and duplicate treatments. Effluent samples are collected to measure changes in
242
Tyler S. Radniecki and Ellen G. Lauchnor
NO2 production and to measure the concentrations of the inhibitors and/ or their oxidized daughter products (Lauchnor et al., 2011). Level of inhibition is determined by directly comparing the NO2 production rates in exposed biofilms before and after inhibition, using the control biofilms to verify constant NO2 production rates during the test. Alternatively, the coupons containing the biofilms can be removed from the DFR for microscopic examination of biofilm structure, or placed in a recirculating laminar flow cell, containing the inhibitor and biofilm growth media, where the concentration profiles of O2, pH, NO2, and NH4þ can be measured using microelectrodes as described in detail elsewhere (Gieseke and deBeer, 2004).
5. Conclusions N. europaea is an excellent model organism to use in understanding how priority pollutants and emerging contaminants may inhibit NH3 oxidation in the global nitrogen cycle and in the removal of nitrogen from WWTP. The biochemistry of the NH3 oxidation pathway in N. europaea is well understood (Arp et al., 2002) and many protocols exist with which to probe the activity of key enzymes within that pathway (e.g., AMO-SOURs and HAO-SOURs). Additionally, nitrification inhibition tests have been successfully conducted with N. europaea cells grown in batch (Park and Ely, 2009), continuous culture (Radniecki et al., 2009b) and biofilms (Lauchnor et al., 2011), allowing for researchers to examine how different growth phases and conditions affect nitrification inhibition. Choosing which bioreactor configuration is best for a particular nitrification inhibition assay depends on the goals of the individual experiment and care must be taken in interpreting the results keeping in mind the strengths and weaknesses of each configuration. For instance, 3-h acute batch inhibition tests are the simplest (particularly for testing volatile compounds) and quickest format to use. This format allows a researcher to test a wide range of concentrations and conditions in a relatively short period of time and allows for the easy harvest of cells for genetic characterization. However, batch assays do not allow for the observation of long-term exposure inhibition patterns to emerge (including increased sensitivity during longer exposure periods) and makes it difficult to characterize the potential recovery of N. europaea from the inhibition. Batch growth inhibition assays allow for longer inhibition exposure times (generally 3–5 days) to be examined while still being simple enough to test a wide range of inhibitor concentrations and conditions simultaneously. However, batch growth inhibition assays do have the decided disadvantage of only being capable of being run to a moderate exposure
N. europaea, Inhibition and Bioreactors
243
time and several variables, including pH, NO2, NH4þ, and cell concentrations, are in constant flux throughout the experiment. FDRs can maintain these variables at a pseudo-steady state for much longer exposure times (weeks to months) and makes it possible to test how cell age influences toxicity. In addition, the recovery of cell activity and growth can be monitored as the inhibitor is flushed out of the FDR over time. The main disadvantages of the FDR are that it is labor intensive, thus limiting the number of conditions that can be simultaneously tested, and pH, NO2, NH4þ, and cell concentrations are in still in flux throughout the experiment, although in a more limited fashion. A continuous growth reactor is less labor intensive than FDRs and provides the highest level of control of all variables within the reactor as true-steady state is achieved and maintained over the course of weeks to months. Similar to FDRs, the long experimental time allows for the examination of the impact of long-term exposure to the inhibition and of the potential recovery of cell activity and growth as the inhibitor washes out of the system. The large volume of most continuous growth reactors allows for the harvesting of relatively large cell samples for genetic and physiological tests on a daily basis. The disadvantages to using continuous growth reactors are that they are more labor intensive and time-consuming than batch assays, require relatively expensive culturing equipment (thus often limiting the number of reactors available to the researcher) and are a fully mixed and aerated system that makes testing volatile compounds problematic. N. europaea cells are most often found in WWTP in biofilms. The formation of biofilms introduces a host of new conditions not captured in planktonic batch and continuously cultured assays. These conditions include factors such as heterogeneity in cell age, the presence of lipid polysaccharides, and the diffusion limitations of substrates and inhibitors through the thickness of the biofilm. DFRs have been used to demonstrate that these factors potentially influence the sensitivity of N. europaea to inhibitors but do not necessarily change their ultimate transcriptional responses (Lauchnor et al., 2011). While DFRs provide a more realistic simulation of WWTP conditions, they have several limitations that must be considered as well, not the least of which is that they are time-consuming. It generally takes up to 3–4 weeks to grow pure culture N. europaea biofilms for inhibition tests, thus greatly reducing the ability to quickly test a large range of conditions and concentrations. Additionally, N. europaea biofilms do not lend themselves well to traditional AMO-SOUR and HAO-SOUR assays thus limiting the amount of physiological information that they can provide. Finally, DFRs provide limited cell mass for transcriptional examination as sampling of an N. europaea biofilm is a destructive process that can only be done at the end of the experiment. With N. europaea’s genome being fully sequenced and annotated (Chain et al., 2003), there are now many powerful genomic tools, including
244
Tyler S. Radniecki and Ellen G. Lauchnor
microarrays and qRT-PCR, available to the research community to probe the transcriptional responses of N. europaea to nitrification inhibitors. The results of these genomic assays have lead to an even greater understanding of how the nitrification of N. europaea is being inhibited and what action does N. europaea take, if any, in response to the inhibition. Recent studies in the literature have highlighted several candidate sentinel genes for a wide-range of inhibitors (Table 9.1). The expression of these sentinel genes provide superior biomarkers for nitrification inhibition in comparison to traditional physiological assays, including NO2 production and SOURs, and the expression of metabolic enzymes, amoA and hao, in that they provide a higher level of specificity allowing for the cause of the inhibition to be identified rather than just identifying that inhibition is occurring. Recently, sentinel gene green fluorescent protein (GFP)-constructs within N. europaea have been created (Gvakharia et al., 2009) and may be useful in biosensor applications to detect and identify nitrification inhibitors in complex environmental and wastewater samples. The use of such biosensors may one day allow WWTP operators to have the capability to identify nitrification inhibitors entering into the WWTP at an early stage and take corrective actions (e.g., increasing aeration upon the detection of aromatic hydrocarbons, the addition of Cu2þ upon the detection of CN or the addition of Ca2þ/Mg2þ upon the detection of heavy metals) before nitrification failure occurs.
REFERENCES Arp, D. J., Sayavedra-Soto, L. A., and Hommes, N. G. (2002). Molecular biology and biochemistry of ammonia oxidation by Nitrosomonas europaea. Arch. Microbiol. 178, 250–255. Ausubel, F. M., Brent, R., Kingston, R. E., Moore, D. D., Seidman, J. G., Smith, J. A., and Struhl, K. (eds.), (2002). Short Protocols in Molecular Biology, John Wiley & Sons, Inc., Hoboken, New Jersey. Burton, E. O., Read, H. W., Pellitteri, M. C., and Hickey, W. J. (2005). Identification of acyl-homoserine lactone signal molecules produced by Nitrosomonas europaea strain Schmidt. Appl. Environ. Microbiol. 71, 4906–4909. Chain, P., Lamerdin, J., Larimer, F., Regala, W., Lao, V., Land, M., Hauser, L., Hooper, A., Klotz, M., Norton, J., Sayavedra-Soto, L., Arciero, D., Hommes, N., Whittaker, M., and Arp, D. (2003). Complete genome sequence of the ammonia-oxidizing bacterium and obligate chemolithoautotroph Nitrosomonas europaea. J. Bacteriol. 185, 2759–2773. Chandran, K., and Love, N. G. (2008). Physiological state, growth mode, and oxidative stress play a role in Cd(II)-mediated inhibition of Nitrosomonas europaea 19718. Appl. Environ. Microbiol. 74, 2447–2453. Choi, O., and Hu, Z. Q. (2008). Size dependent and reactive oxygen species related nanosilver toxicity to nitrifying bacteria. Environ. Sci. Technol. 42, 4583–4588. Cikos, S., Bukovska, A., and Koppel, J. (2007). Relative quantification of mRNA: comparison of methods currently used for real-time PCR data analysis. BMC Mol. Biol. 8, 113–127.
N. europaea, Inhibition and Bioreactors
245
Gieseke, A., and deBeer, D. (2004). Use of microelectrodes to measure in situ microbial activities in biofilms, sediments, and microbial mats. In “Molecular Microbial Ecology Manual,” (G. A. Kowalchuk, F. de Bruijn, I. Head, A. Akkermans, and J. van Elsas, eds.). Springer, Heidelberg. Gieseke, A., Bjerrum, L., Wagner, M., and Amann, R. (2003). Structure and activity of multiple nitrifying bacterial populations co-existing in a biofilm. Environ. Microbiol. 5, 355–369. Goeres, D. M., Hamilton, M. A., Beck, N. A., Buckingham-Meyer, K., Hilyard, J. D., and Loetterle, L. R. (2009). A method for growing biofilm under low shear at the air-liquid interface using the drip flow biofilm reactor. Nat. Protoc. 4, 783–788. Gornall, A. G., Bardawill, C. J., and David, M. M. (1949). Determination of serum proteins by means of the biuret reaction. J. Biol. Chem. 177, 751–766. Groeneweg, J., Sellner, B., and Tappe, W. (1994). Ammonia oxidation in Nitrosomonas at NH3 concentrations near Km: Effects of pH and temperature. Water Res. 28, 2561–2566. Gvakharia, B. O., Permina, E. A., Gelfand, M. S., Bottomley, P. J., Sayavedra-Soto, L. A., and Arp, D. J. (2007). Global transcriptional responses of Nitrosomonas europaea to chloroform and chloromethane. Appl. Environ. Microbiol. 73, 3440–3445. Gvakharia, B. O., Bottomley, P. J., Arp, D. J., and Sayavedra-Soto, L. A. (2009). Construction of recombinant Nitrosomonas europaea expressing green fluorescent protein in response to co-oxidation of chloroform. Appl. Microbiol. Biotechnol. 82, 1179–1185. Hunik, J. H., Meijer, H. J. G., and Tramper, J. (1992). Kinetcs of Nitrosomonas europaea at extreme substrate, product and salt concentrations. Appl. Environ. Microbiol. 37, 802–807. Hyman, M. R., and Arp, D. J. (1992). 14C2H2-labeling and 14CO2-labeling studies of the de novo synthesis of polypeptides by Nitrosomonas europaea during recovery from acetylene and light inactivation of ammonia monooxygenase. J. Biol. Chem. 267, 1534–1545. Kindaichi, T., Kawano, Y., Ito, T., Satoh, H., and Okabe, S. (2006). Population dynamics and in situ kinetics of nitrifying bacteria in autotrophic nitrifying biofilms as determined by real-time quantitative PCR. Biotechnol. Bioeng. 94, 1111–1121. Kowalchuk, G. A., and Stephen, J. R. (2001). Ammonia-oxidizing bacteria: A model for molecular microbial ecology. Annu. Rev. Microbiol. 55, 485–529. Lauchnor, E. G., Radniecki, T. S., and Semprini, L. (2011). Biofilms of Nitrosomonas europaea exposed to phenol and toluene. Biotechnol. Bioeng. 108, 750–757. Lide, D. R. (1996). CRC Handbook of Chemistry and Physics. CRC Press, Boca Raton. Livak, K. J., and Schmittgen, T. W. (2001). Analysis of relative gene expression data using real-time quantitative PCR and the 2-DDCt method. Methods 25, 402–408. Mobarry, B. K., Wagner, M., Urbain, V., Rittmann, B. E., and Stahl, D. A. (1996). Phylogenetic probes for analyzing abundance and spatial organization of nitrifying bacteria. Appl. Environ. Microbiol. 62, 2156–2162. Moussa, M. S., Garcia-Fuentes, O., Lubberding, H. J., Hooijmans, C. M., van Loosdrecht, M. C. M., and Gijzen, H. J. (2006). Nitrification activities in full-scale treatment plants with varying salt loads. Environ. Technol. 27, 635–643. Murphy, D. (2002). Gene expression studies using microarrays: Principles, problems and prospects. Adv. Physiol. Educ. 26, 256–270. Park, S., and Ely, R. L. (2008a). Candidate stress genes of Nitrosomonas europaea for monitoring inhibition of nitrification by heavy metals. Appl. Environ. Microbiol. 74, 5475–5482. Park, S., and Ely, R. L. (2008b). Genome-wide transcriptional responses of Nitrosomonas europaea to zinc. Arch. Microbiol. 189, 541–548. Park, S., and Ely, R. L. (2009). Whole-genome transcriptional and physiological responses of Nitrosomonas europaea to cyanide: Identification of cyanide stress response genes. Biotechnol. Bioeng. 102, 1645–1653.
246
Tyler S. Radniecki and Ellen G. Lauchnor
Peirson, S. N., Butler, J. N., and Foster, R. G. (2003). Experimental validation of novel and conventional approaches to quantitative real-time PCR data analysis. Nucleic Acids Res. 31, e73. Radniecki, T. S., and Ely, R. L. (2011). Transcriptional and physiological responses of Nitrosococcus mobilis to copper exposure. J. Environ. Eng. ASCE (in press). Radniecki, T. S., Dolan, M. E., and Semprini, L. (2008). Physiological and transcriptional responses of Nitrosomonas europaea to toluene and benzene inhibition. Environ. Sci. Technol. 42, 4093–4098. Radniecki, T. S., Semprini, L., and Dolan, M. E. (2009a). Expression of merA, amoA and hao in continuous cultured Nitrosomonas europaea exposed to zinc chloride. Biotechnol. Bioeng. 102, 546–553. Radniecki, T. S., Semprini, L., and Dolan, M. E. (2009b). Expression of merA, amoA, hao and trxA in continuous cultured Nitrosomonas europaea exposed to cadmium sulfate. Biotechnol. Bioeng. 104, 1004–1011. Radniecki, T. S., Gilroy, C. A., and Semprini, L. (2011). Linking NE1545 expression with decreases in cell diameter in Nitrosomonas europaea cells exposed to aromatic hydrocarbons. Chemosphere 82, 514–520. Schulze, A., and Downward, J. (2001). Navigating gene expression using microarrays—A technology review. Nat. Cell Biol. 3, E190–E195. Skern, R., Frost, P., and Nilsen, F. (2005). Relative transcript quantification by Quantitative PCR: Roughly right or precisely wrong? BMC Mol. Biol. 6, 10–12. Stein, L. Y., Arp, D. J., and Hyman, M. R. (1997). Regulation of the synthesis and activity of ammonia monooxygenase in Nitrosomonas europaea by altering pH to affect NH3 availability. Appl. Environ. Microbiol. 63, 4588–4592. Suzuki, I., Dular, U., and Kwok, S. C. (1974). Ammonia or ammonium ion as substrate for oxidation by Nitrosomonas europaea cells and extracts. J. Bacteriol. 120, 556–558. U.S.EPA (1993). Process Design Manual: Nitrogen Control. U.S. Environmental Protection Agency, Washington, DC. Underhill, S. E., and Prosser, J. I. (1987). Inhibition and stimulation of nitrification by potassium ethyl xanthate. J. Gen. Microbiol. 133, 3237–3245. Yu, R., Kampschreur, M. J., Van Loosdrecht, M. C. M., and Chandran, K. (2010). Mechanisms and specific directionality of autotrophic nitrous oxide and nitric oxide generation during transient anoxia. Environ. Sci. Technol. 44, 1313–1319.
C H A P T E R
T E N
Nitrification of Raw or Used Water Using Expanded Bed Biofilm Reactor Technology M. J. Dempsey*,† Contents 248 248 250 250 250 252 253 255 255 256 256 257 258 259 260 261 261 262 262 262 265 266
1. Introduction 1.1. Treatment of raw or used water 1.2. Biofilm systems 1.3. Cell immobilization 1.4. EBBR technology 2. Design and Operation of EBBRs 2.1. Bioreactor design 2.2. Biomass support materials 2.3. Biofilm thickness control 2.4. Aeration 2.5. pH control 2.6. Bioreactor startup 2.7. Miniature bioreactor for bioparticle rate measurement 3. Measurement of Nitrification Performance 3.1. Measurement of inorganic nitrogen species 3.2. Measurement of pH 3.3. Measurement of dissolved oxygen (DO) 4. Typical Bioreactor and Bioparticle Performance Data 4.1. Pilot plant 4.2. Miniature EBBR 5. Conclusions References
Abstract Excessive ammonia in raw water increases the consumption of chlorine for disinfection during production of potable water, through oxidation to produce chloramines. Excessive ammonia in used water results in pollution of the aquatic * Division of Biology and Conservation Ecology School of Science and the Environment, Faculty of Science and Engineering, Manchester Metropolitan University, Manchester, UK Advanced Bioprocess Development Ltd., c/o MMU, Manchester, UK
{
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00010-5
#
2011 Elsevier Inc. All rights reserved.
247
248
M. J. Dempsey
environment, where it is particularly toxic to fish. Furthermore, nitrifying prokaryotes in the receiving water will consume dissolved oxygen equivalent to 4.6 g oxygen per g ammonia-nitrogen oxidized to nitrate. This places a considerable oxygen demand on the receiving water and can result in anoxic conditions. One solution to these problems is to nitrify the ammonia in a dedicated biological process. As nitrifiers are particularly slow growing, they are easily washed out of conventional water and wastewater treatment processes; hence, the use of immobilized biomass in an expanded bed biofilm reactor. This solution typically allows at least 10-times the biomass concentration of conventional systems, with a similar decrease in bioreactor size or increase in bioreactor productivity. This chapter describes expanded bed technology for nitrification of water, and methods for studying biomass and process performance.
1. Introduction Expanded bed biofilm reactor (EBBR) technology exploits the natural ability of microorganisms to adhere to surfaces and grow as biofilms, either as pure or mixed cultures. Pure cultures are typically used for applications in fermentation, whereas mixed cultures are typically used for water or wastewater treatment. Aside from culturing microbes in a more natural state (as biofilm), this technology allows a high concentration of biomass to be obtained. This cell concentration can be as high as 40 g/L (Fig. 10.1), which is coupled with high cell activity because of the excellent mixing (heat and mass transfer) associated with particle fluidization. The net result is a range of high rate biological processes that are either one tenth the volume of alternatives or ten times as productive. As an aside, because the biomass is a separate phase to the flowing fluid, this technology is also applicable for biocatalysis. Biomass can be grown on the support particles by recirculating a growth medium, which can then be replaced with a solution of the substrate to be converted to the product by an enzyme or enzyme pathway of the immobilized cells. In this way, there are no issues of cell harvesting for enzyme recovery and biocatalyst preparation and, therefore, all steps can take place within the aseptic environment of the bioreactor.
1.1. Treatment of raw or used water The aim of water treatment is to purify raw water so that it is suitable for potable or industrial use. Such treatment normally involves reducing the concentrations of chemical and microbial contaminants, followed by disinfection to render the water suitable for drinking or process use. Expanded bed technology can be used for reducing levels of chemical and microbial contamination, especially for the oxidation of ammonia to nitrate (nitrification), where it is a potential alternative to slow sand filtration. No health-
Specific surface area (m2 m–3)
2500
50
2000
40
1500
30
1000
20
500
10
0
0 0
1
2
3
4 5 6 7 8 Support particle diameter (mm)
9
10
Predicted biomass hold-up (kg m–3)
249
Expanded Bed Biofilm Reactor Technology
11
Specific surface area for colonisation (50 % bed expansion, m2 m–3) Predicted biomass hold-up (50 % bed expansion, g dm–3 dry wt.)
Figure 10.1 Calculated specific surface area available for colonization by microbial biofilm on spheres of diameter 1–10 mm when fluidized to give a bed expansion of 50%, together with predicted biomass concentration, assuming 0.5-mm thick biofilm containing 60% cells and 80% water content.
based guideline value has been proposed for ammonia in drinking water by the World Health Organization (WHO, 2006), because it normally occurs at concentrations well below those at which toxic effects are an issue. However, ammonia removal can be important for reasons related to disinfection with chlorine. The aim of wastewater treatment is to produce an effluent that meets legal requirements for discharge to the aquatic environment, for example, the European Community Water Framework Directive (EC, 2000) or the United States of America Federal Water Pollution Control Act (United States Senate, 2002). These legal requirements exist to protect the health of the public, as well as that of aquatic organisms. Growing legislative pressure for improved quality of treated wastewater, for example, reduced ammonia concentration, often requires installation of a new process. However, although there is a wide range of processes now available for improved wastewater treatment, many were designed at a time when sustainability was not an issue. As a result, many of these processes involve the use of a larger land area, more construction materials, increased maintenance requirements, and greater energy consumption. This is particularly true for highly aerobic processes such as tertiary nitrification. Thus, there is a pressing need for more sustainable process technologies, so that continued protection of public health and enhanced protection of the aquatic environment does not
250
M. J. Dempsey
result in increased emission of CO2 through escalating fossil fuel use. It is believed that such technologies will include the EBBR.
1.2. Biofilm systems It is now recognized that many natural microbial systems exist as mixed cultures growing as a biofilm. This fact is at odds with microbiology’s historic reductionist approach and can lead to misconceptions amongst classically trained microbiologists. Treating a biofilm community as a system requires an understanding of biofilm dynamics and kinetics. In essence, a biofilm is a continuous culture in space as well as time. In other words, gradients of substrates and products exist spatially within a biofilm, just as they do temporally in a conventional batch culture. Generally, the rate of substrate consumption in a biofilm is higher than suspension cultures of the same cells, owing to a significantly higher cell density in the biofilm. This results in a zone of substrate depletion above the biofilm surface, the so-called “boundary layer”, as well as penetration into the biofilm being limited to 100–120 m (de Beer et al., 1993). For this reason, the biofilm in an expanded bed ought to be limited to about this thickness.
1.3. Cell immobilization Atkinson and Knights (1975) were amongst the first to formally demonstrate the benefits of immobilized cell systems for biological process intensification, and the idea of biomass support particles (BSPs) was developed later at UMIST, Manchester (Atkinson et al., 1980). These workers identified reticulated polyurethane foam in the form of cuboids as a suitable BSP material, using bioreactors generally configured as moving beds. Around the same time as the development of BSPs, Jeris et al. (1977) demonstrated BOD (organic matter) and nitrogen removal from settled sewage using fluidized bed technology, initially with activated carbon but later with silica sand as a cheaper biomass support medium.
1.4. EBBR technology Expanded bed biofilm technology uses small (typically 1 mm) BSPs (“media”) that are suspended by vertical fluid flow. The flow rate is such that the drag force overcomes the force of gravity (or buoyancy) on individual particles, which become separated from each other. Consequently, they are suspended in the fluid flow, the particles become fluidized and the bed expands (Fig. 10.2). The particles are in continual relative motion but are not transported by the fluid, which passes through the bed at a relatively high superficial velocity (typically, 1 cm/s). Ideally, the fluid
251
Expanded Bed Biofilm Reactor Technology
Static bed
Zero to low flow
Fluidized bed
Expanded bed
Medium flow
High flow
Figure 10.2 Transition from static to expanded to fluidized bed as upward flow velocity is increased. (Black circles represent bioparticles, at enlarged scale with respect to column diameter.)
passes through in plug-flow mode with minimal back-mixing, although most systems have some degree of recycle to maintain the vertical velocity and, hence, degree of bed expansion. The fluid may be a gas or a liquid. With liquid fluidization, the liquid flow is downward for buoyant particles (Arnaiz et al., 2003) and upward for nonbuoyant ones (Heijnen and Enger, 1985). The nitrification system described here uses nonbuoyant particles and, therefore, upflowing water. Adhesive microorganisms attach to the BSPs and grow as a biofilm (cell immobilization), which completely embeds the support (Fig. 10.3). These “particulate biofilms” (Nicolella et al., 2000) can be pure or mixed cultures. For example, Zymomonas mobilis or Saccharomyces cerevisiae for ethanol production (Dempsey et al., 1986); or a mixed community of heterotrophic bacteria, autotrophic nitrifying bacteria, protozoa, rotifers, nematode, and oligochaete worms for tertiary treatment of wastewater (Dempsey et al., 2006). Sometimes, airlift and moving bed bioreactors are erroneously referred to as “fluidized beds”. However, in neither system are the media particles fluidized in the true sense, as they are not suspended by vertical fluid flow. With airlift, they are carried with the internal recirculation flow; whereas in moving bed biofilm reactors (MBBRs), the media particles are carried in the horizontal flow. This means that there is little relative motion between the media and wastewater in either system; unlike in a true expanded or fluidized bed, where there is considerable relative motion (typically 30–50 m h 1).
252
M. J. Dempsey
A
C
B
D
Figure 10.3 (A) Scanning electron micrograph (SEM) of glassy coke particle, showing pores (bar marker 50 mm). (B) SEM of glassy coke particle colonized by nitrifying biofilm, which has cracked to reveal coke surface (bar marker 200 mm). (C) Fluidized bioparticles in expanded bed, each bioparticle is approximately 1 mm in diameter. (D) Light micrograph of bioparticles, approximately 1 mm in diameter. Note the feathery growths from the biofilm surface, which are stalked protozoa, rotifers, or protozoan stalks colonized by bacteria.
2. Design and Operation of EBBRs A generalized bioreactor design for true particle fluidization is shown schematically in Fig. 10.4. Photographs of laboratory, technical, pilot, and fullscale reactors built to this design are shown during use in Fig. 10.5. Particle fluidization starts when the upward drag force overcomes gravity and the particles become suspended; the bed then occupies a larger volume and becomes expanded. By suspending the particles, the entire surface area is exposed to the flowing water, unlike in a packed bed where a significant fraction is unavailable where the particles touch. Fluidization also increases the efficiency of treatment by improving mass transfer, as there is significant relative velocity between the biofilm and the water. Because of the balance of forces involved in particle fluidization and bed expansion, the smallest particles migrate to the top and the largest to the bottom. Therefore, the media particles should be graded to a relatively tight size range, for example, 1 0.2 mm, which can be an expensive process. Nevertheless, as naturally occurring materials are recommended, the support material is still relatively cheap.
253
Expanded Bed Biofilm Reactor Technology
g
e
d h
f c
b
a
Figure 10.4 Shematic diagram of expanded bed biofilm reactor layout: (a) feed pump, (b) fluidizing (recirculation) pump, (c) nonreturn valve (e.g., glass ball), (d) expanded bed column, with reducers at each end to allow attachment of tubing, (e) aeration device, (f) air inlet, (g) outlet for treated water and waste gas, and (h) bioparticle recycle. A
B
C
D
Figure 10.5 Photographs of (A) laboratory scale (0.0002 m3), (B) technical scale (0.01 m3), (C) pilot scale (0.6 m3), and (D) full scale (9 m3) expanded bed biofilm reactors for nitrification and tertiary treatment of municipal wastewater.
2.1. Bioreactor design Fluidization of particles is achieved in a vertical column that is normally narrower than it is long. Chemical engineering textbooks normally deal with gas-fluidized systems, where the recommended aspect ratio is typically
254
M. J. Dempsey
10:1 (height:width). However, with liquid-fluidized systems, a smaller aspect ratio can be used. In fact, with a fractal distributor at the bottom and a fractal collector at the top, the aspect ratio can be reduced to 1:2 (Rearick et al., 1999). Unfortunately, current designs of fractal distributor can become blocked with debris in wastewater. In the lab and at technical scale, an aspect ratio of about 10:1 is normally used; whereas at pilot scale, 6:1, and at full scale, 4:1, have been demonstrated to work; the key to a small aspect ratio being the design of the liquid inlet distributor, which is often kept confidential for commercial reasons. Lab- and technical-scale systems were constructed from process glassware (e.g., QVF), although this limits the design to readily available components. Nevertheless, using such glassware allows a robust bioreactor to be constructed and the use of autoclaving or free-steaming if sterilization is necessary. For lab-scale bioreactors, a 50-cm long by 2.5 cm diameter pipe sections was used. This was clad with a 40-cm long by 5 cm diameter pipe section as a water jacket for temperature control, using silicone rubber strips and sealant at either end (Fig. 10.6). Water was circulated through the jacket via silicone rubber tubing that passed through the upper seal, with the inlet tubing reaching to the bottom of the jacket but the outlet tubing ending flush with the base of the upper seal. In this way, any gas bubbles were expelled from the jacket. For long-term use, a biocide can be added to the circulating water, to prevent fouling of the water jacket, which would otherwise obscure the bioparticles within the column. Ideally, a thermocirculator with an external temperature sensor located in the bioreactor is used, to ensure that the required process temperature is maintained. The column ends are finished with straight or 90 hose connectors, for ease of plumbing. A glass ball of suitable diameter (e.g., a child’s “marble”) is used as a nonreturn valve at the base of the column. This is pushed upward
Figure 10.6 Detail of silicone rubber strips and sealant seal between outer jacket and inner column of QVF lab-scale expanded bed column.
255
Expanded Bed Biofilm Reactor Technology
by the inlet flow but seals the base of the column against bioparticles flowing down the inlet pipe should the flow fail or need to be turned off. It does not, however, provide a perfect liquid seal.
2.2. Biomass support materials An ideal biomass support material should be porous and relatively light. Porous so that microorganisms can attach easily to form an enveloping biofilm, and light so that the upward velocity for fluidization is not too high, to minimize energy costs. The initial material used was activated carbon ( Jeris et al., 1974), which was discovered to be a suitable biomass support material in an earlier physicochemical adsorption process for removing residual pollutants from wastewater after initial biological treatment. However, this expensive material was soon replaced by cheaper sand (Tanaka et al., 1981), although an improved material has been introduced more recently, glassy coke (Fig. 10.3A). Glassy coke (Dempsey, 2003) is prepared by washing, drying, and sieving twice, to obtain particles of about 1 mm (Fig. 10.7), which is available commercially from the author as ABDite.
2.3. Biofilm thickness control Water leaving the top of the column will contain entrained bioparticles once the bioreactor has been in operation for some time and the bed has expanded to 100%, owing to biofilm growth. It may even contain entrained 70
Mass fraction (%)
60 50 40 30 20 10 0 <0.25
0.25–0.50
0.5–0.7 0.7–1.0 Size class (mm)
1.0–1.4
>2.0
Figure 10.7 Size distribution of commercially available glassy coke (ABDiteÒ), showing majority of particles in the size range 0.7–1.4 mm.
256
M. J. Dempsey
bioparticles beforehand, caused by floating after attachment of gas bubbles. These bioparticles can be separated from the recirculating water and returned to the base of the expanded bed using, for example, a pinchvalve system operated using a pair of cyclic timers (Dempsey et al., 1986). This system prevents bioparticles from passing through the fluidizing pump (Fig. 10.5). It also achieves control of biofilm thickness and, therefore, also controls the height and volume of the expanded bed. Despite the size and mass of the glass ball nonreturn valve, bioparticles are able to pass around it as it lifts with the inlet flow, and reenter the expanded bed column. With larger systems (technical scale to full scale), a separate bioparticle recycle line can be used at the point for bed height control, with an eductor pump to suck bioparticles from the top of the bed and reinject them into the base of the expanded bed (Dempsey, 2007).
2.4. Aeration Oxygen for the nitrifying bacteria can be supplied by a variety of means, all of which are designed to prevent gas bubbles passing through the expanded bed column where the turbulence caused by their passage can cause detachment of biofilm. For example, at lab scale, aeration can be achieved using a stirred tank through which the water is recirculated from the top to the bottom of the expanded bed. Alternatively, a bubble column can be employed in parallel with the expanded bed column, where the water flows down and becomes aerated by air bubbles passing up. A similar, counter-current, system has been used successfully at technical, pilot, and full scales. However, at larger and full scales, it was necessary to use oxygendepleted air from a pressure-swing “oxygen generator” (pilot: OG-50, OGSI, North Tonawanda, NY, USA; full: 01, Gazcon, Lyngby, Denmark), so that the oxygen demand of the high concentration of active bacteria in the biofilm could be satisfied. At lab and technical scales, such technology was not used as a suitably small generator was not available. Instead, the performance of bioreactors at this scale was restricted by oxygen limitation at the top of the bed. Although a counter-current bubble column has been used for aeration at pilot and full scales, it is feasible to replace such technology with alternatives, such as a static mixer to dissolve oxygen in a by-pass.
2.5. pH control Nitrification of water results in its acidification, owing to proton release during hydrolysis of hydroxylamine, the second step in the oxidation of ammonia to nitrite. During tertiary treatment of municipal wastewater, when the ammonia concentration is low (<25 mg/L), the fall in pH can be up to 1 unit in soft water areas, from about 7 to about 6. This is normally
Expanded Bed Biofilm Reactor Technology
257
acceptable for discharge to receiving waters, although advice should be sought from the relevant environmental protection agency. However, when the ammonia concentration is higher (800–1200 mg/L), as in sludge dewatering liquor (“filtrate” or “centrate”), the pH can fall as low as 5, which results in process inhibition. Under such circumstances, pH control is required and an alkali, such as 1 mol L 1 NaOH, can be used. For raw water treatment, the necessity for alkali addition, and its nature, should be approved by the relevant drinking water regulator.
2.6. Bioreactor startup For operation at laboratory scale with a known species or community of nitrifying Bacteria or Archaea, it is best to sterilize the bioreactor and biomass support material. If the bioreactor is small enough, this is most easily achieved by autoclaving with the support particles in place and the system partially filled with water or growth medium, so that entrapped gas is expelled from the bioparticles and they sink. Alternatively, sterilization can be achieved by steaming or with an easily flushed biocide with limited environmental impact, such as a solution of hypochlorite bleach. Clearly, if a disinfectant is used, the bioreactor must be flushed out with sterile water or growth medium before inoculation with the process microbes. If raw or used water is the source of feed as well as inoculum, so that sterilization of the bioreactor and feed might not be essential, the fact that some of the porous BSPs will float means that some means of releasing trapped gas is required. This can be achieved at small scale by autoclaving the particles under water and transferring them to the bioreactor, without exposure of the particles to air. Alternatively, a polar, water-miscible solvent, such as ethanol, or an aqueous surfactant solution can be used to release the gas in situ. Once the gas is released, this liquid can be displaced with water or growth medium, taking care that the particles are not exposed to air during the process, to avoid the pore-space liquid being replace by air and the particles becoming buoyant again. The initial charge of particles should fill 30% of the expanded bed column (Fig. 10.5) as a static bed, and if not yet completely filled with liquid, the bioreactor should be filled with growth medium, raw, or used water. The recirculation pump is started and the flow rate increased to expand the bed to fill 50% of the reactor. If the bioreactor has been sterilized and sterile feed (e.g., a synthetic nitrification medium; Van Niel et al., 1993) is to be used, the system must be inoculated with the chosen microorganism(s). If raw or used water is to be nitrified, inoculation may not be required if the feed water contains sufficient nitrifying microorganisms. Once inoculated, the system should be left in batch culture for 24–48 h. This allows the inoculum to grow, attach to the fluidized particles, and start to form a biofilm. Once biofilm formation is observed, feeding should be initiated
258
M. J. Dempsey
at a dilution rate equivalent to at least 80% of the microbes’ maximum growth rate (mmax for Nitrosomonas europea, one of the fastest-growing ammonia oxidizing bacteria, is approximately 0.1 h 1), so that planktonic cells are washed out and a selection pressure is exerted for attached growth (biofilm). For laboratory use, it is often found that the feed consumption rate exceeds the rate at which it can be prepared, owing to the high concentration of active biomass that becomes established. In which case, it is possible to make concentrated feed (which may not need sterilization) and dilute it immediately before use with clean but not necessarily sterile water. (The requirement for sterilization will depend on the nature of the experimental work.) Starting with a static bed that fills 30% of the column; the vertical flow velocity is chosen to expand the bed to its initial height, typically 50% of the available height. Microorganisms attach to the media particles and grow to form a biofilm. This results in an increase in particle size and a decrease in composite particle (bioparticle) density. Thus, despite any initial differences in density, all biomass support media tend toward a similar specific gravity (approximately 1.1) as the biofilm thickness increases (Atkinson et al., 1981). Because of the size increase and density decrease, the bed continues to expand until it reaches full design height, at which point biofilm thickness must be controlled as explained above.
2.7. Miniature bioreactor for bioparticle rate measurement A miniature bioreactor has been developed for measurement of the maximum nitrification rate of bioparticles in the absence of either oxygen or ammonia limitation (Dempsey et al., 2009). This system is only for measuring the activity of bioparticles, it is an open system and so not suitable for experiments lasting more than a few hours. Harvested bioparticles were suspended in “full medium” and incubated under “standard conditions,” which were based on an International Standard (ISO-15522, 1989). This expanded bed was in a plastic tip designed for 1-mL automatic pipetters (Fig. 10.8). It contained bioparticles harvested from an operational expanded bed equivalent to a 0.5-mL static bed, which was expanded to 1.0 mL by controlling the upward flow velocity of “full medium” using a variable-speed peristaltic pump (Fig. 10.8). The “full medium” was held in a reservoir constructed from a 20-mL syringe barrel, using the Luer fitting at the base as the feed outlet. Aeration of the “full medium” was achieved by pumping air through a fine-tipped (“50-dropper”) plastic pipette with its bulb cut off. The tip of this pipette was submerged in the reservoir of “full medium”. In order to minimize variation between samples and controls through potential airstripping of ammonia, the air flow rate was set to be the same for each reactor system by using a variable area flow meter (Platon LGX). Samples
259
Expanded Bed Biofilm Reactor Technology
e d f
c
a
b
Figure 10.8 Arrangement of four miniature expanded bed biofilm reactors: (a) reservoir for “full medium” (see text) and its aeration; (b) multichannel, peristaltic pump head (Watson Marlow 505LA) on variable speed peristaltic pump (Watson Marlow 505S); (c) inlet tubing to base of expanded bed; (d) expanded bed (1 mL plastic pipette tip); (e) exit tubing from top of expanded bed to feed reservoir; (f) air line, to supply oxygen to “full medium”. Inset: detail from top of expanded bed (pipette tip), showing attachment of exit tubing, and bioparticle bed in expanded state; note centimeter scale on ruler to right hand side.
for measurement of ammonia, nitrite, and nitrate concentration were withdrawn from the reservoir at intervals of 15–30 min for 3–4 h, depending on the actual rate of nitrification.
3. Measurement of Nitrification Performance Normally, the performance of nitrification systems is determined by measuring the reduction in ammonia concentration between the process influent and effluent. This change in concentration, coupled with the volumetric flow rate (L/L/d; m3/m3/d) can be used to calculate the volumetric rate of ammonia oxidation (often referred to as the “ammonia removal rate”; which is erroneous, as the ammonia is oxidized rather then “removed”). Other measures can include the change in nitrate concentration, to demonstrate that complete nitrification has occurred. But, ideally, the nitrite concentrations are also measured, so that a better nitrogen mass balance can be calculated: the inlet concentration of nitrogen (as ammonia, nitrite, and nitrate) should equal the outlet concentration. However, such a
260
M. J. Dempsey
simplistic mass balance does not take account of other forms of nitrogen, either inorganic or organic, that may be present in the influent and may be nitrified in the treatment process. Neither does it account for nitrogen assimilated into biomass, although this is likely to be a relatively small fraction owing to the slow growth rate of nitrifying bacteria. Furthermore, it does not account for internal nitrogen cycling within the frequently complex microbial community likely to develop in field-based reactors (Dempsey et al., 2006). For example, nitrogen assimilated by protozoa from bacteria in the influent and excreted within the reactor as ammonia that is nitrified without appearing in the inlet analysis. Clearly, a comprehensive nitrogen mass balance is difficult to achieve for such systems.
3.1. Measurement of inorganic nitrogen species The concentrations of ammonia, nitrite, and nitrate can be measured using a variety of techniques, for example, manual or continuous-flow spectrophotometric assays and ion chromatography. Wherever possible, internationally recognized standard methods should be employed, unless local regulators stipulate some other method. 3.1.1. Sample preparation Samples of EBBR influent and effluent were filtered (25-mm Cronus syringe filter FPNN2545: 0.45-mm pore nylon membrane with glass fiber prefilter, Lab Hut, Gloucester, UK) before transport to the laboratory for chemical analysis. This treatment is designed to remove microorganisms that might change the sample during transit or pose a health risk to laboratory workers. 3.1.2. Ammonia ISO-7150-1 (1984): Colourimetric measurement at 655 nm of the blue– green compound formed by reaction of ammonium with salicylate and hypochlorite ions in the presence of sodium nitrosopenta-cyanoferrate (III)—alternative name, sodium nitroprusside. 3.1.3. Nitrite ISO-6777 (1984): Colourimetric measurement at 540 nm of the pink azo dye formed by reaction of nitrite with 4-aminobenzene sulphonamide in the presence of orthophosphoric acid to form a diazonium salt, which reacts with N-(1-naphtyl)-1, 2-diamoethane dihydrochloride.
Expanded Bed Biofilm Reactor Technology
261
3.1.4. Nitrate APHA 4500: American Public Health Association UV absorbance method for examination of water and wastewater, based on the measurement of absorption at 220 (nitrate) and 275 nm (nitrate þ organic matter), using HCl (1 mol/l) to reduce interference from hydroxide and carbonate ions. 3.1.5. Ion chromatography NH4þ–N, NO2–N, NO3–N and other ions (Dionex ICS-2000, AS18 separation column with an AG18 guard column for anions, and CS16 separation column and a CG16 guard column for cations).
3.2. Measurement of pH In addition to monitoring performance from measuring inorganic nitrogen species, other measures of nitrification activity can be used. In particular, the fall in pH of the process effluent compared to the influent. In fact, this can make a reliable online measurement for process monitoring, which does not require the use of reagents or expensive equipment. However, the problem of sensor fouling with adhesive nitrifying bacteria can be an issue: the sensor surface will be at the base of the fouling layer, so the measured pH will be lower than the bulk pH, owing to nitrification releasing protons within the biofilm. This problem can be minimized by using a “cleaning in place” system.
3.3. Measurement of dissolved oxygen (DO) Monitoring oxygen consumption can also provide useful process information, especially as nitrification consumes far more oxygen than other metabolic processes. From the stoichiometry of microbial nitrification, 4.6-mg O2 are consumed per mg ammonia-nitrogen oxidized to nitrate (Daigger et al., 1994); whereas a maximum of 1.5-mg O2 are consumed in the oxidation of carbon compounds, assuming complete oxidation of any that is temporarily stored by the cells. However, oxygen is also consumed by other organisms in the bioreactor, unless the system was sterilized before use and inoculated with known pure cultures of nitrifyers. Nevertheless, monitoring oxygen consumption from the air flow rate (assuming automatic control of DO concentration) and the degree of removal from the inlet gas (air or oxygen-enriched/nitrogendepleted air) provides valuable, online information, particularly as gas-phase sensors (e.g., AutoO2, City Tech, UK) eliminate problems of sensor fouling, as they are not in contact with the process liquid (i.e., the microbial culture). DO concentrations can also be used to monitor performance. In fact, a DO sensor immersed above the top of the bed is used at pilot and full scales to control the aeration rate so that the oxygen transfer rate in the aeration system matches the oxygen consumption rate of the biomass in the expanded bed.
262
M. J. Dempsey
In this way, energy consumption for aeration is minimized and better process control can be achieved. Sensors based on the new luminescent dissolved oxygen (LDO) technology are suitable in most cases; except where the DO concentration exceeds 20 mg/L, which is an issue when measuring in the aeration system if oxygen-rich air is used. This appears to be a fundamental feature of LDO technology, owing to the light intensity of the feedback response decreasing with increasing DO concentration, and therefore, older types of sensor that can measure concentrations > 20 mg/L have to be used, for example, galvanic or polarographic sensors.
4. Typical Bioreactor and Bioparticle Performance Data Example performance data from different scales of EBBR operation are presented in this section.
4.1. Pilot plant A pilot plant for tertiary nitrification of activated sludge final (settled) effluent has been in almost constant operation at a municipal wastewater treatment works in the UK since 2003. During Summer 2009, it was out of operation for several weeks, so that maintenance could be carried out on the feed and fluidizing (recirculation) pumps. The process was monitored on an almost daily basis for 14 weeks following restart, including the recovery of biomass concentration, which took 2 weeks (Fig. 10.9); the inlet and outlet ammonia concentrations; and feed rate of activated sludge final (settled) effluent (process influent), as summarized in Fig. 10.10. During this period, the rate of ammonia oxidation (“nitrification rate”) was found to increase slowly for a period of about 4 weeks, while at the same time the feed rate was increased (decreasing recycle ratio ¼ feed flow rate/recirculation flow rate), as shown in Fig. 10.11. The absolute dependence of ammonia oxidation on the supply of DO was clearly demonstrated when the air compressor failed. As soon as all the DO was consumed, the pH rose because no more acid was being liberated by the cells (Fig. 10.12). This observation also clearly shows the useful information about process performance that is provided by constant monitoring of the process effluent pH.
4.2. Miniature EBBR When using the mini-EBBRs for measuring the nitrification rate of bioparticles harvested from operational systems (lab or field), it was found that replicate samples of bioparticles demonstrated similar rates, whereas controls
263
Expanded Bed Biofilm Reactor Technology
Estimated biomass concentration (kg VSS m–3 EBBR)
50 45 40 35 30 25 20 15 10 5 0 0
7
14 21 28 35 42 49 56 63 70 77 84 91 98 Time (days)
Figure 10.9 Recovery of biomass concentration in pilot-plant expanded bed biofilm reactor following several weeks shutdown for maintenance of feed and fluidizing (recirculation) pumps. 20
4.5 Inlet mg / L
Outlet mg / L
Influent flow rate (m3 / h)
18
4.0 3.5
14
3.0
12 2.5 10 2.0 8 1.5
6
ASFE flow rate (m3 h–1)
NH3-N conc. (mg L–1)
16
1.0
4
0.5
2 0
0.0 0
7
14
21
28
35
42 49 56 Time (days)
63
70
77
84
91
98
Figure 10.10 Performance of pilot plant for tertiary treatment of activated sludge final (settled) effluent (mainly nitrification but also removal of organic matter [CBOD], suspended solids [TSS] and bacteria), showing inlet and outlet ammonia concentrations and influent feed rate during 14 weeks operation following restart after major maintenance to feed and fluidizing (recirculation) pumps.
without bioparticles or with bioparticles but in the presence of a specific inhibitor of ammonia oxidation (allylthiourea) demonstrated a much lower rate of ammonia loss (Fig. 10.13). Ammonia loss from the controls possibly being due to volatilization during aeration or through assimilation by other
264
M. J. Dempsey
20
1.0 Nitrification rate
18
0.9
16
0.8
14
0.7
12
0.6
10
0.5
8
0.4
6
0.3
4
0.2
2
0.1
0
Nitrification rate (kg NH3-N m–3 d–1)
Recirculation ratio
Recirc ratio
0.0 0
7
14
21
28
35
42 49 56 Time (days)
63
70
77
84
91
98
Figure 10.11 Performance of pilot plant for tertiary treatment of activated sludge final (settled) effluent (mainly nitrification but also removal of organic matter [CBOD], suspended solids [TSS] and bacteria), showing volumetric ammonia oxidation rate and recycle ratio during 14 weeks operation following restart after major maintenance to feed and fluidizing (recirculation) pumps.
7.5 DO_top% pH_top pH
4
7.3
3
7.1
2
6.9
1
6.7
pH
Dissolved oxygen concentration (mg/L)
5
0
6.5 00
02
04
06
08
10 12 14 16 Clock time (h)
18
20
22
00
Figure 10.12 Failure of ammonia oxidation in pilot plant, following failure of air compressor, showing rapid rise in pH following rapid decline in dissolved oxygen concentration.
microorganisms in the biofilm. Whatever the reason for this loss, its rate was subtracted from that measured for uninhibited bioparticles to give a corrected rate, as it was assumed that a similar loss also occurred in the test incubations.
265
Expanded Bed Biofilm Reactor Technology
Ammoniacal-N conc. (mg / L)
60 55 50 45 40 35 30 0
30
60
90
Control Replicate 1 Replicate 3 Linear (Replicate 1) Linear (Replicate 3)
120 Time (min)
150
180
210
240
Sample + inhibitor Replicate 2 Linear (Control) Linear (Replicate 2) Linear (Sample + inhibitor)
Figure 10.13 Ammonia oxidation (“nitrification”) rate of bioparticles harvested from pilot plant for tertiary treatment of activated sludge final (settled) effluent, when incubated in mini-EBBR reactors. “Control”, bioparticle free; “Sample þ inhibitor”, bioparticles in presence of allylthiourea (a specific inhibitor of ammonia oxidation); “Replicate 1–3”, three samples of bioparticles in separate mini-EBBRs. All incubations were in “full medium” at 20 C, as described in Section 5.9 of ISO-15522 (1989).
5. Conclusions
Reasons for nitrification of raw and used water have been outlined, with recommendations to discuss local requirements with the relevant national regulatory authorities. A brief history of cell immobilization and the development of the EBBR concept have been given, to set the technology in context. A generic design for EBBRs has been described, together with specific details for construction of laboratory scale and miniature systems: the former for experimental work to develop robust and reliable processes and the latter for measuring the maximum rate of nitrification in the absence of substrate limitation by bioparticles harvested from operational systems, so that process performance can be judged. Operation of EBBRs at all scales has been outlined, together with suggestions for process monitoring, instrumentation, and control. Where available, ISO methods have been recommended, with the advice that any relevant local regulations about methods should also be observed.
266
M. J. Dempsey
During development of this technology, it was found that process performance at lab scale improved when activated sludge final effluent was used compared to synthetic wastewater. Operation at technical, pilot, and full scales was only conducted at wastewater treatment sites, using real wastewater. Here, the scale of operation did not produce significantly different rates of nitrification. Construction of bioreactors was generally easier at larger scale, owing to the ability to make equipment to specified designs rather than having to use standard components, as was necessary at technical and lab scales. Future work is planned to investigate the composition of the biofilm community, using molecular biological techniques. This will demonstrate whether there is a stable community or whether it changes with varying conditions, such as temperature, rainfall, or time of year. Although the use of the EBBR for nitrification has been the focus of this chapter, it must be emphasized that this technology can also be applied in other areas; such as biocatalysis, fermentation, and bioremediation.
REFERENCES Arnaiz, C., Buffiere, P., Elmaleh, S., Lebrato, J., and Moletta, R. (2003). Anaerobic digestion of dairy wastewater by inverse fluidization: The inverse fluidized bed and the inverse turbulent bed reactors. Environ. Technol. 24, 1431–1443. Atkinson, B., and Knights, A. J. (1975). Microbial film fermenters—Present and future applications. Biotechnol. Bioeng. 17, 1245–1267. Atkinson, B., Black, G. M., and Pinches, A. (1980). Process intensification using cell support systems. Process Biochem. 15, 24. Atkinson, B., Black, G. M., and Pinches, A. (1981). The characteristics of solid supports and biomass support particles when used in fluidised beds. Biological Fluidized Bed Treatment of Water and Wastewater. In “Biological Fluidized Bed Treatment of Water and Wastewater,” (P. F. Cooper and B. Atkinson, eds.), pp. 75–111. Ellis Horwood for Water Research Laboratory, Stevenage Laboratory, Chichester. Daigger, G. T., Heinemann, T. A., Land, G., and Watson, R. S. (1994). Practical experience with combined carbon oxidation and nitrification in plastic media trickling filters. Water Sci. Technol. 29, 189–196. de Beer, D., van den Heuvel, J. C., and Ottengraf, S. P. P. (1993). Microelectrode measurements of the activity distribution in nitrifying bacterial aggregates. Appl. Environ. Microbiol. 59, 573–579. Dempsey, M. J. (2003). US6572773 Nitrification process. Dempsey, M. J. (2007). US 7 309 433 Fluid bed expansion and fluidisation. Dempsey, M. J., Black, G. M., and Atkinson, B. (1986). Natural immobilization of adhesive microorganisms in a solid support, fluidized bed fermenter for the continuous production of ethanol. In “Process Engineering Aspects of Immobilised Cell Systems,” (B. Atkinson, G. M. Black, and C. Webb, eds.), pp. 246–252. Inst. Chemical Engineers, Rugby (UMIST, Manchester, UK, 1984). Dempsey, M. J., Porto, I., Mustafa, M., Rowan, A. K., Brown, A., and Head, I. M. (2006). The expanded bed biofilter: Combined nitrification, solids destruction, and removal of bacteria. Water Sci. Technol. 54, 37–46.
Expanded Bed Biofilm Reactor Technology
267
Dempsey, M. J., Akhidime, I. D., Byrom, S., Guipponi, M., and Brazzorrotto, D. (2009). In Measurement of Microbial Activity in Biofilms from Expanded Bed Bioreactors. Biofilm processes: fundamentals to applications, IWA. Davis, CA, USA. EC (2000). Directive 2000/60/EC of the European Parliament and of the Council establishing a framework for the Community action in the field of water policy. E. Union (ed.), (2000). (Brussels). Heijnen, J. J., and Enger, W. A. (1985). Biological treatment of industrial waste-water in a 2-stage anaerobic fluidized-bed reactor. Water Sci. Technol. 17, 1487. ISO-15522 (1989). Section 5.9 Method for assessing the inhibition of nitrification of activated sludge micro-organisms by chemicals and waste waters. ISO-6777 (1984). Water quality — Determination of nitrite — Molecular absorption spectrometric method. ISO-7150-1 (1984). Water quality-Part 2: Physical, chemical and biochemical methodsAmmonium Section 2.11 Determination of ammonium: manual spectrometric method. Jeris, J. S., Beer, C., and Mueller, J. A. (1974). High-rate biological denitrification using a granular fluidized-bed. J. Water Pollut. Control Fed. 46, 2118–2128. Jeris, J. S., Owens, R. W., Hickey, R., and Flood, F. (1977). Biological fluidized-bed treatment for BOD and nitrogen removal. J. Water Pollut. Control Fed. 49, 816–831. Nicolella, C., van Loosdrecht, M. C. M., and Heijnen, S. J. (2000). Particle-based biofilm reactor technology. Trends Biotechnol. 18, 312–320. Rearick, D. E., Costesso, D. D., and Kearney, M. M. (1999). Chromatography in sucrose recovery and purification. Int. Sugar J 101, 423–427. Tanaka, H., Uzman, S., and Dunn, I. J. (1981). Kinetics of nitrification using a fluidized sand bed reactor with attached growth. Biotechnol. Bioeng. 23, 1683–1702. (USC, Clean Water Act. 1977). United States Senate (2002). Federal Water Pollution Control Act http://epw.senate.gov/ water.pdf. Van Niel, E. W. J., Arts, P. A. M., Wesselink, B. J., Robertson, L. A., and Kuenen, J. G. (1993). Competition between heterotrophic and autotrophic nitrifiers for ammonia in chemostat cultures. FEMS Microbiol. Ecol. 102, 109–118. WHO (2006). Guidelines for Drinking-Water Quality. 3rd edn, (Vol. 1. Recommendations. x þ 188p).
C H A P T E R
E L E V E N
Ammonia-Oxidizing Bacteria in Wastewater Micol Bellucci and Thomas P. Curtis Contents 270 271 271 272 272 273 273 273 275 275 276 276 277 279 281 281 283 284
1. 2. 3. 4.
Introduction Sampling DNA Extraction Quantitative PCR 4.1. Preparation of the qPCR standards 4.2. qPCR procedure 5. Denaturing Gradient Gel Electrophoresis 5.1. PCR primers 5.2. DGGE procedure 6. Fluorescence In Situ Hybridization 6.1. Fixation and cryosectioning 6.2. Microscope slide 6.3. Fluorescently labeled oligonucleotide probes 6.4. FISH on slides 6.5. FISH in solution 6.6. Microscopy and AOB detection 7. Conclusion References
Abstract Ammonia-oxidizing bacteria (AOB) have a key role in the conversion of ammonia to nitrite in wastewater treatment plants (WWTPs). The characterization of AOB communities in such systems requires the use of genomic methods as AOB are difficult to isolate from environmental samples. Fluorescence in situ hybridization (FISH) using fluorescently labeled probes targeting 16S rRNA molecules provides a robust tool for the detection and quantification of AOB populations in biofilms and activated sludge flocs. The abundance of AOB may be also determined by real-time quantitative polymerase chain reaction (qPCR) using primers that amplify either the 16S rRNA or amoA genes. The evaluation of changes in the AOB community in time and space can be undertaken by PCR amplification of School of Civil Engineering and Geosciences, Newcastle University, Newcastle upon Tyne, United Kingdom Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00011-7
#
2011 Elsevier Inc. All rights reserved.
269
270
Micol Bellucci and Thomas P. Curtis
these gene fragments followed by denaturing gradient gel electrophoresis (PCRDGGE). In this chapter, we summarize the most commonly applied procedures for the analysis of the AOB in wastewater, emphasizing their advantages and limitations.
1. Introduction Nitrification, the two-step oxidation of ammonia to nitrate via nitrite, is a fundamental process in the biological removal of nitrogen in domestic and industrial wastewater treatment plants (WWTPs). The first step of nitrification is carried out by the ammonia-oxidizing bacteria (AOB) that oxidize ammonia to nitrite. Due to the slow growth of these bacteria and their sensitivity to environmental conditions, nitrification has been often considered one of the most unreliable and unpredictable processes of WWTPs. For many years, both engineers and microbiologists have been focusing on the correlation between nitrification performance and AOB community structure. However, the study of the physiology and ecology of AOB has been hampered by the limitations of cultivation-dependent methodologies. Only in the last two decades, valuable knowledge about such biological process has been gained thanks to the progress of molecular techniques. Many AOB 16S rRNA gene sequences retrieved from diverse environments have been catalogued enabling the development of rRNA-based techniques, which are widely applied for the characterization of AOB community structure in WWTPs. Also, the fulllength sequence of the gene coding for the a-subunit of ammonia monooxygenase (amoA) of Nitrosomonas europaea provided another molecular marker (McTavish et al., 1993) for the detection of the AOB. Based on the phylogenetic analysis of 16S rRNA and amoA genes, it has been demonstrated that all the AOB in wastewater belong to the b-proteobacteria (Koops, 2003). Members of the Nitrosomonas oligotropha, N. europaea/Nitrosococcus mobilis, and Nitrosomonas communis lineages are commonly found, though the growth of Nitrosospira spp. can be favored in particular conditions (typically low pH and low temperature) and/or in industrial WWTPs (Koops, 2003; Siripong and Rittmann, 2007). Determination of AOB composition in WWTPs has been also widely assessed using in situ hybridization with a set of fluorescently labeled hierarchical 16S rRNA-targeted probes for AOB (Gieseke et al., 2001; Juretschko et al., 1998; Mobarry et al., 1996; Schramm et al., 1998). Such studies revealed that only one or two AOB species are usually detectable in a WWTP, though some systems can harbor higher AOB diversity. Fluorescence in situ hybridization (FISH) has been also utilized for reliable quantification of AOB in both activated sludge flocs and biofilms (Coskuner et al., 2005; Daims et al., 2001). Though FISH is a valuable method, the visualization of stained cells can be limited in samples with high autofluorescence (e.g.,
Ammonia-Oxidizing Bacteria in Wastewater
271
industrial wastewater). Also, FISH has a relative high detection limit as a minimum concentration of 103–104 cell/ml is required for reliable counts. Recently, AOB abundance has been determined by quantifying 16S rRNA or amoA gene copies using quantitative polymerase chain reaction (qPCR; Harms et al., 2003; Wells et al., 2009; Wittebolle et al., 2008). This method is a robust, sensitive, and rapid quantitative tool, which provides a valid alternative to FISH, though it can be limited by the efficiency of DNA extraction and PCR biases (Martin-Laurent et al., 2001). Standard PCR amplification of the 16S rRNA or amoA gene fragments followed by denaturing gradient gel electrophoresis (DGGE) has been also widely employed to provide a fingerprint of the AOB community. The sequencing of the DGGE bands also allows a comparative assessment of the AOB diversity, but the phylogeny can be prone to biases as only fragments shorter than 500 bp can be separated on the gel. Nevertheless, the examination of time series and AOB population dynamics (Rowan et al., 2003) can be relatively rapid using DGGE as several samples can be run and analyzed simultaneously. In this chapter, we provide sampling instructions and a clear description of some procedures which have been successfully applied for the characterization of AOB communities in activated sludge or biofilm samples.
2. Sampling Before leaving the laboratory, pour a known volume (e.g., 25 ml) of ethanol (standard laboratory grade) into a sterile bottle or 50 ml screw-top plastic tube. At the wastewater plant, collect an appropriate volume of mixed liquor (100 ml) or biofilm. The sample is then divided into two parts. One part is kept for the evaluation of the physical and chemical parameters and DNA extraction. The other part is used for FISH analysis and the sample should be immediately fixed in ethanol to prevent the sample solidifying upon storage at 20 C which could damage and destroy the cell wall structures. To fix the sample in ethanol, mix the liquor to avoid settling of the solid material and transfer it to the ethanol (1 volume ethanol:1 volume of sample). Similarly, any biofilm samples should also be immersed into ethanol. Samples are then transported to the laboratory in an ice-box and stored at 20 C upon arrival.
3. DNA Extraction The first step of PCR-based methods for the analysis of the AOB in wastewater involves the extraction of DNA from the whole bacterial community. Many commercially available DNA extraction kits for soil have been successfully used for the DNA extraction of wastewater samples
272
Micol Bellucci and Thomas P. Curtis
(the reader is suggested to look at Chapter 1, which describes the DNA extraction techniques in details).
4. Quantitative PCR Real-time or quantitative PCR (qPCR) of 16S rRNA and amoA genes is frequently used for the quantification of AOB in biofilm and activated sludge samples (Harms et al., 2003; Wells et al., 2009).
4.1. Preparation of the qPCR standards Standards for AOB quantification can be made from pure cultures or clones. When the DNA of a pure culture is used as a standard, keep in mind that the amplification efficiency, and therefore the calibration curves, can differ between AOB taxa. It has been reported that the amplification efficiency of the 16S rRNA gene fragments of Nitrosomonas strain AL212 and Nitrosospira strain NpAV is lower than that of N. europaea strain ATCC 25978 and Nitrosospira multiformis strain ATCC (Sekido et al., 2008). N. europaea strains seem to be the most suitable also when quantifying the number of the amoA gene fragments (Okano et al., 2004). Subsequently, the operator should ideally know the AOB composition in the sample and use a standard generated from a suitable or representative organism. Alternatively, if standards are generated from cloned PCR products, grow the Escherichia coli clone in standard liquid medium with antibiotics (e.g., LB with ampicillin) and extract the plasmid DNA from 8 to 10 ml of culture using commercial plasmid isolation kits. After purification, the concentration and quality of the plasmid DNA should be determined using a NanoDrop Spectrophotometer. From the concentration value, the amount of plasmid DNA (number of copies) per microliter can be calculated as follows: DNA amount ðmolecules=mlÞ ¼ 6:23 1023 ðmolecules=moleÞ concentrationðg=mlÞ ð11:1Þ MWðg=molÞ where MW is the number of base pair multiplied by 660 Da. The investigator should prepare a top standard with a concentration of 109 copies per number per microliter, aliquot and store it at 20 C. Fresh serial dilutions of the top standard ranging between 108 and 103 copies per number per microliter should be then made at the beginning of each experiment.
Ammonia-Oxidizing Bacteria in Wastewater
273
4.2. qPCR procedure AOB quantification is performed with primers targeting the 16S rRNA or amoA genes (Table 11.1) using a real-time PCR machine. The PCR mixture varies according to laboratories. Both general dyes (i.e., 1% of 100 SYBR-Green I in the total PCR volume, v/v) and specific TaqMan probes are commonly applied for the fluorescence detection. The PCR cycle for the amplification of the 16S rRNA gene is as follows: 50 C for 2 min; polymerase activation at 95 C for 10 min; 40 cycles with melting at 94 C for 20 s; annealing at 60 C for 1 min; and elongation at 72 C for 40 s (Knapp and Graham, 2007). The thermocycling step for the AmoA-1F/ AmoA-2R (0.3 mM) primer set is as follows: 95 C for 2 min, followed by 32 cycles consisting of 94 C for 45 s, 56 C for 30 s, 72 C for 1 min, and a detection step for 10 s at 83.5 C (Wells et al., 2009). The PCRs are performed in duplicate, together with a set of standards (in duplicate) to enable the absolute quantification of number of copy of the target gene. The 16S rRNA gene copy per number can be converted as AOB number by assuming that one rRNA operon exists per cell in AOB (Klappenbach et al., 2001). The number of copies of the amoA gene is typically two or three according to the AOB species (Stein et al., 2007).
5. Denaturing Gradient Gel Electrophoresis 5.1. PCR primers DGGE is a powerful technique for the evaluation of the diversity and dynamics of the AOB populations in time and space. This technique electrophoretically separates PCR amplicons that have the same length but have different primary sequence. Either the 16S rRNA or the amoA gene fragments are commonly separated. The CTO primer set amplifying a 465-bp fragment of the 16S rRNA gene is commonly used. Nevertheless, these primers have limited specificity and subsequent sequencing of the DGGE bands is required to confirm their origin. Alternatively, the AmoA1F/AmoA-2R primer set can be applied to amplify a 491-bp fragment of amoA gene of the b-proteobacteria AOB. However, both these approaches can lead to gels with faint and limited number of bands. To increase the sensitivity of the essay, it is strongly recommended to use a nested PCR approach. CTO amplicons can be used as a template for a second PCR cycle with bacterial-specific primers 3 and 2 (Muyzer et al., 1993), which amplifies 193 bp of the V3 hypervariable region of the 16S rRNA gene. The sequences of the primers and references are reported in Table 11.2. Primer 3 contains a 40-nucleotide GC rich sequence (GC clamp) at its 50 -end to
Table 11.1 Target gene, name, sequence, and reference of the PCR primer sets commonly used for qPCR Target gene
Primer
Sequence (50 –30 )
Reference
16S rRNA
CTO 189fA/B CTO 189fC RT1r AmoA-1F AmoA-2R
GGAGRAAAGCAGGGGATCG GGAGGAAAGTAGGGGATCG CGTCCTCTCAGACCARCTACTG GGGGTTTCTACTGGTGGT CCCCTCKGSAAAGCCTTCTTC
Kowalchuk et al. (1997)
amoA
Hermansson and Lindgren (2001) Rotthauwe et al. (1997) Rotthauwe et al. (1997)
Table 11.2 Target organisms, name, sequence, and references of the PCR primer sets used for DGGE Target gene
Primer
Sequence (50 –30 )
References
AOB 16S rRNA
CTO189fA/B CTO189fC CTO654r AmoA-1F AmoA-2R Primer3f
GGAGRAAAGCAGGGGATCG GGAGGAAAGTAGGGGATCG CTAGCYTTGTAGTTTCAAACGC GGGGTTTCTACTGGTGGT CCCCTCKGSAAAGCCTTCTTC CGCCCGCCGCGCGCGGCGGGCGGGGCGGGGGC ACGGGGGG CCTACGGGAG GCAGCAG ATTACCGCGGCTGCTGG
Kowalchuk et al. (1997)
amoA All bacteria 16S rRNA
Primer2r
Rotthauwe et al. (1997) Rotthauwe et al. (1997) Muyzer et al. (1993)
Ammonia-Oxidizing Bacteria in Wastewater
275
prevent the complete strand separation during the electrophoresis in the denaturant gel.
5.2. DGGE procedure The PCR-amplified fragments are separated on a DGGE system (e.g., the D-Code System, Bio-Rad Laboratories Ltd., UK). PCR products from the nested PCR approach using CTO and primer 3/primer 2 are run on a 10% (w/v) polyacrylamide gel (10%, w/v acrylamide stock solution (acrylamideN,N-methylenebisacrylamide, 37:1)) containing 1 TAE (Tris–acetate– EDTA; 40 mM Tris–acetate, 1 mM EDTA) buffer with a 35–55% denaturing gradient (where 100% denaturant comprises 7 M urea and 40% (v/v) deionized formamide (FA)). If the aim is to separate the amoA gene or the CTO fragments, prepare an 8% (w/v) polyacrylamide gel in 1 TAE buffer using a denaturing gradient ranging from 30% to 70%. Acrylamide is polymerized by adding TEMED (final concentration 0.1%, v/v) and ammonium persulfate (final concentration 0.1%, w/v). Then, leave the gel to polymerize for 4 h (or overnight) on the bench. After preparation of the gel, load PCR products mixed with a loading buffer into each well. Markers or DGGEladder consisting of a series of known clones can be also included every four or five wells. Run the electrophoresis in 1 TAE buffer at 60 C for about 4 h at a constant voltage (200 V). Then, stain the gel for 30 min in a solution of SYBR green I diluted 1/10,000 in 1 TAE buffer and examine with an ultraviolet trans-illuminator. The comparison of the DGGE band patterns can be assessed by software for the analysis and database archiving of 2D gels (e.g., using Bionumerics 4.0, Applied Maths BVBA, Belgium). The resulting gel contains a band pattern representing the fingerprint of the AOB community in the sample. Usually, when primer3/primer2 PCR products have been separated on the gel, the bands in the upper part of the gel are related to Nitrosomonas spp., while the ones in the middle-low part are associated with Nitrosospira spp. and the bands in the lowest part of the gel are not AOB. Theoretically, each band corresponds to a bacterial taxon, but two DNA fragments differing in sequences may migrate together. Also, multiple bands can belong to the same taxon. Therefore, bands in the same position on a gel cannot be assumed to be the same species without sequencing analysis. Consequentially, the strongest bands are commonly excised, purified, and sequenced before subsequent phylogenetic analyses.
6. Fluorescence In Situ Hybridization FISH is the most common technique used for the detection and quantification of the AOB in wastewater. During FISH analyses, the cells are first stained with fluorescently labeled probes targeting 16S rRNA molecules in
276
Micol Bellucci and Thomas P. Curtis
ribosomes and then detected easily by fluorescence microscopy (Amann et al., 1990a,b; Amann et al., 1995; DeLong et al., 1989). Several modifications have been proposed since the first FISH protocol was described (i.e., FISH in solution, FISH-CLSM, FISH-MAR, CARD-FISH; Coskuner et al., 2005; Lee et al., 1999; Pernthaler et al., 2002; Rossetti et al., 2007). However, all the procedures imply four main steps: fixation, hybridization, washing, and detection of the fluorescence signal.
6.1. Fixation and cryosectioning AOB are gram negative; therefore, it is necessary to cross-link the terminal amino groups on the membrane lipids to better preserve the cell structure which can be damaged during the storage and hybridization steps. To achieve this, the ethanol-fixed sample must be further fixed in a 4% paraformaldehyde (PFA) solution (Amann et al., 1990a) as soon as possible (no later than a month) using the following procedure. An appropriate amount of ethanol-fixed mixed liquor sample (e.g., 1 ml) is centrifuged at 13,000 rpm for 3 min, and the supernatant discarded. The pellet is then washed by adding 1 PBS (1 ml), vortexed, and spun at 13,000 rpm for 3 min and the supernatant discarded. The pellet is fixed by adding 750 ml of 4% PFA solution and 250 ml of 1 PBS (3:1 ratio, v/v). This mixture is vortexed to completely resuspend the pellet and incubated at 4 C for 4–12 h. After fixation, the pellet is washed twice with 1 ml 1 PBS and the pellet resuspended in 1 ml 1 PBS and ethanol (standard laboratory grade) solution (1:1 ratio, v/v). PFA-fixed samples can be stored at 20 C for many years. Intact biofilm samples in ethanol are transferred to a freshly prepared 4% PFA solution for 8 h at 4 C. The biofilm is then washed in a 1 PBS solution and then embedded in optimum cutting temperature (OCT) tissue-freezing medium (Tissue-Tek OCT, Sakura Finetek, the Netherlands). After rapid freezing at 20 C, 5–20 mm vertical cryosections are cut using a cryostat and attached to a gelatin-coated slide (see below).
6.2. Microscope slide FISH experiments are performed using Teflon-coated glass slides with 6–10 wells, into which the fixed biomass is placed. The sample can occasionally detach from the surface of the slide during FISH procedures thereby affecting the results (particularly the quantification of AOB cells). To avoid this, two strategies are usually employed. Slides can be coated with gelatin or the biomass can be embedded in agarose. To prepare gelatin-coated slides, place the slides into a plastic rack and then submerge it into a 10% solution of KOH (w/v) in 95% ethanol for 1 h. Then, wash the slides by immersing the rack into distilled or deionized
Ammonia-Oxidizing Bacteria in Wastewater
277
water for 30 s. Replace the water, and repeat three times. After that, leave the slide to dry on the bench. In the mean time, heat distilled water in a box which can contain the rack to 70 C using a water bath and then add to a final concentration 0.1% gelatin and 0.01% CrK(SO4)2 (w/v) and mix gently. Submerge the rack with the dried slides into the gelatin-coating solution for 3 min, remove and leave to air dry for 5 min. Repeat this step three times. Finally, leave the slides to air dry in a dust-free environment and store them at 4 C. To embed the biomass in agarose, place 10 ml of the biomass sample into a microscope slide well and leave it to air dry. Then, add 5 ml of 0.5% agarose solution without touching the biomass (e.g., leave the drop of agarose solution to fall down and spread on the well) and leave it to solidify.
6.3. Fluorescently labeled oligonucleotide probes Probes used for FISH are short synthetic oligonucleotides labeled with a fluorophore at its 50 -end. Cyanine dyes, Cy3 (indocarbocyanine) and Cy5 (indodicarbocyanine), and fluorescein dyes (FITC or FLUO) are commonly used. Cy3 (excited at 550 nm-emitting at 570 nm) absorbs in the green spectrum range and emits in the red spectrum, while Cy5 (excited at 650 nm, emitting at 670 nm) adsorbs red light and emits in the infra red. Although filters for the detection of Cy5-labeled probes are available for fluorescence microscope, cells hybridized with such probes are difficult to visualize. Therefore, the use of Cy5-labeled probes is recommended only when the hybridized biomass is examined by Confocal Laser Scanning Microscope (CLSM) equipped with appropriate lasers. Fluorescein probes (exciting at 592 nm, emitting at 520 nm) emitting in the green light are commonly used together with Cy3-labeled probes as they are easy to detect by fluorescence microscopy. However, some wastewater samples autofluorescence in the same range and positive signals of FLUO-labeled probes can be difficult to recognize. Probes complementary to group-, genus-, and lineage-target site have been designed and successfully applied to the detection and quantification of AOB populations in wastewater (Table 11.3; Nielsen et al., 2009; Mobarry et al., 1996). For the quantification of the total AOB community, probes Nso1225 and Nso190 targeting the entire b-proteobacteria AOB lineage have been widely used. However, it is more common to simultaneously hybridize the biomass with a probe mixture containing 6a192, NEU, and Nso1225, all labeled with the same fluorophore. To completely quantify the AOB and simultaneously distinguish between Nitrosomonas spp. and Nitrosospira spp., probes Nms156 and Nso190 labeled with different fluorophores can be used together. Probe Nso190 encompasses all the b-proteobacteria AOB, while Nms156 targets most of the Nitrosomonas spp. The overlapping signal of the two probes represents the group of Nitrosomonas spp.,
Table 11.3 List of probes commonly used for FISH analysis Title
Target
Target site
Sequence (50 –30 )
Nso1225 Nso190 NEU
b-Proteobacterial AOB b-Proteobacterial AOB Halophilic Nitrosomonas spp. Competitor to NEU N. oligotropha lineage Competitor to 6a192 Nitrosomonas communis lineage Nitrosomonas cryotolerans lineage Nitrosococcus mobilis lineage Nitrosospira spp. Nitrosomonas europaealineage Nitrosomonas spp., Nitrosococcus mobilis Nitrosomonas oligotropha lineage Most bacteria Planctomycetales Verrucomicrobiales –
1004–1022 189–207 651–668
CGCCATTGTATTACGTGTGA 35 CGATCCCCTGCTTTTCTCC 55 CCCCTCTGCTGCACTCTA 35
Mobarry et al. (1997) Mobarry et al. (1996) Wagner et al. (1995)
659–676 192–212 192–212 120–139
TTCCATCCCCCTCTGCCG CTTTCGATCCCCTACTTTCC CTTTCGATCCCCGACTTTCC TTAAGACACGTTCCGATGTA
35 35 35 25
1004–1022
TCTCACCTCTCAGCGAGCT
35
174–191 443–461 1472–1489
TCCTCAGAGACTACGCGG CCGTGACCGTTTCGTTCCG ACCCCAGTCATGACCCCC
35 30 50
Wagner et al. (1995) Adamczyk et al. (2003) Adamczyk et al. (2003) Pommerening-Roser et al. (1996) Pommerening-Roser et al. (1996) Juretschko et al. (1998) Mobarry et al. (1996) Juretschko et al. (1998)
155–173
TATTAGCACATCTTTCGAT
5
Mobarry et al. (1996)
218–236
CGG CCG CTC CAA AAG CAT 35
Gieseke et al. (2001)
338–355 338–355 338–355 –
GCT GCC TCC CGT AGG AGT GCA GCC ACC CGT AGG TGT GCT GCC ACC CGT AGG TGT ACT CCT ACG GGA GGC AGC
Amann et al. (1990b) Daims et al. (1999) Daims et al. (1999) Manz et al. (1992)
CTEa 6a192 c6a192a NmII NmIV NmV Nsv443 Nse1472 Nsm156 Nmo218 EUB338i EUB338ii EUB338iii NONEUB a
Competitors: they must be used in the same equimolar amount of the respective probe.
FA (%)
0–50 0–50 0–50 0–50
Reference
Ammonia-Oxidizing Bacteria in Wastewater
279
while the AOB populations targeted only by Nso190 belong to the Nitrosospira lineage. Alternatively, probe NSV443 targeting Nitrosospira spp. can be applied simultaneously with Nms156. However, probe NSV443 frequently gives false positive signals; therefore, the results should be confirmed by hybridizing the biomass either with general AOB probes and NSV443, or using NSV443 together with a nonsense probe (a probe that does not target any bacteria) to identify any nonspecific binding. For a general survey of the different AOB populations, it is best to hybridize the sample simultaneously with probes 6a192, NEU, NSV443, and Nso1225. Probe NSV443 and Nso1225 should be labeled with the same fluorophore, while 6a192 and NEU should be labeled with different fluorophores. After this initial analysis, more specific probes, or a combination thereof, can be used for a complete description of the AOB composition (e.g., NmV for the detection of N. mobilis). If the aim of the experiment is to evaluate the fraction of the AOB with respect to the total bacterial community, probes specific for AOB are applied together with a probe mixture that detects most Bacteria (EUB mix). The two sets of probe must be labeled with two different fluorophores. It should be recognized that only hybridization with multiple probes with the same stringency can be performed simultaneously. However, when probes requiring differing stringency conditions are used, the hybridization and washing steps with the high stringency condition is performed first, and then the protocol is repeated with the appropriate less stringent conditions.
6.4. FISH on slides For the detection in situ and quantification of AOB populations, the protocol first described by Amann et al. (1990a) is routinely applied. A known volume of PFA-fixed sample (10 ml) is transferred into three wells of a gelatin-coated slide and dried for 10 min at 46 C in an incubator. This step is repeated to obtain a thick layer of biomass. Usually, the sample in the first well is a negative control in which no probe will be added. This is required to assess the autofluorescence of the sample, especially when the hybridized cells are visualized by CLSM. The sample in the second well represents another negative control in a which non-sense (e.g., NONEUB) probe will be added. This negative control ensures the specificity of the hybridization step and controls for nonspecific fluorescence caused by the probes. Finally, the biomass in the third well is the sample to test. If gelatincoated slides are not used, the dried samples should be covered with the agarose solution as described before. The biomass on the slide is serially dehydrated by immersing the slide into 60, 80, and 96% ethanol solutions for 3 min. The slide is then allowed to air dry before the subsequent hybridization steps.
280
Micol Bellucci and Thomas P. Curtis
The hybridization buffer (HB; 2 ml) is prepared with a specific formamide (FA) concentration according to the stringency of the probes (Table 11.4). Theoretically, up to three probes (50 ng/ml) requiring the same stringency conditions can be applied simultaneously. However, probe mixture solution with probes having equimolar amount can be prepared and used as an individual probe. A 10 ml aliquot of the HB is applied onto each well and 1 ml of each probe is added to the samples. The remaining HB is poured onto a piece of absorbent paper that has been placed previously into a 50-ml screw-top plastic tube. The slide is then placed horizontally into the tube. All the steps with FA must be undertaken in a fume cupboard as this reagent is extremely toxic. The samples are then incubated at 46 C for 1.5–3 h. After the hybridization step, the biomass is washed to remove any excess probe. To achieve this, prepare the washing buffer (WB; 40 ml) in a 50-ml tube according to Table 11.5 and preheat to 48 C. The slide is then immersed into the buffer and incubated at 48 C for 15 min in a water bath. The slide is then dipped into ice-cold double sterile (autoclaved and filtered) water for 2–3 s and then dried as quickly as possible by gently blowing compressed air over the surface of the slide. This prepared slide can then be stored in the dark at 20 C until microscopic visualization. Table 11.4 Hybridization buffer (Manz et al., 1992) 15% FA 30% FA 35% FA 40% FA 55% FA
4.5 M NaCl (ml) 200 mM Tris–HCl (pH 7.2) (ml) 10% SDS (ml) Deionized formamide (FA) (ml) Milli Q (ml) Total volume (ml)
0.2 0.1 2 0.15 0.55 1
0.2 0.1 2 0.30 0.40 1
0.2 0.1 2 0.35 0.35 1
0.2 0.1 2 0.40 0.30 1
0.2 0.1 2 0.55 0.15 1
Table 11.5 Washing buffer (Amann et al., 1990a) 15% FA 30% FA 35% FA 40% FA 55% FA
4.5 M NaCl (ml) 0.5 EDTA (pH 8.0) (ml) 200 mM Tris–HCl (pH 7.2) (ml) 10% SDS (ml) Make up to total volume with Milli Q (ml)
2 0.4 4 100 40
1 0.4 4 100 40
0.750 0.4 4 100 40
0.5 0.4 4 100 40
0.375 0.4 4 100 40
Ammonia-Oxidizing Bacteria in Wastewater
281
6.5. FISH in solution A modified FISH procedure has also been described to allow the hybridization of biomass in solution (Coskuner et al., 2005). FISH in solution may be advantageous for AOB quantification as all the steps are preformed in a microcentrifuge tube and biomass loss is thought to be minimized. However, this method involves many centrifugation steps that increase the operation time and during which the biomass might be accidentally lost when the supernatant is removed. Furthermore, FISH in solution can give lower fluorescence signal than FISH on a slide. In this procedure, an appropriate volume of PFA sample (200–250 ml) is transferred into sterile microcentrifuge tubes; two for the negative controls and one for the analysis of the sample. The sample is spun for 3 min at 13,000 rpm and the supernatant discarded. The biomass is dehydrated by adding 500 ml of 60% ethanol solution (v/v), vortexed, spun for 3 min at 13,000 rpm and the supernatant discarded. This step is subsequently repeated with 80 and 96% ethanol solutions. Then, HB (1 ml) is prepared according to the probe stringency as detailed in Table 11.4. The HB volume added to the biomass pellet depends on the number of probes used. However, the final volume of the HB plus probes (50 ng/ml; 2 ml each) should be 40 ml. The pellet is gently resuspended in the HB solution and then the sample is incubated in a water bath at 46 C for 1.5–3 h in the dark. After the hybridization step, the biomass is spun for 3 min at 13,000 rpm and the pellet is washed twice by adding 1 ml of preheated WB (Table 11.5) and incubated for 15 min at 48 C. The pellet is then washed in ice-cold double sterile water (1 ml) and resuspended in 100–250 ml of double sterile water. Ten microliters of thoroughly mixed hybridized sample is then transferred onto a Tefloncoated slide (gelatin-coated slide or agarose embedding are not necessary) and the biomass is left to dry in the dark before storing at 20 C.
6.6. Microscopy and AOB detection Before microscopy analysis, the frozen slide is dried with compressed air or by incubating at 46 C for 5 min. Two drops of antifadent solution (e.g., Citifluor AF1, Citifluor Ltd., UK) are added; a coverslip is then placed on the top and sealed with transparent nail varnish. For qualitative analysis of the AOB community composition, the presence or absence of the hybridized AOB populations can be examined by fluorescence microscopy. For AOB quantification, the use of a CLSM is strongly recommended as AOB occur in tight colonies within the activated sludge floc or biofilm. The first step is to determine the background fluorescence using the negative control sample. This allows the operator to distinguish between the positive signals of the hybridized biomass and the autofluorescence of
282
Micol Bellucci and Thomas P. Curtis
the sample. Further, the AOB abundance can be expressed as a fraction of the total bacterial community or as total AOB numbers. The assessment of the AOB fraction relies on the evaluation of the area of the target AOB as a percentage of the area of the total bacterial community (Daims et al., 2006). To do this, adjust the pinhole of the microscope in order to have an optical section with a thickness of 1 mm. Images of multiple fields of view (FOV; 20–30) should be taken at low magnification by randomly moving the slide. For each FOV, an image with the filter for the detection of the AOB population and an image with the filter for the bacterial community are recorded. The AOB colonies should appear in both images, so the setting for the detector sensitivity of the CLSM for each channel must be adjusted in order to match the area of the AOB colonies in the two images. Errors in this step can lead to under- or overestimations of the AOB fraction. The images are saved as monochrome 8bit TIFF files. Images can be then processed using software which can determine the area of the fluorescent biomass (e.g., DAIME; Daims et al., 2006). Notwithstanding the elegance and simplicity of this method, the measurement of the AOB fraction does not allow the investigator to infer the ammonia oxidation rate and/or kinetic parameters. To overcome this issue, it has been suggested to convert the area of the bacteria to cell numbers using the area of a known concentration of E. coli as reference (Daims et al., 2001a). However, the accuracy of the method is limited by the different sizes of the microorganisms. To quantify the total AOB numbers, direct or indirect cell counting can be assessed. In both cases, it is assumed that the sample is uniformly distributed on the slide and the CLSM images should be taken using the following systematic procedure. Set the background fluorescence threshold using the negative control and move the objective with the lowest magnification to the horizontal or vertical edge of the well of the test sample. This will be the first FOV. z-stack images (1 mm optical sections) are then taken through the depth of the biomass. Move to the next adjacent FOV, estimated by following an imaginary diameter of the well, and collect a further series of z-stack images. Images should be collected through the well until the other edge is reached. The z-stack images are usually saved as 8-bit TIFF images in sequence into one folder. This contains all the individual images and one overlapping all the optical sections. The total number of AOB can then be determined by directly counting the cells in the z-stack images if the cell width is assumed to equal to 1 mm (thickness of the optical slice). The sum of cells in the optical sections of the z-stack represents the number of AOB in one FOV. The total number of cell is then calculated by the following equation: TN AOB ðcell=mlÞ ¼ Mean number of cell per FOV ðcellÞ
Area well ðmm2 Þ 1000 ml 1 a 2 Area FOV ðmm Þ Volume of sample on the wellðmlÞ ml ð11:2Þ
Ammonia-Oxidizing Bacteria in Wastewater
283
where TN AOB is the total number of AOB (cell/ml) and a is a correction factor accounting for dilution and concentration steps. Because AOB occur in colonies, it may be possible that the cells are not normally distributed in the FOV; subsequently, the data may need to be transformed in order to achieve a normal distribution (e.g., logarithmic, square root; Davenport and Curtis, 2004). However, the direct counting of cells is extremely time consuming and it is not feasible for the quantification of large number of samples. Alternatively, indirect AOB quantification can be assessed by converting the AOB volume to AOB numbers or AOB biomass (Coskuner et al., 2005). This methodology implies two main assumptions: (1) there is a linear correlation between size of the colonies and cell number within a colony; (2) the AOB colonies are spherical. The mean number and diameter of colonies in each FOV (overlapping image of the z-stacked) is measured using specific image processing softwares (e.g., DAIME or ImageJ). After checking for normality, if the data do not follow a normal distribution, they should be transformed. The diameter is then used to calculate the mean volume of the microcolonies that can be converted to cell numbers considering the cell width of 1 mm and 23–24% void volume. To infer the total AOB number in the sample, one should consider the mean number of cells per FOV and use the previous equation (11.2). The AOB volume per unit can be alternately converted into AOB biomass by multiplying the mean volume per 0.490 g/cm3 (Coskuner et al., 2005).
7. Conclusion Genomic methods are powerful tools that can provide insights into the AOB community in wastewater. These methods need to be constantly updated as novel taxa are continuously retrieved from activated sludge and biofilms. FISH is a robust method for the assessment of both AOB phylogeny and quantification. However, the number of species detected by the probes is limited. Also, the combination of FISH and CLSM provides accurate quantitative results, but this methodology is extremely time consuming and many laboratories cannot afford such an expensive microscope. qPCR represents a valid alternative to FISH, but the PCR efficiency varies according to the AOB species to quantify. Therefore, a general knowledge of the AOB community in the sample is needed to use appropriate standards. DGGE is a robust fingerprinting technique, but it does not provide
284
Micol Bellucci and Thomas P. Curtis
precise phylogenetic assessment as only fragment smaller than 500 pb can be separated on the DGGE gel. We hope that the insights in this chapter will help others to adopt these methods to understand the ecology of AOB and to improve the engineering of nitrification.
REFERENCES Adamczyk, J., et al. (2003). The isotope array, a new tool that employs substrate-mediated labeling of rRNA for determination of microbial community structure and function. Appl. Environ. Microbiol. 69(11), 6875–6887. Amann, R. I., Krumholz, L., and Stahl, D. A. (1990a). Fluorescent-oligonucleotide probing of whole cells for determinative, phylogenetic, and environmental studies in microbiology. J. Bacteriol. 172(2), 762–770. Amann, R. I., et al. (1990b). Combination of 16S rRNA-targeted oligonucleotide probes with flow cytometry for analyzing mixed microbial populations. Appl. Environ. Microbiol. 56(6), 1919–1925. Amann, R. I., Ludwig, W., and Schleifer, K. H. (1995). Phylogenetic identification and in situ detection of individual microbial cells without cultivation. Microbiol. Rev. 59, 143–169. Coskuner, G., et al. (2005). Agreement between theory and measurement in quantification of ammonia-oxidizing bacteria. Appl. Environ. Microbiol. 71(10), 6325–6334. Daims, H., et al. (1999). The domain-specific probe EUB338 is insufficient for the detection of all bacteria: Development and evaluation of a more comprehensive probe set. Syst. Appl. Microbiol. 22(3), 434–444. Daims, H., et al. (2001). Cultivation-independent, semiautomatic determination of absolute bacterial cell numbers in environmental samples by fluorescence in situ hybridization. Appl. Environ. Microbiol. 67(12), 5810–5818. Daims, H., Lucker, S., and Wagner, M. (2006). daime, a novel image analysis program for microbial ecology and biofilm research. Environ. Microbiol. 8(2), 200–213. Davenport, R. J., and Curtis, T. P. (2004). Quantitative fluorescence in situ hybridisation (FISH): Statistical methods for valid cell counting. In “Molecular Microbial Ecology Manual,” (G. Kowalchuk, et al., eds.). Kluwer Publishing, Dordrecht, The Netherlands. DeLong, E. F., Wickham, G. S., and Pace, N. R. (1989). Phylogenetic stains: Ribosomal RNA-based probes for the identification of single cells. Science 243(4896), 1360–1363. Gieseke, A., et al. (2001). Community structure and activity dynamics of nitrifying bacteria in a phosphate-removing biofilm. Appl. Environ. Microbiol. 67(3), 1351–1362. Harms, G., et al. (2003). Real-time PCR quantification of nitrifying bacteria in a municipal wastewater treatment plant. Environ. Sci. Technol. 37(2), 343–351. Hermansson, A., and Lindgren, P.-E. (2001). Quantification of ammonia-oxidizing bacteria in arable soil by real-time PCR. Appl. Environ. Microbiol. 67(2), 972–976. Juretschko, S., et al. (1998). Combined molecular and conventional analyses of nitrifying bacterium diversity in activated sludge: Nitrosococcus mobilis and Nitrospira-like bacteria as dominant populations. Appl. Environ. Microbiol. 64(8), 3042–3051. Klappenbach, J. A., et al. (2001). rrndb: The ribosomal RNA operon copy number database. Nucleic Acids Res. 29(1), 181–184. Knapp, C. W., and Graham, D. W. (2007). Nitrite-oxidizing bacteria guild ecology associated with nitrification failure in a continuous-flow reactor. FEMS Microbiol. Ecol. 62, 195–201.
Ammonia-Oxidizing Bacteria in Wastewater
285
Koops, H. P. (2003). The lithoautotrophic ammonia-oxidizing bacteria. In “The Prokaryotes: An Evolving Electronic Resources for the Microbiological Community,” (E. M. Dworkin, et al., eds.). Springer-Verlag, New York. Kowalchuk, G. A., et al. (1997). Analysis of ammonia-oxidizing bacteria of the beta subdivision of the class proteobacteria in coastal sand dunes by denaturing gradient gel electrophoresis and sequencing of PCR-amplified 16 S ribosomal DNA fragments. Appl. Environ. Microbiol. 63(4), 1489–1497. Lee, N., et al. (1999). Combination of fluorescent in situ hybridization and microautoradiography—A new tool for structure-function analyses in microbial ecology. Appl. Environ. Microbiol. 65(3), 1289–1297. Manz, W., et al. (1992). Phylogenetic oligodeoxynucleotide probes for the major subclasses of proteobacteria—Problems and solutions. Syst. Appl. Microbiol. 15(4), 593–600. Martin-Laurent, F., et al. (2001). DNA extraction from soils: Old bias for new microbial diversity analysis methods. Appl. Environ. Microbiol. 67(5), 2354–2359. McTavish, H., Fuchs, J. A., and Hooper, A. B. (1993). Sequence of the gene coding for ammonia monooxygenase in Nitrosomonas europaea. J. Bacteriol. 175(8), 2436–2444. Mobarry, B. K., et al. (1996). Phylogenetic probes for analyzing abundance and spatial organization of nitrifying bacteria. Appl. Environ. Microbiol. 62(6), 2156–2162. Mobarry, B. K., et al. (1997). Phylogenetic probes for analyzing abundance and spatial organization of nitrifying bacteria. Appl. Environ. Microbiol. 63(2), p. 815a-. Muyzer, G., de Waal, E. C., and Uitterlinden, A. G. (1993). Profiling of complex microbial populations by denaturing gradient gel electrophoresis analysis of polymerase chain reaction-amplified genes coding for 16S rRNA. Appl. Environ. Microbiol. 59(3), 695–700. Nielsen, P. H., Daims, H., and Lemmer, H. (2009). FISH Handbook for Biological Wastewater Treatment: Identification and Quantification of Microorganisms in Activated Sludge and Biofilm by FISH. IWA Publishing, London, UK. Okano, Y., et al. (2004). Application of real-time PCR to study effects of ammonium on population size of ammonia-oxidizing bacteria in soil. Appl. Environ. Microbiol. 70(2), 1008–1016. Pernthaler, A., Pernthaler, J., and Amann, R. (2002). Fluorescence in situ hybridization and catalyzed reporter deposition for the identification of marine bacteria. Appl. Environ. Microbiol. 68(6), 3094–3101. Pommerening-Roser, A., Rath, G., and Koops, H. P. (1996). Phylogenetic diversity within the genus Nitrosomonas. Syst. Appl. Microbiol. 19(3), 344–351. Rossetti, S., et al. (2007). Bacterial growth kinetics estimation by fluorescence in situ hybridization and spectrofluorometric quantification. Lett. Appl. Microbiol. 44(6), 643–648. Rotthauwe, J. H., Witzel, K. P., and Liesack, W. (1997). The ammonia monooxygenase structural gene amoA as a functional marker: Molecular fine-scale analysis of natural ammonia-oxidizing populations. Appl. Environ. Microbiol. 63(12), 4704–4712. Rowan, A. K., et al. (2003). Composition and diversity of ammonia-oxidising bacterial communities in wastewater treatment reactors of different design-treating identical wastewater. FEMS Microbiol. Ecol. 43(2), 195–206. Schramm, A., et al. (1998). Identification and activities in situ of Nitrosospira and Nitrospira spp. as dominant populations in a nitrifying fluidized bed reactor. Appl. Environ. Microbiol. 64(9), 3480–3485. Sekido, T., et al. (2008). Limitations of the use of group-specific primers in real-time PCR as appear from quantitative analyses of closely related ammonia-oxidising species. Water Res. 42(4–5), 1093–1101. Siripong, S., and Rittmann, B. E. (2007). Diversity study of nitrifying bacteria in full-scale municipal wastewater treatment plants. Water Res. 41(5), 1110–1120.
286
Micol Bellucci and Thomas P. Curtis
Stein, L. Y., et al. (2007). Whole-genome analysis of the ammonia-oxidizing bacterium, Nitrosomonas eutropha C91: Implications for niche adaptation. Environ. Microbiol. 9(12), 2993–3007. Wagner, M., et al. (1995). In-situ identification of ammonia-oxidizing bacteria. Syst. Appl. Microbiol. 18(2), 251–264. Wells, G. F., et al. (2009). Ammonia-oxidizing communities in a highly aerated full-scale activated sludge bioreactor: Betaproteobacterial dynamics and low relative abundance of Crenarchaea. Environ. Microbiol. 11(9), 2310–2328. Wittebolle, L., et al. (2008). Quantifying community dynamics of nitrifiers in functionally stable reactors. Appl. Environ. Microbiol. 74(1), 286–293.
C H A P T E R
T W E LV E
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier Patrick S. G. Chain,*,†,1 Gary Xie,*,† Shawn R. Starkenburg,*,† Matthew B. Scholz,*,† Nicholas Beckloff,*,† Chien-Chi Lo,*,† Karen W. Davenport,*,† Krista G. Reitenga,*,† Hajnalka E. Daligault,*,† J. Chris Detter,*,† Tracey A. K. Freitas,*,† Cheryl D. Gleasner,*,† Lance D. Green,*,† Cliff S. Han,*,† Kim K. McMurry,*,† Linda J. Meincke,*,† Xiaohong Shen,*,† and Ahmet Zeytun*,† Contents 290 294 294 295 297 297 300 304 306 306 311 312 313 313
1. Introduction: The Genomic Guinea Pigs 2. Want a Genome? Library Preparation First! 2.1. Sample and sequencer considerations 2.2. Creating libraries for different platforms 3. Sequencing a Genome from Start to Finish 3.1. Sequencing in the “Next-Gen” era 3.2. Assembling sequence reads 3.3. Genome closure and polishing 4. Apre`s Sequencing 4.1. Annotation 4.2. Comparative analysis 5. Outlook: The Next Frontier Acknowledgments References
Abstract While sequencing methods were available in the late 1970s, it was not until the human genome project and a significant influx of funds for such research that this technology became high throughput. The fields of microbiology and microbial ecology, among many others, have been tremendously impacted over the years, * Genome Biology Group, Los Alamos National Laboratory, Los Alamos, New Mexico, USA Microbial and Metagenomics Programs, Joint Genome Institute, Walnut Creek, California, USA Corresponding author
{ 1
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00012-9
#
2011 Elsevier Inc. All rights reserved.
289
290
Patrick S. G. Chain et al.
to such an extent that the determination of complete microbial genome sequences is now commonplace. Given the lower costs of next-generation sequencing platforms, even small laboratories from around the world will be able to generate millions of base pairs of data, equivalent to entire genomes worth of sequence information. With this prospect just around the corner, it is timely to provide an overview of the genomics process: from sample preparation to some of the analytical methods used to gain functional knowledge from sequence information.
1. Introduction: The Genomic Guinea Pigs The first genome sequencing project of a free-living organism, Haemophilus influenzae opened the door to a revolution in genome sciences (Fleischmann et al., 1995). In the 15 years since then, over 1000 bacterial and archaeal genomes have been deposited in genome repositories (Benson et al., 2010). While the initial focus was primarily on organisms of medical importance, the Department of Energy’s bold initiative to promote genomics of microbes of environmental importance has led to a multitude of advances in many different fields, and the creation of the Joint Genome Institute to specifically tackle such environmentally important projects, including nitrifier genomics. While the major centers continue to dominate the sequencing landscape, with next-generation sequencing (NGS) technologies, sequencing genomes and metagenomes has become more commonplace, even in smaller centers and university laboratories, holding tremendous promise for every sphere of biological research. Prior to the genomics era, knowledge of nitrifying microorganisms at the genetic and molecular level was rather limited. Given that nitrifiers are chemolithoautotrophs, most genetic investigations were focused only on a few key genes that enabled the use of ammonia and nitrite as energy sources (ammonia monooxygenase (amo), hydroxylamine oxidoreductase (hao), and nitrite oxidoreductase (nxr)). While targeted sequencing of ribosomal RNA and these key functional genes laid the foundation for understanding the distribution and abundance of ammonia and nitrite-oxidizing microorganisms in natural systems, a more comprehensive understanding of the global molecular, biochemical, and physiological properties that define these microbes remained limited. The emergence of higher-throughput sequencing and automated annotation created new opportunities for many genome-based studies of nitrification. In 2001, the ammonia oxidizer, Nitrosomonas europaea (aka, the Guinea Pig), was the first bacterial genome to be analyzed and published by the Joint Genome Institute (Chain et al., 2003). As sequencing capacity increased, more nitrification-centric genome projects were completed and at present, most of the common nitrifier lineages have one or more sequenced representatives (Table 12.1). Many genome-based investigations
Table 12.1 Genome projects for nitrifying microbes
Organism
Habitat
Phylogenya Status (reference)
Ammonia oxidizers Nitrosomonas europaea Nitrosomonas sp. Is79A3
Sewage sludge Freshwater
Beta Beta
Complete (Chain et al., 2003) In process ( J. Norton, NP)
Nitrosomonas sp. AL212
Sewage sludge
Beta
In process ( J. Norton, NP)
Nitrosomonas marina C-113a
Marine
Beta
In process (M. Klotz, NP)
Nitrosomonas cryotolerans ATCC 49181 Nitrosomonas eutropha C91 Nitrosospira multiformis Surinam Nitrosospira briensis C-128
Marine
Beta
Sewage sludge Soil Soil
Beta Beta Beta
Marine Marine Marine Marine Marine Sponge symbiont Hot spring
Gamma Gamma Gamma Gamma Thaum Thaum
To be completed ( J. Norton, NP) Complete (Stein et al., 2007) Complete (Norton et al., 2008) To be completed ( J. Norton, NP) Complete (M. Klotz, NP) Complete (Klotz et al., 2006) Complete (M. Klotz, NP) In process (M. Klotz, NP) Complete (Walker et al., 2010) Complete (Hallam et al., 2006)
Cren
In process ( J. de la Torre, NP)
Nitrosococcus oceani AFC27 Nitrosococcus oceani ATCC 19707 Nitrosococcus halophilus Nitrosococcus watsonii C-113 Nitrosopumilus maritimus Cenarchaeum symbiosum A Nitrosocaldus yellowstonii
Size Sequence quality (Mbp)
Finished High-quality draft High-quality draft High-quality draft NA
2.8 3.7
Finished Finished NA
2.8 3.2 NA
Finished Finished Finished Finished Finished Composite MF
3.5 3.5 4.1 3.4 1.6 2.0
NA
NA
3.2 3.6 NA
(continued)
Table 12.1 (continued)
a
Organism
Habitat
Phylogenya Status (reference)
Nitrite oxidizers Nitrobacter winogradskyi Nb-255
Soil
Alpha
Nitrobacter hamburgensis X14
Soil
Alpha
Nitrobacter sp. Nb-311A
Marine
Alpha
Nitrococcus mobilis Nb-231 Nitrospina sp. SCGC AAA288-L16 Candidatus Nitrospira defluvii
Marine Marine
Gamma Delta
Sewage sludge
Complete (Starkenburg et al., 2006) Complete (Starkenburg et al., 2008) Complete ( J. Waterbury, NP)
Complete ( J. Waterbury, NP) To be completed (R. Stepanauskas, NP) Nitrospirae Complete (Lucker et al., 2010)
Size Sequence quality (Mbp)
Finished
3.4
Finished
5.0
High-quality draft Finished NA
4.1
Composite MF
4.3
3.6 NA
Alpha, alphaproteobacteria; Beta, betaproteobacteria; Gamma, gammaproteobacteria; Delta, deltaproteobacteria; Cren, crenarchaeota; Thaum, thaumarchaeota; NP, not published; NA, not available; Composite MF, composite metagenome finished (i.e., a composite genome of a population of like strains).
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
293
followed (Klotz et al., 2006; Norton et al., 2008; Starkenburg et al., 2006, 2008; Stein et al., 2007; Walker et al., 2010) which yielded a number of novel discoveries about the molecular and evolutionary basis for nitrification, demonstrating the value and necessity of genome sequencing, annotation, and analysis. The source of DNA for the aforementioned genome sequencing projects came from pure cultures of common bacterial lab strains (Nitrosomonas, Nitrosospira, Nitrobacter), which were traditionally thought to be the major contributors to nitrification in the natural systems. Targeted cloning and metagenomic sequencing of environmental samples forced a reassessment of this dogma. Ribosomal RNA surveys and shotgun sequencing of environmental samples demonstrated that many previously uncultivated nitrifiers play a significant role in both ammonia and nitrite oxidation in various habitats. For example, through metagenomic studies (Schleper et al., 2005; Treusch et al., 2004; Venter et al., 2004), we have learned that in addition to bacteria, members of the Crenarchaeota contribute to ammonia oxidation ubiquitously around the globe (Francis et al., 2005; Prosser and Nicol, 2008) and may even be a larger contributor to ammonia oxidation than bacteria in some environments (Leininger et al., 2006). Similarly, cultivationindependent methods have also revealed that Nitrospira is more abundant in wastewater treatment systems and some soil types than the classical nitrite oxidizer, Nitrobacter (Altmann et al., 2003; Daims et al., 2001; Freitag et al., 2005). Most recently, archaeal amoA and marine group I crenarchaeal 16S rRNA gene abundances were correlated with Nitrospina 16S rRNA gene abundance (Park et al., 2010; Santoro et al., 2010), suggesting a more important role for these understudied nitrite oxidizers as well. Clearly, these discoveries illustrate the power of environmental metagenomics to decipher the functional importance and diversity of uncultured nitrifiers. Further genomic and metagenomic sequencing as well as comprehensive analysis of nitrifying communities are needed to help determine the ecological relevance of each nitrifier lineage. The application of NGS technologies can be brought to bear on such questions to gain access to the diversity present in most nitrifying environments. Traditional Sanger sequencing, used effectively to sequence many nitrifier genomes from pure cultures over the years, has become too expensive and time consuming compared with NGS, and does not provide as much sequence depth to adequately survey complex metagenomic environmental samples, or to efficiently sequence multiple new strains of the same species. Herein, we present a technical overview of current sequencing methods used to prepare and sequence nitrifier genomic DNA samples, emphasizing NGS technologies. Furthermore, we also provide an overview of common tools and methods used to assemble, finish, annotate, and analyze microbial sequences (Fig. 12.1). Due to the fact that the field of DNA sequencing is constantly reinventing itself, this overview is not meant to be comprehensive but
294
Patrick S. G. Chain et al.
454 Library preparation Sample collection
DNA extraction
NGS sequencing
DNA fragmentation Illumina library preparation
Comparative analysis
Genome annotation
Genome closure
Sequence assembly
Data processing
Figure 12.1 Outline of genomics steps for nitrifiers. After sample collection, the genomic DNA of an isolate nitrifier is processed in the laboratory through extraction, fragmentation, genomic library preparation, and sequencing. Following these steps, the data are processed, assembled, run through a series of finishing reactions and software to obtain a completed genome. Once finished, the genome is annotated and compared to other available nitrifier genomes.
hopefully will provide a taste of the benefits and limitations of utilizing NGS (and related methods and tools) to further research on microbial nitrification.
2. Want a Genome? Library Preparation First! 2.1. Sample and sequencer considerations Although having a target nitrifier or other organism in pure culture may be one of the more important steps in characterizing its genome, the genomic DNA sample quantity and quality continues to be extremely important for all sequencing processes, sometimes taking months to acquire. The ability to obtain high quality and sufficient quantities of sample for specific sequencing strategies can be challenging at times, particularly when the target organism is fastidious and genomic DNA recovery is poor or difficult. This is particularly relevant for assessing nitrifying communities in natural samples and even some pure cultures of nitrifiers, given their slow rates of growth, low biomass yields, and formation of extracellular polymeric substances that can house contaminants (Konneke et al., 2005; Lebedeva et al., 2005, 2008).
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
295
For traditional Sanger sequencing, high-molecular weight DNA is necessary for the construction of clone libraries of narrow insert size range. This is particularly true for larger insert libraries (>10 kb) which require minimal degradation and large amounts of starting material (10–20 mg of DNA). Degraded DNA is preferentially incorporated into cloning vectors and can ruin a library (Birren et al., 1997). The new requirements for constructing cloneless libraries for NGS platforms, such as Roche 454 and Illumina Genome Analyzer (and more recently HiSeq2000), are also quite substantial. Even though library fragment size is somewhat less important on these platforms (or rather, the requirement is to have smaller fragments amenable to the library construction and sequencing protocols), degraded samples often result in very poor-quality libraries (Roche, 2009b). The quantity requirement for starting material varies with the platform being used as well as with the type of sequencing being performed. In addition, the target library type (e.g., paired-end libraries) also dictates the sample quantity requirements up front. New methods for shearing DNA to smaller sizes, such as acoustic wave systems, have reduced sample requirements from 10 to 1–3 mg of starting material, due in part to the retention of most of the DNA within the sample (Kozarewa et al., 2009; Quail et al., 2008). Because such instruments are not capable of shearing genomic DNA in large size ranges (i.e., 10–20 kb), the advantages of these methods are lost in shearing large fragments for paired-end (“jumping”) libraries for current platforms, which thus require up to 10–15 mg. Recent advances by researchers and/or the availability of novel sample preparation kits have enabled NGS with as little as 5 ng of DNA or RNA (Wood et al., 2010). Another way to overcome low amounts of starting material is through whole genome amplification prior to library preparation. Though biases in coverage may arise during this amplification process (e.g., some regions may be preferentially amplified over others; Pinard et al., 2006), the added throughput of NGS technologies can offset this issue, and allow the recovery of the entire genome nonetheless. Thus, the coupling of such amplification strategies with NGS technologies is opening new avenues of genomic research for organisms where genomic DNA recovery is difficult and can help alleviate the challenges associated with nitrifying enrichment cultures.
2.2. Creating libraries for different platforms With sufficient high-molecular weight purified genomic DNA in hand, a number of protocols exist to create a library of sequenceable fragments that are highly dependent on the sequencing platform used (Fig. 12.1). Library preparation for traditional Sanger sequencing can take around 1 week to complete and consists of size selection (3, 8, and 40 kb are typical) of sheared fragments, followed by end repair and ligation into a sequencing vector. Transformation into Escherichia coli allows for selection
296
Patrick S. G. Chain et al.
of clones for storage of these random fragments for future use, which is a significant difference from NGS libraries. A 454 shotgun library can be completed in 1 day following a slightly modified Roche protocol (Roche, 2009a). Fragmentation of genomic DNA occurs with all NGS procedures and can be achieved by any number of methods (nebulization, hydroshearing, sonication), although some new methods such as acoustic shearing may be advantageous for <1 kb fragments due to increased sample recovery. Following fragmentation, fragments anywhere from 500 to 800 bp are size selected by agarose gel electrophoresis and excision. A number of purification and quality control steps are carried out before and after end repair and ligation of library adaptors to these fragments. All primer dimers, short fragments, and fragments not ligated to both different adaptors are removed in a number of steps and result in single-stranded DNA fragments. These are diluted and immobilized onto DNA capture beads such that each bead carries a single unique library fragment. The capture beads are subjected to water-in-oil emulsion PCR amplification (Williams et al., 2006) resulting in several million copies of template fragment per bead. After breaking the emulsion, beads with amplified fragments are enriched by removing “null” beads, and the purified library beads can be loaded onto a 3.6 million well PicoTiterPlate for sequencing. The library making process for 454 paired-end sequencing is substantially more demanding, requiring a greater amount of initial sample material and a far longer preparation time at the bench (3 days following a modified Roche method; Roche, 2009c). Following mechanical shearing to a designated size range, the end-repaired fragments are ligated to biotinylated adaptors with loxP sites, size selected, and gel purified. Cre recombinase is used for circularization of these linear molecules and plasmid-safe DNase is used to digest uncircularized fragments. The resulting circular products carry a single biotinylated loxP adaptor sequence. These are sheared to a size of 500–600 bp, and endrepaired fragments carrying the biotinylated loxP adaptor are purified using streptavidin-coated magnetic beads. These bead-bound fragments undergo library adaptor ligation and PCR amplification which also releases the templates into solution, followed by a final size selection of the fragments using AMPure size exclusion beads (Agencourt). Additional steps are included to remove the biotinylated strand; however, the remainder of the protocol proceeds as in the regular protocol to generate a library of amplified fragments on capture beads that can be loaded onto a PicoTiterPlate for sequencing. Library creation for the Illumina Genome Analyzer can be completed in less than 1 day using Illumina’s library preparation kits and modified versions of the associated protocols (Illumina, 2008). Following genomic DNA shearing to 200–300 bp fragments, end repair is then carried out to generate blunt-ended fragments. A 30 -end A-tailing step enables adaptor ligation, the sequences of which vary depending on the library (single “fragment” reads, paired end, and multiplexing). Ligation products are then size selected and purified using either
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
297
AMPure (Agencourt) magnetic beads or gel electrophoresis/excision. The final step in library preparation is the enrichment of DNA fragments via PCR with “tailed” primers that add complementary sequences to the oligonucleotides bound to the flow cell. When preparing indexed (or barcoded) libraries for multiplexed sequencing, a third primer is used to attach a unique “bar-coding” sequence. This PCR step serves to enrich for library fragments that contain adaptors ligated to both ends, a requirement for successful cluster generation on the flow cell. The library templates are denatured with NaOH, pooled if indexed, and diluted for hybridization to a flow cell. In order to generate sufficient fluorophore signal, templates are amplified on the flow cell to form a cluster of roughly 1000 template copies (Illumina, 2009). The library template hybridization, amplification, linearization, blocking, and sequencing primer hybridization are performed on the flow cell using the Cluster Station. This is performed within 5–6 h using an onboard fluidics system with temperature control. First, the single-stranded library is hybridized to the flow cell followed by “bridge” amplification using complementary oligonucleotides on the flow cell, where amplification products fold over such that the free end comes into contact with a complementary flow cell oligonucleotide and becomes bound to the surface (forming the “bridges”). The end result is a number of “clusters” of identical double-stranded library templates bound to the flow cell at both ends. Linearization then releases one end of each bridge amplicon from the surface of the flow cell by cleaving off one of the adaptors. A blocking group is then added to the free 30 -hydroxyl group to prevent nonspecific sequencing. Finally, the clusters are denatured to single-stranded templates (with one end remaining bound to the flow cell), and the sequencing primer is hybridized. A typical flow cell for the Illumina platforms has millions of these library clusters spread across the surface (Table 12.2). Greater detail on sample preparation for both 454 and Illumina, as well as protocols for other platforms not covered here, can be supplied by the vendor. A number of modifications to these protocols exist. As these two NGS technologies continue to mature, others are certain to encroach on the microbial sequencing space. It is clear that current NGS platforms require substantial man-hour investment in sample preparation. Future NGS platform winners will undoubtedly incorporate the majority of sample preparation on board the instruments, as part of the sequencing process.
3. Sequencing a Genome from Start to Finish 3.1. Sequencing in the “Next-Gen” era The different sequencing platforms vary greatly in methodology, and understanding these differences is critical for correctly interpreting results. In addition, these platforms rely on different library construction processes
Table 12.2 Sequencing platforms and associated attributes
Sequencing technology
Read length
Approximate Maximum cost/Mbp bases/run Error rate
Sanger 600–1000 $500 454 GS-FLX or GS-Junior 400 $10 $20 Illumina GAIIX or 75–125 $0.10 Hiseq2000 100 $0.05 SOLiD 5500 or 5500xla 75 $0.04
a b
Helicos Heliscope Polonator G.007
32 26
$0.45–0.60 <$0.45
364 Kb 450 Mb 35 Mb 95 Gb 200 Gb 105 Gb 210 Gb 37 Gb 12 Gb
Pacific Biosciencesa
> 900
Unknown
200 Mb
Estimates of output at release of instrument. Multiple linked reads, conceptually similar to paired-end reads.
4
5
10 –10 10 3–10 4
Potential biases/comments
10 2–10 3
Cloning biases, random errors Biases at extreme %GC, homopolymer errors Biases at extreme %GC
10 2–10 3
Biases at extreme %GC
10 5 1:10 1– 1:10 3 10 1
Single molecule, very short reads Very short reads Single molecule, real time; strobe sequencingb
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
299
and generate vastly different types of readouts and quantities of data (Table 12.2). Due to the lower cost of NGS on a per base pair amount, traditional Sanger sequencing has all but been replaced as the main throughput method by the newer NGS technologies. Due to this fact, here we provide a very cursory overview of the traditional Sanger method and focus mostly on the two currently dominant platforms for generating microbial genomic draft DNA sequence data. Sanger sequencing relies on the detection of fluorescently labeled dideoxynucleotide-terminated fragments that are separated by size and interrogated by a laser in a DNA polymerase-catalyzed DNA synthesis reaction. Due to the ratio of the four labeled ddNTPs to regular dNTPs, and the random nature of incorporation by DNA polymerase, many fragments terminate at any given nucleotide. The detection of the nucleotide-specific fluorophore along with the size of the fragment allows the reconstruction (sequencing) of the template. High-throughput Sanger sequencing machines generate only up to 384 reads with an average read length of 800 bp within 8 h, a far cry from NGS platforms (Table 12.2). 454 pyrosequencing is a sequence-by-synthesis method that measures the release of pyrophosphate as a byproduct of DNA polymerase activity, using an enzyme cascade that ends with detection of luciferase chemiluminescent signals. The bead-based library (see Section 2.2), together with DNA polymerase, cofactors, and “packing” beads (that help keep the library beads in the wells) are loaded onto a PicoTiterPlate. These are manufactured to accommodate only a single library bead per well, though not all wells contain beads. In addition, “enzyme beads,” which contain the necessary downstream enzymes for light emission, are added and covered with pyrophosphatase beads to help prevent chemical cross talk between the wells. Once the PicoTiterPlate is loaded onto the sequencer, the fluidics system flows individual dNTPs in a fixed order across the wells with washing steps in between each dNTP, allowing for parallel sequencing of many templates that can incorporate the flowed nucleotide. Addition of one or more of the nucleotides is possible and the resulting signal is proportional to the number of nucleotides inserted. The resolution of greater than five or six nucleotide additions is problematic and results in so-called homopolymer errors (Table 12.2). The Illumina GAiiX uses another sequence-by-synthesis method that produces short reads from the clusters generated by the library preparation (see above) and is driven by fluidics delivery of reagents and buffers directly on the flow cell. A DNA polymerase binds and remains bound to the primed, single-stranded templates throughout the process, as a mixture of fluorophore-labeled nucleotide analogs (all four nucleotides can be differentiated via their fluorophore) are flowed through the flow cell. Unincorporated nucleotides are washed away and the incorporated nucleotide is detected via fluorophore laser excitation and image capture and
300
Patrick S. G. Chain et al.
quantification of cluster brightness. The 30 position of each nucleotide is modified with a reversible terminator, 30 -O-azidomethyl 20 -deoxynucleoside triphosphate, allowing only a single nucleotide to be incorporated into the growing complementary strand per “cycle.” This terminator, along with the fluorophore, is then cleaved to allow the addition of another nucleotide (cycle). Cleavage products are washed away and the next cycle of synthesis begins. Read lengths simply depend on the number of cycles allowed (Table 12.2). In multiplexed (barcoded) applications, depending on the method, the custom index is either sequenced as part of the first (or paired) read, or an additional set of cycles (equal to the length of the index) is initiated after denaturation of the first read and annealing of a specific index sequencing primer. For paired-end sequencing applications, the templates are flipped on the flow cell to expose the priming site for the second read. Hybridization of primer and cycles of nucleotide addition occur as in the first read. Due to the small fragments placed on the flow cell, unless special “jumping” libraries are created (similar to the 454 paired-end protocol), the two reads are generally spaced 100–400 bp apart. A number of other technologies have surfaced since the introduction of 454 and Illumina sequencing; however, these two platforms are the dominant platforms used and are representative of their class of sequencing products. Specifics on Illumina, 454, and other platform products, output capabilities, and biases are listed in Table 12.2. Additional information can be gathered at vendor Web sites.
3.2. Assembling sequence reads As no currently available sequencing technology is yet capable of sequencing an entire chromosome in a single pass, all genome sequencing projects require assembly of smaller sequenced reads into larger contiguous sequences (contigs). The method of assembly, however, depends on the sequencing technology used, or more specifically the size and number of reads (fold coverage), and on the availability of a sufficiently closely related genome for reference-based assembly. The screening of data for contaminants, vector or adaptor sequences, and for low-quality regions, prior to assembly, has been a highly useful strategy when using only Sanger sequencing data, and provides superior results. The screening of contaminants and adaptor sequences continues to be beneficial for assemblies; however, less has been done with regard to screening low-quality NGS data, due in part to less adequate experience in estimating biases and errors with respect to quality scores. While screening low-quality bases at the ends or beginnings of reads has generally resulted in better assembly results for NGS data, the quality of extremely high or low G þ C regions has been shown to be inferior with respect to quality scores than for regions with a moderate G þ C content.
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
301
For assembly with the use of a reference genome, much of the computational challenge is reduced to finding similar regions between the data and the reference, such as between closely related or evolved strains. However, these methods are less useful for regions that are divergent, and rarely extend into regions that are only present in the new dataset. This strategy therefore would best be used in conjunction with de novo assembly for divergent/ unique regions. While Sanger sequencing methods reigned, assembly of novel data was done using overlap algorithms that looked at alignments between reads. For example, the Phrap program (P. Green, Washington University) was long used for assembling Sanger reads into contigs even with low coverage (< 10). The lower costs of NGS have trumped the use of Sanger data for sequencing genomes; thus many new algorithms have recently emerged that are capable and more adept at handling the substantially larger volume of data required for adequate assembly of the shorter read lengths. For 454 data, the Newbler assembler (Margulies et al., 2005) has been the primary program of choice, in part since it was developed explicitly for 454 pyrosequencing data. For short read (Illumina, SOLiD) data, a large number of assembly tools have now been developed (Table 12.3). The two predominant methods that have emerged follow either a more traditional all by all comparison to find overlaps and join reads together into contigs, or begin by reducing the complexity of the dataset by deconstructing reads into subsequences of length K (termed, Kmers) and only tracking the overlaps between unique Kmers to build a large graph of possible contigs. The two methodologies have their own drawbacks. The “overlap” and associated methods require significant computational resources which increase exponentially with the number of reads and are also made more difficult with shorter read lengths. As more data are used for assembling genomes, assembly is increasingly performed using Kmer-based graph programs, despite their requirement for copious amounts of memory. In terms of accuracy, most assemblers function well unless there is a predominance of poorquality data; however, their ability to adequately assemble reads into contigs is dependent on the program parameters used. Although the default settings may work well in some instances, sequencing fold coverage, repetitiveness of the genome, and length of reads all need to be taken into consideration. More specific details of the assembly methods and algorithms are reviewed more thoroughly elsewhere (Miller et al., 2010; Pop, 2009). Despite recent advances in de novo genome assembly of NGS data, the majority of these newer short read assembly tools either cannot or do not adequately take advantage of the longer read lengths provided by Sanger or 454 sequencing. Similarly, pyrosequencing and Sanger sequencing assemblers were specifically designed for their respective sequencing methods. Therefore two solutions for combining data from different platforms have been implemented: (1) the direct merging of assemblies using software
Table 12.3 Next-generation sequencing assembly tools
Software
de Bruijn graphs ALLPATHS
EULER-SR
Velvet
SOAPdenovo
ABySS
Ray
Features
Disadvantages
Technologies
Read types recognized
Reference
Uses paired-end information Removes erroneous reads and corrects erroneous base calls Graph reduction and partition by scaffolds Uses paired-end information Removes erroneous reads and corrects erroneous base calls Graph construction by multiple values of Kmers, and graph reduction Uses paired-end information Removes erroneous reads Graph reduction Uses paired-end information Corrects erroneous base calls Graph reduction, and read partitioning Uses paired-end information Removes erroneous reads Distributed algorithm Uses paired-end information Distributed algorithm Hybrid assembly
Requires 40 coverage; requires specific libraries (including paired ends) Produces shorter contigs, less accurate than ALLPATHS and Velvet
Illumina
FASTA/QUAL
Butler et al. (2008)
454, Illumina
FASTA/QUAL
Chaisson et al. (2009)
Sanger, 454, Illumina, SOLiD Illumina
FASTA/ FASTQColor space FASTA/QUAL
Zerbino and Birney (2008)
Poor assembly quality compared to Velvet
Illumina
FASTA/QUAL
Simpson et al. (2009)
Fixed Kmer
454, Illumina
FASTA/ QUALFlow space
Boisvert et al. (2010)
RAM usage issues for larger datasets Sensitive to sequencing errors, produces shorter contigs
Li et al. (2010)
Overlap/consensus CABOG Uses paired-end information (Celera Removes erroneous reads and Assembler) corrects erroneous base calls, and robust to homopolymer run length uncertainty Graph reduction Edena Graph reduction
Specified input format
Sanger, 454, Illumina
FASTA/QUAL
Miller et al. (2008)
Illumina
FASTA/ FASTQ
Hernandez et al. (2008)
454
FASTA/ QUALFlow space FASTA/ QUALColor space
NA
Newbler
Uses paired-end information Graph reduction
Designed for unpaired reads of uniform length Does not work well for <150 bp
Shorty
Uses paired-end information Graph reduction
Required a few long reads as seeds
Illumina, SOLiD, Helicos
Hossain et al. (2009)
304
Patrick S. G. Chain et al.
dedicated to finding overlaps between large and small contigs and (2) adapting the results of one or more assemblies for use as input into one of the assemblers specifically designed for a different type of dataset (e.g., modifying the results of 454 or Illumina assemblies for input into Phrap). Therefore, the specific methodology used to assemble data for a given genome will be highly dependent on the amount (Newbler functions best with 35-fold coverage, while most short read assemblers function best with >100-fold coverage) and types (platform, paired ends) of reads from any given platform. Significant deviations from ideal coverage may result in either poor assemblies or even assembly failure; therefore, additional sequencing data are recommended for under-sequenced genomes, while reduction of data is recommended for oversequenced genomes. Complicating matters are the errors and associated ambiguities within the data (Table 12.2), which can result in many very small contigs or in highly similar contigs that differ only at erroneous bases. To mitigate the effects of sequencing errors, reads can either be trimmed for quality, or can be assembled and evaluated during the assembly process using quality scores as a metric. For nitrifier genomes, NGS assemblies can result in highly accurate contigs (with the possible exception of homopolymer mistakes when not using DNA polymerase terminators), the number of which depends heavily on the amount of data used, the input of paired-end reads capable of spanning repetitive regions, and the complexity of the target genome.
3.3. Genome closure and polishing Draft assemblies are often fragmented in numerous contigs and generally contain many issues and errors that are not readily addressed with assembly software including unresolved repeated elements within a genome, misassemblies (generally at these repeats), gaps in these repeats as well as in unique regions, low-quality sequences, and sequencing errors. Repeat regions often consist of the largest burden in the finishing process, and nitrifier genomes are known to be riddled with repeated insertion elements, difficult tandem repeats, and duplications of key operons, such as the amoCAB gene cluster, involved in ammonia catabolism (Arp et al., 2007; Chain et al., 2003; Starkenburg et al., 2008). The task of “finishing” in order to completely close a genome addresses all of these issues: closing gaps, resolving misassemblies, and raising sequence quality with additional sequencing. Inspection of these regions can be manual or automated with the help of various software (most are center specific and custom built) and is most often performed using a combination of both strategies. Most genome centers develop their own specific finishing process, software and tracking systems, custom built to complement center-specific sequencing processes, assembly tools, and finishing strategies. When Sanger sequencing was the primary
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
305
method for generating draft sequence, clones propagated in E. coli could be retrieved for targeted finishing reactions. With next-generation platforms, however, the requirement for clones is obviated, thus eliminating this resource. For regions without clones, a number of different PCR strategies are used to close gaps and raise sequence quality with the resulting data incorporated into a new assembly. Finishing pipelines often require several rounds of this process to completely finish a microbial genome, depending on the genome complexity, as well as the amount and types of data used. Using any of the sequencing technologies, repetitive DNA has always caused the greatest havoc in finishing a genome. Without adequate mate pairs (paired reads of known or unknown distance from one another) that span repeats or without software to take this information into account, the result is often misassemblies of some type. Complicating matters for finishing is the fact that for most new NGS technologies, paired-end sequencing methods are extremely difficult (see Section 2.2). Tandem repeats, a sequence repeated end to end such that its total length is larger than a read or than paired reads, are the most difficult of challenges, particularly if there is little variability between repeats and the total length is very large, making physical size estimates (e.g., running PCR products on a gel) difficult. Shorter reads exacerbate the repeat-solving issues. Other costly and difficult regions include so-called hard-stops: regions where all reads appear to magically end, often due to secondary structure that impedes the sequencing process. Regions with exceptionally high GC or highly palindromic sequences are often recalcitrant to most finishing reactions, including those with added DNA relaxants. One initial apprehension of using novel sequencing approaches was the fear of unreliable data in the form of high error rates and biases. While the increased throughput allows for higher coverage and addresses in part any higher error rates, reproducible errors such as homopolymer base additions/ deletions using pyrosequencing technology have required additional handling by finishers. This and other errors inherent in new technology processes (e.g., in emulsion PCR steps), or the low quality or lack of coverage found in some genomic regions, can all be addressed by complementing one of the NGS technologies with another (Aury et al., 2008; Goldberg et al., 2006). Many of these lessons in finishing are still being discovered; thus tailoring finishing strategies and software to these NGS technologies is constantly undergoing improvements. In part due to these difficulties, the increased burden of finishing and closing more gaps, and the frenetic pace with which microbial genomes can now be sequenced, most sequencing centers have been forced to reevaluate their commitment to finishing the genomes they draft. This has in turn driven the formalization of new “categories” of genome products, from Draft, to High-Quality Draft, to Improved High-Quality Draft, to Noncontiguous Finished, to Finished (Chain et al., 2009). While Finished continues to be the
306
Patrick S. G. Chain et al.
gold standard where there are no remaining gaps or misassemblies and the error rate is less than 1 in 100,000 bp, Draft now specifically means the raw assembled data from a sequencing procedure, with no additional processing. The additional categories cover various stages of genome improvement and are not meant to be technology specific. While the ideal target would be Finished for all genome projects, the costs associated with this step, particularly in comparison with draft genome sequencing, make this untenable. It is critical for downstream steps, however, to understand what level of finishing has been accomplished before performing and interpreting annotation and subsequent analysis.
4. Apre`s Sequencing 4.1. Annotation Once one of the finishing levels is reached, defining the functional components of the genome is performed in order to assess metabolic and other functional capabilities as well as to provide higher-level comparisons (e.g., at the protein level). Annotation is essentially the extraction and assignment of biological knowledge to nucleotide sequences based on evolutionary principles. Annotation is a multilevel process that can consist of prediction and labeling not only of genes but also of pseudogenes, promoter regions, RNA genes (rRNAs, tRNAs, and other small RNAs), and untranslated regions (Fig. 12.2). Further genomic details, such as origins of replication, mobile elements (including prophages), pathogenicity islands, etc., can also be detailed within annotation files, but are not often performed due to scarcity of automated tools. Although gene-finding efforts have themselves been automated, as have the annotation of called genes, all such tools are far from perfect. The difficulties in correcting gene calls and gene product functional assignments are beyond the scope of this overview and are partly covered elsewhere (e.g., Overbeek et al., 2007; Poptsova and Gogarten, 2010). Additional complications have arisen in the recent past due to inadequately coupling information on assembly quality with automated gene calls. For example, some NGS technologies result in inaccurate sequence in downstream assemblies due to reproducible errors (e.g., pyrosequencing has a well-known issue with homopolymeric regions, with reproducible small insertion or deletion errors). There are two mainstream and complementary approaches to gene prediction, which is the first step in genome annotation (Fig. 12.2). Ab initio gene finding relies on intrinsic properties of DNA sequence (e.g., di-, tri-, and tetranucleotide composition) to facilitate discrimination between coding and noncoding regions. When combined with evidence-based gene prediction, where similarity to known genes is used for calling genes
307
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
No
Want inhouse pipeline?
Yes Want independent programs?
No
Yes
Annotation
Gene prediction
No
Web-based gene prediction and annotation pipeline
Installable prebuilt gene prediction and annotation pipeline (customizable)
Web-based analysis package
ab initio Gene prediction:
Reference genome?
Evidence-based gene prediction
Transfer gene predictions
Transfer annotation
Customized annotation package
Custom analyses that may include any available tools, packages, databases
Analysis
Locally installable package (customizable)
Yes
General features, repetitive elements
Metabolic pathways transporters, protein secretion,
Promoter analysis, regulon analysis
Small RNAs, IS elements, prophages, plasmids
Comparative analysis, phylogenetic profiling
Unique genes, SNPs, INDELs, pseudogenes, reductive evolution analysis
Figure 12.2 Analyzing nitrifier genomes after sequencing is complete. Depending on the level of automation desired, there exist several possibilities and software packages for gene prediction, annotation, and whole genome analysis.
(e.g., using BLAST), the results are generally good in terms of identifying genes. Alone, evidence-based methods function poorly when interrogating genomes of novel lineages, and ab initio methods miss a number of genes with composition profiles different from the remainder of the genome (e.g., some regions of recent lateral gene transfer). A number of commonly used gene callers exist and are listed in Table 12.4a. In addition to identifying proteincoding genes, ribosomal RNA operons are generally found via similarity to known rRNA sequences, while transfer RNAs can be reliably identified using tRNAscan-SE (Lowe and Eddy, 1997). Other genomic features are not normally found or defined as part of automated pipelines, although there do exist a few implementable tools to do some of the required searches (Langille and Brinkman, 2009; Mantri and Williams, 2004). Once protein-coding genes have been found, a large number of similarity searches are generally performed in order to transfer “annotations” based on sequence similarity (e.g., product description, protein family membership, etc.). A number of databases and utilities for describing the products of
Table 12.4 Software and Web servers for genome annotation
(a) Gene prediction and associated programs CRITICA http://www.ttaxus.com/software.html Prodigal http://compbio.ornl.gov/prodigal Glimmer3 http://www.cbcb.umd.edu/software/glimmer Genemark http://exon.biology.gatech.edu MetaGene http://metagene.cb.k.u-tokyo.ac.jp TMHMM http://www.cbs.dtu.dk/services/TMHMM SignalP http://www.cbs.dtu.dk/services/SignalP tRNAscan-SE http://lowelab.ucsc.edu/tRNAscan-SE (b) Annotation resources COG http://www.ncbi.nlm.nih.gov/COG eggnog http://eggnog.embl.de. PHOG http://phylofacts.berkeley.edu/orthologs Pfam http://pfam.janelia.org TIGRfam http://www.jcvi.org/cms/research/projects/tigrfams/ overview KEGG http://www.genome.jp/kegg ProtClustDB http://www.ncbi.nlm.nih.gov/sites/entrez? db¼proteinclusters Interpro http://www.ebi.ac.uk/interpro GenBank http://www.ncbi.nlm.nih.gov/sutils/genom_table.cgi Genomes GO http://www.geneontology.org/GO.downloads. annotations.shtml Prosite http://www.expasy.ch/prosite STRING http://string.embl.de
Badger and Olsen (1999) Hyatt et al. (2010) Delcher et al. (2007) Lukashin and Borodovsky (1998), Besemer et al. (2001) Noguchi et al. (2006, 2008) Krogh et al. (2001) Bendtsen et al. (2004) Lowe and Eddy (1997) Tatusov et al. (1997), Tatusov et al. (2003) Jensen et al. (2008), Muller et al. (2010) Datta et al. (2009) Finn et al. (2010) Haft et al. (2003) Kanehisa and Goto (2000), Kanehisa et al. (2010) Klimke et al. (2009) Hunter et al. (2009) Cummings et al. (2002) Ashburner and Lewis (2002) Sigrist et al. (2010) Jensen et al. (2009)
(c) Web-based annotation packages and pipelines IMG-ER http://img.jgi.doe.gov/cgi-bin/pub/main.cgi RAST http://rast.nmpdr.org JCVI http://www.jcvi.org/cms/research/projects/annotationservice IGS http://ae.igs.umaryland.edu/cgi/index.cgi xBASE http://www.xbase.ac.uk/annotation BASys http://basys.ca/basys/cgi/submit.pl Ergatis http://ergatis.sourceforge.net DIYA http://gmod.org/wiki/DIYA CG-Pipeline http://wiki.jordan.biology.gatech.edu/index.php/ CG-Pipeline PGAAP http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline. html
Markowitz et al. (2009) Aziz et al. (2008) NA NA Chaudhuri et al. (2008) Van Domselaar et al. (2005) Orvis et al. (2010) Stewart et al. (2009) NA NA
(a) Some widely used gene-finding and associated tools, (b) some popular databases for assigning product function/description, (c) some complete annotation packages and pipelines.
310
Patrick S. G. Chain et al.
protein-coding genes are listed in Table 12.4b. The gene-coding regions found by gene prediction programs are searched against these resources and annotations are assigned based on a scoring threshold. This remains an imperfect process due to the fact that each database maintains its own scoring matrices, many of the databases are populated with erroneous data, and there are often contradictions between scoring annotation assignments of the same gene, making the selection process more difficult. While every annotation pipeline differs in a number of aspects, many of the databases and the methods of query are similar; thus here we provide a brief overview of the process and provide options for using or building an annotation pipeline. Because annotation is a multistep process (Fig. 12.2), which requires the integration of a large number of tools for specific genomic features, interoperability of tools for gene finding, assignment of functions and other descriptions, and the ability to visualize such annotations and associated evidence have hampered many independent annotation efforts. Although past efforts were strictly within large genome centers, a number of publicly available tools or resources have surfaced (Table 12.4c) that begin to encompass three critical annotation components: (1) an integrated set of tools and information-rich databases for gene calling and function assignment; (2) a data management system and repository for storing and tracking annotations; and (3) an interactive graphical user interface for presentation of results, evidence, and context. As the advances in decreasing costs and increasing the democratization of sequencing continues, an increasing number of investigators will be relying on such pipelines for annotation of their favorite genomes. A few user friendly Web-based platforms exist that only require formatted short reads, contigs, or chromosomes as input and provide reusable analytical pipelines, such as helping users search a number of resources, executing downstream analysis (i.e., phylogenic analysis, etc.), visualizing and storing the results (Table 12.4c). A recent study compared the annotation capabilities of IMG-ER (Markowitz et al., 2009), RAST (Aziz et al., 2008; Meyer et al., 2008), and JCVI (http://www.jcvi.org/cms/research/ projects/annotation-service/), and while all three were comparable in their abilities to identify genes (though certainly not identical), none of them provided an all inclusive package for genome annotation and analysis (Bakke et al., 2009). Gene calling and annotation standards, such as those proposed for genome finishing, would certainly provide a more solid foundation for future annotation efforts. In the meantime, it may not always be obvious which platform to adopt, since metrics for annotation quality are not well defined. Some of the drawbacks of relying on Web services include turnaround time for annotation, the lack of flexibility in terms of programs, databases, and threshold cutoffs, among others.
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
311
As an alternative to Web services, there exist several semi-stand-alone pipeline packages or workflow systems available for local installation (Table 12.4c). The major drawback of this approach is the knowledge and expertise necessary to integrate the various components and auxiliary tools within the system, as well as hardware requirements. However, for laboratories that conduct bioinformatics research, it may be more beneficial to install a highly flexible pipeline that can integrate gene calling, annotation, analysis, and tools to link to specialized databases that do not necessarily apply to all projects. A number of packages are available through opensource licenses and are composed of multiple gene prediction and protein annotation programs that can be linked together within a computational pipeline (Table 12.4c). As the number of genomes and genome annotations continue to increase, and at a more rapid pace, it has become imperative to provide a reliable resource for future use in comparative genomics, phylogenetics and molecular evolution studies, and ironically, better annotations.
4.2. Comparative analysis While a thorough annotation makes use of comparisons with known proteins or protein features, a more detailed comparison is often sought after sequencing. The specific type or level of comparison is generally highly project specific, but here we discuss a number of ways to perform genome comparisons and why such approaches may be useful (Fig. 12.2). For nitrifier genomes, because there are already a number of lineages sequenced, many options are possible. It is still likely that a number of undiscovered lineages exist, and thus a number of future genome projects will have no near-neighbor reference genome to guide a number of analyses. In the cases where no close relative’s genome is available, protein-based comparisons are used. Ideally, comparisons would be made on similarly annotated genomes (i.e., using similar or identical platforms/methods). When comparing genomes, the most interesting aspects are generally in what is common or distinct between them, thus finding orthologs (often using a bidirectional best BLAST hit approach) is one of the first objectives. One can define candidate orthologs, unique proteins, as well as potential gene family expansions (paralogs). Physiological and phenotypic capabilities are often “transferred” from the reference genome to the newly sequenced genome if the pathway components are present. Such transfers often facilitate detailed comparisons by allowing fast and accurate verification and validation of annotations and pathways obtained with automated annotation (see Section 4.1 above). In a similar fashion, by examining differences in protein profiles, inactive pathways or novel functions may be found. In the rare cases where a nitrifier would be so novel that no direct comparisons can be made, several de novo pathway inference and metabolic reconstructions can be made.
312
Patrick S. G. Chain et al.
If the newly sequenced genome has a close relative, more direct methods can be applied. Whole genome alignments can be performed using a number of different algorithms, though tBLASTx is most sensitive in comparing genome sequences together since it translates DNA sequence into all six reading frames of both reference and query before looking for protein similarities. This also has the advantage of not relying on annotated features, which may differ between genomes despite identical sequence. By comparing presence and absence of genes among all nitrifiers (phylogenetic profiling), it may be possible to discover divergences in metabolic pathways that do not correlate with phylogeny. For the ever-elusive hypothetical and conserved hypothetical genes which have no known function, focusing on gene to gene proximity, or a gene’s environment, functional prediction may be ascribed since genes with related functions (i.e., enzymes of the same metabolic pathway) tend to cluster together on the chromosome. For highly similar genomes, other tools such as MUMmer (Kurtz et al., 2004) can be used to quickly align entire genomes. By processing the output data, genome rearrangements, insertion/deletions, and even single nucleotide polymorphisms (SNPs) can be derived in terms of precise coordinates and resulting effect(s) at the protein, and pathway, levels. Such detailed analyses will also reveal the movement of mobile elements, phage-induced deletions, and genomic rearrangements, as well as unique restriction modification systems. These could imply evolutionary pressures that led to species- or type-specific differences in physiologies. As is common in the field of genomics, the results of one stage of analysis is simply the starting point for a myriad of other inquiries; the same is true for comparative analysis, which highlights those regions of the genome that may be further interrogated in order to better understand specific functions.
5. Outlook: The Next Frontier Many genomics methods to sequence nitrifier and other microbial genomes are being used currently, and due to improvements in cost, the output is increasing at a phenomenal pace. New sequencing technologies are already being used (e.g., Table 12.2), and more are yet to enter the sequencing market. All of these NGS technologies hold great promise for de novo microbial sequencing, as well as genome resequencing (i.e., sequencing closely related strains of the same species). While this type of “pan-genomic” effort (Medini et al., 2005) has not yet been applied to nitrifiers, the methods to quickly use reference genomes for the mapping of sequencing data have been well established (Li and Homer, 2010). As sequencing continues to become inexpensive and fast, the bottleneck has shifted to obtaining sufficient biomass for adequate sample preparation. For nitrifiers, this often
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
313
remains a difficult issue to resolve. Fortunately, NGS technologies and their associated throughput, combined with new developments in assembly of such vast amounts of data, have ushered in a new era of metagenomics, whereby entire communities can be sequenced (Qin et al., 2010). For some communities dominated by nitrifiers, such as in some sewage treatment plants, this approach could help delineate the genomes of entire populations of nitrifiers. A future focus for nitrifier research may thus be outside the confined context of the laboratory, in the natural environment. Other technologies such as flow cytometry may be coupled with advances in molecular amplification of minute quantities of nucleic acids and NGS to overcome sample preparation difficulties or to tackle nitrifier populations that play an important environmental role yet are not dominant within mixed communities. Application of single cell/NGS technologies to nitrification is already underway as researchers at the Bigelow Laboratory for Ocean Sciences will be amplifying genomic DNA from an individual cell of a newly discovered marine nitrite oxidizer, Nitrospina sp. SCGC AAA288L16, for sequencing by the JGI (http://www.jgi.doe.gov/sequencing/why/ mesopelagic-bacterioplankton.html). In addition, studies to investigate the diversity of ammonia oxidizers, that have used amo gene-targeted PCR (Norton et al., 2002; Ward and O’Mullan, 2002), are beginning to be adapted to the much higher-throughput NGS platforms using analytical methods originally designed to accommodate classification of 16S rRNA sequences. As new technologies continue to unfold, and as democratization of sequencing increases, it is inevitable that more and more laboratories will be performing one or a combination of the above methods, applied to one or more of the above samples, in order to gain greater insight into the nitrification process and the microbes that perform this essential function.
ACKNOWLEDGMENTS We thank all other B6 members for their contributions to the establishment of standardized methods, development of software and processes, and genome projects described in this chapter. This study was supported in part by the U.S. Department of Energy Joint Genome Institute through the Office of Science of the U.S. Department of Energy under Contract Number DE-AC02-05CH11231 and grants from NIH (Y1-DE-6006-02), the U.S. Department of Homeland Security under contract number HSHQDC08X00790, and the U.S. Defense Threat Reduction Agency under contract numbers B104153I and B084531I.
REFERENCES Altmann, D., Stief, P., Amann, R., De Beer, D., and Schramm, A. (2003). In situ distribution and activity of nitrifying bacteria in freshwater sediment. Environ. Microbiol. 5, 798–803. Arp, D. J., Chain, P. S., and Klotz, M. G. (2007). The impact of genome analyses on our understanding of ammonia-oxidizing bacteria. Annu. Rev. Microbiol. 61, 503–528.
314
Patrick S. G. Chain et al.
Ashburner, M., and Lewis, S. (2002). On ontologies for biologists: The Gene Ontology— Untangling the web. Novartis Found. Symp. 247, 66–80, discussion 80–63, 84–90, 244– 252. Aury, J. M., Cruaud, C., Barbe, V., Rogier, O., Mangenot, S., Samson, G., et al. (2008). High quality draft sequences for prokaryotic genomes using a mix of new sequencing technologies. BMC Genomics 9, 603. Aziz, R. K., Bartels, D., Best, A. A., DeJongh, M., Disz, T., Edwards, R. A., et al. (2008). The RAST Server: Rapid annotations using subsystems technology. BMC Genomics 9, 75. Badger, J. H., and Olsen, G. J. (1999). CRITICA: Coding region identification tool invoking comparative analysis. Mol. Biol. Evol. 16, 512–524. Bakke, P., Carney, N., Deloache, W., Gearing, M., Ingvorsen, K., Lotz, M., et al. (2009). Evaluation of three automated genome annotations for Halorhabdus utahensis. PLoS One 4, e6291. Bendtsen, J. D., Nielsen, H., von Heijne, G., and Brunak, S. (2004). Improved prediction of signal peptides: SignalP 3.0. J. Mol. Biol. 340, 783–795. Benson, D. A., Karsch-Mizrachi, I., Lipman, D. J., Ostell, J., and Sayers, E. W. (2010). GenBank. Nucleic Acids Res. 38, D46–D51. Besemer, J., Lomsadze, A., and Borodovsky, M. (2001). GeneMarkS: A self-training method for prediction of gene starts in microbial genomes. Implications for finding sequence motifs in regulatory regions. Nucleic Acids Res. 29, 2607–2618. Birren, B., Green, E. D., Klapholz, S., Myers, R. M., Riethman, H., and Roskams, J. (1997). Bacterial artificial chromosomes. In “Genome Analysis: A Laboratory Manual,” (B. Birren, ed.)Vol. 3, pp. 242–295. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. Boisvert, S., Laviolette, F., and Corbeil, J. (2010). Ray: Simultaneous assembly of reads from a mix of high-throughput sequencing technologies. J. Comput. Biol. 17, 1519–1533. Butler, J., MacCallum, I., Kleber, M., Shlyakhter, I. A., Belmonte, M. K., Lander, E. S., et al. (2008). ALLPATHS: De novo assembly of whole-genome shotgun microreads. Genome Res. 18, 810–820. Chain, P., Lamerdin, J., Larimer, F., Regala, W., Lao, V., Land, M., et al. (2003). Complete genome sequence of the ammonia-oxidizing bacterium and obligate chemolithoautotroph Nitrosomonas europaea. J. Bacteriol. 185, 2759–2773. Chain, P. S., Grafham, D. V., Fulton, R. S., Fitzgerald, M. G., Hostetler, J., Muzny, D., et al. (2009). Genomics. Genome project standards in a new era of sequencing. Science 326, 236–237. Chaisson, M. J., Brinza, D., and Pevzner, P. A. (2009). De novo fragment assembly with short mate-paired reads: Does the read length matter? Genome Res. 19, 336–346. Chaudhuri, R. R., Loman, N. J., Snyder, L. A., Bailey, C. M., Stekel, D. J., and Pallen, M. J. (2008). xBASE2: A comprehensive resource for comparative bacterial genomics. Nucleic Acids Res. 36, D543–D546. Cummings, L., Riley, L., Black, L., Souvorov, A., Resenchuk, S., Dondoshansky, I., and Tatusova, T. (2002). Genomic BLAST: Custom-defined virtual databases for complete and unfinished genomes. FEMS Microbiol. Lett. 216, 133–138. Daims, H., Nielsen, J. L., Nielsen, P. H., Schleifer, K. H., and Wagner, M. (2001). In situ characterization of Nitrospira-like nitrite-oxidizing bacteria active in wastewater treatment plants. Appl. Environ. Microbiol. 67, 5273–5284. Datta, R. S., Meacham, C., Samad, B., Neyer, C., and Sjolander, K. (2009). Berkeley PHOG: PhyloFacts orthology group prediction web server. Nucleic Acids Res. 37, W84–W89. Delcher, A. L., Bratke, K. A., Powers, E. C., and Salzberg, S. L. (2007). Identifying bacterial genes and endosymbiont DNA with Glimmer. Bioinformatics 23, 673–679. Finn, R. D., Mistry, J., Tate, J., Coggill, P., Heger, A., Pollington, J. E., et al. (2010). The Pfam protein families database. Nucleic Acids Res. 38, D211–D222.
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
315
Fleischmann, R. D., Adams, M. D., White, O., Clayton, R. A., Kirkness, E. F., Kerlavage, A. R., et al. (1995). Whole-genome random sequencing and assembly of Haemophilus influenzae Rd. Science 269, 496–512. Francis, C. A., Roberts, K. J., Beman, J. M., Santoro, A. E., and Oakley, B. B. (2005). Ubiquity and diversity of ammonia-oxidizing archaea in water columns and sediments of the ocean. Proc. Natl. Acad. Sci. USA 102, 14683–14688. Freitag, T. E., Chang, L., Clegg, C. D., and Prosser, J. I. (2005). Influence of inorganic nitrogen management regime on the diversity of nitrite-oxidizing bacteria in agricultural grassland soils. Appl. Environ. Microbiol. 71, 8323–8334. Goldberg, S. M., Johnson, J., Busam, D., Feldblyum, T., Ferriera, S., Friedman, R., et al. (2006). A Sanger/pyrosequencing hybrid approach for the generation of high-quality draft assemblies of marine microbial genomes. Proc. Natl. Acad. Sci. USA 103, 11240–11245. Haft, D. H., Selengut, J. D., and White, O. (2003). The TIGRFAMs database of protein families. Nucleic Acids Res. 31, 371–373. Hallam, S. J., Konstantinidis, K. T., Putnam, N., Schleper, C., Watanabe, Y., Sugahara, J., et al. (2006). Genomic analysis of the uncultivated marine crenarchaeote Cenarchaeum symbiosum. Proc. Natl. Acad. Sci. USA 103, 18296–18301. Hernandez, D., Francois, P., Farinelli, L., Osteras, M., and Schrenzel, J. (2008). De novo bacterial genome sequencing: Millions of very short reads assembled on a desktop computer. Genome Res. 18, 802–809. Hossain, M. S., Azimi, N., and Skiena, S. (2009). Crystallizing short-read assemblies around seeds. BMC Bioinform. 10(Suppl. 1), S16. Hunter, S., Apweiler, R., Attwood, T. K., Bairoch, A., Bateman, A., Binns, D., et al. (2009). InterPro: The integrative protein signature database. Nucleic Acids Res. 37, D211–D215. Hyatt, D., Chen, G. L., Locascio, P. F., Land, M. L., Larimer, F. W., and Hauser, L. J. (2010). Prodigal: Prokaryotic gene recognition and translation initiation site identification. BMC Bioinform. 11, 119. Illumina (2008). Preparing Samples for Sequencing Genomic DNA. Illumina, Inc., San Diego, CA. Illumina (2009). Cluster Station Operations Guide. Illumina, Inc., San Diego, CA. Jensen, L. J., Julien, P., Kuhn, M., von Mering, C., Muller, J., Doerks, T., and Bork, P. (2008). eggNOG: Automated construction and annotation of orthologous groups of genes. Nucleic Acids Res. 36, D250–D254. Jensen, L. J., Kuhn, M., Stark, M., Chaffron, S., Creevey, C., Muller, J., et al. (2009). STRING 8—A global view on proteins and their functional interactions in 630 organisms. Nucleic Acids Res. 37, D412–D416. Kanehisa, M., and Goto, S. (2000). KEGG: Kyoto encyclopedia of genes and genomes. Nucleic Acids Res. 28, 27–30. Kanehisa, M., Goto, S., Furumichi, M., Tanabe, M., and Hirakawa, M. (2010). KEGG for representation and analysis of molecular networks involving diseases and drugs. Nucleic Acids Res. 38, D355–D360. Klimke, W., Agarwala, R., Badretdin, A., Chetvernin, S., Ciufo, S., Fedorov, B., et al. (2009). The National Center for Biotechnology Information’s Protein Clusters Database. Nucleic Acids Res. 37, D216–D223. Klotz, M. G., Arp, D. J., Chain, P. S., El-Sheikh, A. F., Hauser, L. J., Hommes, N. G., et al. (2006). Complete genome sequence of the marine, chemolithoautotrophic, ammoniaoxidizing bacterium Nitrosococcus oceani ATCC 19707. Appl. Environ. Microbiol. 72, 6299–6315. Konneke, M., Bernhard, A. E., de la Torre, J. R., Walker, C. B., Waterbury, J. B., and Stahl, D. A. (2005). Isolation of an autotrophic ammonia-oxidizing marine archaeon. Nature 437, 543–546.
316
Patrick S. G. Chain et al.
Kozarewa, I., Ning, Z., Quail, M. A., Sanders, M. J., Berriman, M., and Turner, D. J. (2009). Amplification-free Illumina sequencing-library preparation facilitates improved mapping and assembly of (GþC)-biased genomes. Nat. Methods 6, 291–295. Krogh, A., Larsson, B., von Heijne, G., and Sonnhammer, E. L. (2001). Predicting transmembrane protein topology with a hidden Markov model: Application to complete genomes. J. Mol. Biol. 305, 567–580. Kurtz, S., Phillippy, A., Delcher, A. L., Smoot, M., Shumway, M., Antonescu, C., and Salzberg, S. L. (2004). Versatile and open software for comparing large genomes. Genome Biol. 5, R12. Langille, M. G., and Brinkman, F. S. (2009). IslandViewer: An integrated interface for computational identification and visualization of genomic islands. Bioinformatics 25, 664–665. Lebedeva, E. V., Alawi, M., Fiencke, C., Namsaraev, B., Bock, E., and Spieck, E. (2005). Moderately thermophilic nitrifying bacteria from a hot spring of the Baikal rift zone. FEMS Microbiol. Ecol. 54, 297–306. Lebedeva, E. V., Alawi, M., Maixner, F., Jozsa, P. G., Daims, H., and Spieck, E. (2008). Physiological and phylogenetic characterization of a novel lithoautotrophic nitriteoxidizing bacterium, ‘Candidatus Nitrospira bockiana’. Int. J. Syst. Evol. Microbiol. 58, 242–250. Leininger, S., Urich, T., Schloter, M., Schwark, L., Qi, J., Nicol, G. W., et al. (2006). Archaea predominate among ammonia-oxidizing prokaryotes in soils. Nature 442, 806–809. Li, H., and Homer, N. (2010). A survey of sequence alignment algorithms for nextgeneration sequencing. Brief. Bioinform. 11, 473–483. Li, R., Zhu, H., Ruan, J., Qian, W., Fang, X., Shi, Z., et al. (2010). De novo assembly of human genomes with massively parallel short read sequencing. Genome Res. 20, 265–272. Lowe, T. M., and Eddy, S. R. (1997). tRNAscan-SE: A program for improved detection of transfer RNA genes in genomic sequence. Nucleic Acids Res. 25, 955–964. Lucker, S., Wagner, M., Maixner, F., Pelletier, E., Koch, H., Vacherie, B., et al. (2010). A Nitrospira metagenome illuminates the physiology and evolution of globally important nitrite-oxidizing bacteria. Proc. Natl. Acad. Sci. USA 107, 13479–13484. Lukashin, A. V., and Borodovsky, M. (1998). GeneMark.hmm: New solutions for gene finding. Nucleic Acids Res. 26, 1107–1115. Mantri, Y., and Williams, K. P. (2004). Islander: A database of integrative islands in prokaryotic genomes, the associated integrases and their DNA site specificities. Nucleic Acids Res. 32, D55–D58. Margulies, M., Egholm, M., Altman, W. E., Attiya, S., Bader, J. S., Bemben, L. A., et al. (2005). Genome sequencing in microfabricated high-density picolitre reactors. Nature 437, 376–380. Markowitz, V. M., Mavromatis, K., Ivanova, N. N., Chen, I. M., Chu, K., and Kyrpides, N. C. (2009). IMG ER: A system for microbial genome annotation expert review and curation. Bioinformatics 25, 2271–2278. Medini, D., Donati, C., Tettelin, H., Masignani, V., and Rappuoli, R. (2005). The microbial pan-genome. Curr. Opin. Genet. Dev. 15, 589–594. Meyer, F., Paarmann, D., D’Souza, M., Olson, R., Glass, E. M., Kubal, M., et al. (2008). The metagenomics RAST server—A public resource for the automatic phylogenetic and functional analysis of metagenomes. BMC Bioinform. 9, 386. Miller, J. R., Delcher, A. L., Koren, S., Venter, E., Walenz, B. P., Brownley, A., et al. (2008). Aggressive assembly of pyrosequencing reads with mates. Bioinformatics 24, 2818–2824. Miller, J. R., Koren, S., and Sutton, G. (2010). Assembly algorithms for next-generation sequencing data. Genomics 95, 315–327.
Genomics for Key Players in the N Cycle: From Guinea Pigs to the Next Frontier
317
Muller, J., Szklarczyk, D., Julien, P., Letunic, I., Roth, A., Kuhn, M., et al. (2010). eggNOG v2.0: Extending the evolutionary genealogy of genes with enhanced non-supervised orthologous groups, species and functional annotations. Nucleic Acids Res. 38, D190–D195. Noguchi, H., Park, J., and Takagi, T. (2006). MetaGene: Prokaryotic gene finding from environmental genome shotgun sequences. Nucleic Acids Res. 34, 5623–5630. Noguchi, H., Taniguchi, T., and Itoh, T. (2008). MetaGeneAnnotator: Detecting speciesspecific patterns of ribosomal binding site for precise gene prediction in anonymous prokaryotic and phage genomes. DNA Res. 15, 387–396. Norton, J. M., Alzerreca, J. J., Suwa, Y., and Klotz, M. G. (2002). Diversity of ammonia monooxygenase operon in autotrophic ammonia-oxidizing bacteria. Arch. Microbiol. 177, 139–149. Norton, J. M., Klotz, M. G., Stein, L. Y., Arp, D. J., Bottomley, P. J., Chain, P. S., et al. (2008). Complete genome sequence of Nitrosospira multiformis, an ammonia-oxidizing bacterium from the soil environment. Appl. Environ. Microbiol. 74, 3559–3572. Orvis, J., Crabtree, J., Galens, K., Gussman, A., Inman, J. M., Lee, E., et al. (2010). Ergatis: A web interface and scalable software system for bioinformatics workflows. Bioinformatics 26, 1488–1492. Overbeek, R., Bartels, D., Vonstein, V., and Meyer, F. (2007). Annotation of bacterial and archaeal genomes: Improving accuracy and consistency. Chem. Rev. 107, 3431–3447. Park, B. J., Park, S. J., Yoon, D. N., Schouten, S., Sinninghe Damste, J. S., and Rhee, S. K. (2010). Cultivation of autotrophic ammonia-oxidizing archaea from marine sediments in co-culture with sulfur-oxidizing bacteria. Appl. Environ. Microbiol. 76, 7575–7587. Pinard, R., de Winter, A., Sarkis, G. J., Gerstein, M. B., Tartaro, K. R., Plant, R. N., et al. (2006). Assessment of whole genome amplification-induced bias through high-throughput, massively parallel whole genome sequencing. BMC Genomics 7, 216. Pop, M. (2009). Genome assembly reborn: Recent computational challenges. Brief. Bioinform. 10, 354–366. Poptsova, M. S., and Gogarten, J. P. (2010). Using comparative genome analysis to identify problems in annotated microbial genomes. Microbiology 156, 1909–1917. Prosser, J. I., and Nicol, G. W. (2008). Relative contributions of archaea and bacteria to aerobic ammonia oxidation in the environment. Environ. Microbiol. 10, 2931–2941. Qin, J., Li, R., Raes, J., Arumugam, M., Burgdorf, K. S., Manichanh, C., et al. (2010). A human gut microbial gene catalogue established by metagenomic sequencing. Nature 464, 59–65. Quail, M. A., Kozarewa, I., Smith, F., Scally, A., Stephens, P. J., Durbin, R., et al. (2008). A large genome center’s improvements to the Illumina sequencing system. Nat. Methods 5, 1005–1010. Roche (2009a). General library preparation method manual. In GS FLX Titanium Roche Diagnostics GmbH, Mannheim, Germany. Roche (2009b). Multi span paired end libraries: Guidelines and additional information. Technical Bulletin Number. Roche 454. Roche (2009c). Paired end library preparation method manual—20 kb and 8 kb span. In GS FLX Titanium. Roche Diagnostics GmbH, Mannheim, Germany. Santoro, A. E., Casciotti, K. L., and Francis, C. A. (2010). Activity, abundance and diversity of nitrifying archaea and bacteria in the central California Current. Environ. Microbiol. 12, 1989–2006. Schleper, C., Jurgens, G., and Jonuscheit, M. (2005). Genomic studies of uncultivated archaea. Nat. Rev. Microbiol. 3, 479–488. Sigrist, C. J., Cerutti, L., de Castro, E., Langendijk-Genevaux, P. S., Bulliard, V., Bairoch, A., and Hulo, N. (2010). PROSITE, a protein domain database for functional characterization and annotation. Nucleic Acids Res. 38, D161–D166.
318
Patrick S. G. Chain et al.
Simpson, J. T., Wong, K., Jackman, S. D., Schein, J. E., Jones, S. J. M., and Birol, I. (2009). ABySS: A parallel assembler for short read sequence data. Genome Res. 19, 1117–1123. Starkenburg, S. R., Chain, P. S., Sayavedra-Soto, L. A., Hauser, L., Land, M. L., Larimer, F. W., et al. (2006). Genome sequence of the chemolithoautotrophic nitriteoxidizing bacterium Nitrobacter winogradskyi Nb-255. Appl. Environ. Microbiol. 72, 2050–2063. Starkenburg, S. R., Larimer, F. W., Stein, L. Y., Klotz, M. G., Chain, P. S., SayavedraSoto, L. A., et al. (2008). Complete genome sequence of Nitrobacter hamburgensis X14 and comparative genomic analysis of species within the genus Nitrobacter. Appl. Environ. Microbiol. 74, 2852–2863. Stein, L. Y., Arp, D. J., Berube, P. M., Chain, P. S., Hauser, L., Jetten, M. S., et al. (2007). Whole-genome analysis of the ammonia-oxidizing bacterium, Nitrosomonas eutropha C91: Implications for niche adaptation. Environ. Microbiol. 9, 2993–3007. Stewart, A. C., Osborne, B., and Read, T. D. (2009). DIYA: A bacterial annotation pipeline for any genomics lab. Bioinformatics 25, 962–963. Tatusov, R. L., Koonin, E. V., and Lipman, D. J. (1997). A genomic perspective on protein families. Science 278, 631–637. Tatusov, R. L., Fedorova, N. D., Jackson, J. D., Jacobs, A. R., Kiryutin, B., Koonin, E. V., et al. (2003). The COG database: An updated version includes eukaryotes. BMC Bioinform. 4, 41. Treusch, A. H., Kletzin, A., Raddatz, G., Ochsenreiter, T., Quaiser, A., Meurer, G., et al. (2004). Characterization of large-insert DNA libraries from soil for environmental genomic studies of Archaea. Environ. Microbiol. 6, 970–980. Van Domselaar, G. H., Stothard, P., Shrivastava, S., Cruz, J. A., Guo, A., Dong, X., et al. (2005). BASys: A web server for automated bacterial genome annotation. Nucleic Acids Res. 33, W455–W459. Venter, J. C., Remington, K., Heidelberg, J. F., Halpern, A. L., Rusch, D., Eisen, J. A., et al. (2004). Environmental genome shotgun sequencing of the Sargasso Sea. Science 304, 66–74. Walker, C. B., de la Torre, J. R., Klotz, M. G., Urakawa, H., Pinel, N., Arp, D. J., et al. (2010). Nitrosopumilus maritimus genome reveals unique mechanisms for nitrification and autotrophy in globally distributed marine crenarchaea. Proc. Natl. Acad. Sci. USA 107, 8818–8823. Ward, B. B., and O’Mullan, G. D. (2002). Worldwide distribution of Nitrosococcus oceani, a marine ammonia-oxidizing gamma-proteobacterium, detected by PCR and sequencing of 16S rRNA and amoA genes. Appl. Environ. Microbiol. 68, 4153–4157. Williams, R., Peisajovich, S. G., Miller, O. J., Magdassi, S., Tawfik, D. S., and Griffiths, A. D. (2006). Amplification of complex gene libraries by emulsion PCR. Nat. Methods 3, 545–550. Wood, H. M., Belvedere, O., Conway, C., Daly, C., Chalkley, R., Bickerdike, M., et al. (2010). Using next-generation sequencing for high resolution multiplex analysis of copy number variation from nanogram quantities of DNA from formalin-fixed paraffinembedded specimens. Nucleic Acids Res. 38, e151. Zerbino, D. R., and Birney, E. (2008). Velvet: Algorithms for de novo short read assembly using de Bruijn graphs. Genome Res. 18, 821–829.
C H A P T E R
T H I R T E E N
Preparation of High-Molecular Weight DNA and Metagenomic Libraries from Soils and Hot Springs Laila J. Reigstad,* Rita Bartossek,* and Christa Schleper*,† Contents 1. Introduction 1.1. Soil as habitat 1.2. Terrestrial hot springs as habitat 1.3. Construction of a metagenomic fosmid library: An overview 2. Protocols 2.1. Sampling and preservation of samples 2.2. Isolation of hmw DNA from environmental samples 2.3. DNA purification and size analysis using PFGE 2.4. Isolation of hmw DNA from agarose matrix 2.5. Cloning of hmw DNA 2.6. In vitro packaging of DNA into lambda bacteriophage heads 2.7. Infection of the E. coli host cells with lambda bacteriophages 2.8. Titration of the fosmid library 2.9. Quality testing of fosmid clones 3. Growing, Picking, Replicating, and Storage of the Fosmid Library 3.1. Screening of specific genes in the fosmid library 3.2. Fosmid sequencing 3.3. General conclusions References
320 322 322 323 324 324 325 330 332 335 336 336 337 337 338 340 341 341 342
Abstract Metagenomics has become an important tool for the characterization of microorganisms, as it is independent of their enrichment or cultivation in the laboratory. Its application has led to the discovery of metabolisms from widespread, yet uncharacterized organisms such as the ammonia-oxidizing archaea. Different approaches ranging from the generation of short sequence reads by direct use of high-throughput sequencing technologies to the construction and * Centre for Geobiology, Department of Biology, University of Bergen, Bergen, Norway Vienna Ecology Centre, Department of Genetics in Ecology, University of Vienna, Vienna, Austria
{
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00013-0
#
2011 Elsevier Inc. All rights reserved.
319
320
Laila J. Reigstad et al.
sequencing of large-insert DNA libraries are being employed. For these purposes, DNA of high quality needs to be prepared from an environmental sample, which is a particular challenge for soils and sediments. Here we describe the methods used for the isolation of high-molecular weight (hmw) DNA from soil and hot spring samples, the subsequent production of large-insert metagenomic libraries, and the analysis of the resulting genomic fragments. Detailed step-by-step procedures include (1) how to isolate good-quality hmw DNA from soils and mud; (2) how to prepare the DNA for cloning; (3) how to efficiently establish, grow, pick, replicate, and store the large-insert metagenomic fosmid library; and finally, (4) how to screen the library for genes of interest.
1. Introduction Metagenomic analyses are increasingly being performed to study the genomic potential of microorganisms that cannot be or have not been cultured in the laboratory (Delong, 2005; Handelsman, 2004; Treusch and Schleper, 2005). Unlike the study of isolated, individual microbial strains, the DNA used in metagenomic studies is extremely complex, reflecting the complexity of natural microbial communities. This chapter provides a guide to the isolation, purification, and use of high-molecular weight (hmw) DNA of high quality directly from environmental samples, in particular, from soils and hot spring sediments, and how to construct large-insert metagenomic libraries using this DNA. In contrast to the analysis of classical clone libraries of 16S rRNA or other genes, large-insert metagenomic libraries have proven to be a valuable tool in the exploration of the physiology, metabolism, and genetics of unknown microorganisms, as their use allows the integration of both phylogenetic and functional information of a particular taxon from a single contiguous genome fragment. The use of such libraries has been instrumental in identifying the metabolism of ammonia-oxidizing archaea in environmental samples (Hallam et al., 2006; Schleper et al., 2005; Treusch et al., 2005; Martin-Cuadrado et al., 2008). In fact, the use of large-insert metagenomic libraries to study archaea started long before their metabolism was known (Quaiser et al., 2002; Schleper et al., 1998; Stein et al., 1996; Treusch et al., 2004). The large-insert metagenomic approach is different from a high-throughput or shotgun sequencing analysis, in which short reads are generated either by conventional sequencing of small, cloned DNA fragments or by high-throughput (454) pyrosequencing technology (Venter et al., 2004; Yooseph et al., 2007). In these two latter approaches, genomic scaffolds can be generated to a certain extent by assembling single reads in silico. In the (more laborious) large-insert approach described here, large contiguous genome fragments are kept intact throughout the process, and assignment of genes from one fragment to a particular taxon is therefore
Metagenomic Libraries from Soils and Hot Springs
321
unambiguous. This approach is particularly useful for the characterization of microorganisms that are less abundant in the environment, and whose genomes can thus not be easily assembled from high-throughput sequencing data. However, it is also extremely useful for the closure of full genomes from organisms that are naturally highly enriched or have been grown in enrichments, that is, in co-culture with other organisms. For example, the full genome of the marine sponge symbiont, Cenarchaeum symbiosum, an archaeon belonging to a lineage of marine ammonia oxidizers, has been completed using large-insert metagenomic libraries (Hallam et al., 2006). Also the genome of the first anammox (anaerobic ammonium oxidizer) organism grown in enrichment cultures has been obtained and closed with metagenomic techniques (Strous et al., 2006). Several vectors exist for the cloning of large genomic inserts of even >100 kb in size (Monaco and Larin, 1994). Of these, bacterial artificial chromosome (BAC) vectors have been used successfully in initial metagenomic analyses (Beja et al., 2000b; Rondon et al., 2000). They are based on the F-(fertility) factor of Escherichia coli, which ensures maintenance of recombinant plasmids at only one to two copies per cell, thus avoiding intermolecular recombination events (Shizuya and Kouros-Mehr, 2001; Shizuya et al., 1992). In order to facilitate the cloning of large inserts with an increase in cloning efficiencies, hmw environmental DNA is now more often ligated into a fosmid vector, a derivative of the BAC vector, that contains cos sites like cosmids, for subsequent packaging of the ligated DNA into phage heads of the bacteriophage lambda (Kim et al., 1992). Compared to BAC cloning, the hybrid fosmid vector allows the generation of genomic libraries with a relatively even distribution of insert sizes (between 38 and 45 kb; Collins and Hohn, 1978) and a high transformation (¼infection) efficiency. There are many protocols for the isolation of hmw DNA for metagenomic studies as there are a range of challenges dictated by the nature and complexity of different samples. The first is to isolate hmw DNA of high purity and quality directly from an environmental sample. Second, it is the aim in most approaches that the resulting DNA is representative for the range of organisms present in the community (although this goal is difficult to achieve due to the relatively mild lysis procedures used). Third, one needs high concentrations of the high-purity hmw DNA so that the resulting library is large enough to cover a sufficient amount of the microbial diversity. The detailed protocols presented here summarize results from different scientists in our laboratory who have used metagenomic libraries to characterize the genomic potential of archaea and acidobacteria from moderate and hot environments (Bartossek et al., 2010; Quaiser et al., 2002; Schleper et al., 1998; Treusch and Schleper, 2005; Treusch et al., 2004, 2005; Reigstad and Schleper, unpublished data). They are modified from protocols developed earlier in other laboratories (DeLong, 2005; Stein et al., 1996) and represent
322
Laila J. Reigstad et al.
the result of years of struggle with complex samples from soils and terrestrial hot springs. This chapter will focus on these environments. However, the protocols have also been successfully applied to other samples, including marine sponges, freshwater liquids, microbial mats, and sediments. We also recommend to consult the protocols for the isolation of hmw DNA from environmental samples and the preparation of large-insert genomic libraries that have been published as online videos by Lee and Hallam (2009) and Taupp et al. (2009), respectively.
1.1. Soil as habitat There is not only a large diversity in the physicochemical properties of soils (e.g., from a dry, alkaline, low organic sandy soil to a wet, acidic, organicrich soil), but different habitat types and land-management regimens also have a profound effect on the microbial communities present (e.g., natural vs. managed soils, different fertilizer treatments, pristine vs. heavy metal or pesticide contaminated soils). Terrestrial ecosystems are likely to harbor the most complex prokaryotic and eukaryotic microbial communities on Earth (Gans et al., 2005; Torsvik et al., 2002; Treusch and Schleper, 2006; Urich et al., 2008). However, not only does the high complexity of soil communities need to be considered when planning a metagenomic study, but also soil contains a range of complex organic components such as humic and fulvic acids and other substances which can be coextracted with nucleic acids and potentially affect downstream molecular applications. In order to obtain clean hmw DNA, these contaminants need to be removed early in the procedure.
1.2. Terrestrial hot springs as habitat Similar to soils, terrestrial hot springs also represent a wide diversity of physical properties. These include differences in size, temperature, pH, mud viscosity, visible biological growth forms (mats, biofilms, filaments), rates of gas diffusion and visible bubbling, and colors associated with different bacterial pigments. In addition to these clearly visible differences, the chemistry of two apparently similar springs may be very different, even if they are separated by only a few meters (Reigstad et al., 2008, 2010). In general, the major challenge associated with hot spring samples is the extraction of DNA from microbial cells that tend to attach to particles of mud and clay. In particular, many acidic hot springs contain very finegrained clay minerals that need to be removed as they inhibit downstream molecular analysis by enzymatic inhibition and clogging of filters and pipette tips.
323
Metagenomic Libraries from Soils and Hot Springs
1.3. Construction of a metagenomic fosmid library: An overview The construction of a metagenomic fosmid library, from the isolation of hmw DNA to the picking of the library, can be completed by one person in a couple of weeks. The bottleneck is to get high concentrations of highquality hmw DNA to make a fosmid library. By following our detailed step-by-step protocol, developed on the basis of studying complex and challenging environmental samples, the majority of pitfalls will hopefully be avoided. The different steps in the preparation of a metagenomic fosmid library are presented in Fig. 13.1. Concerning the isolation of hmw DNA, Isolation of environmental hmw DNA
In agarose plugs
In solution
Purification and size selection two-phase gel
Modification of DNA ends
Packaging of fosmids into phage heads
Infection of E. coli with phages
First plating of clones on agar plates
Quality testing
Large scale plating and archiving of fosmid clones in 384-well plates
Copying 384-well plates on agar plates and producing pooled DNA for screening
Storage at –80 °C Ready for screening
Figure 13.1 Flow diagram highlighting the different steps of metagenomic fosmid library preparation.
324
Laila J. Reigstad et al.
one should always try to perform the procedures carefully but as quickly as possible, avoid the introduction of contaminants, and carefully consider the use of specific buffers and other extraction reagents to avoid unwanted or preferential biases towards particular cell types. The hmw DNA generated by the following protocol is normally above 50 kb in size (and sometimes >200 kb) and needs to be randomly sheared into shorter pieces of 40– 50 kb for cloning. The careful shearing of DNA here is performed mechanically rather than by enzymes to avoid introducing bias. After mechanical shearing and size analysis of the resulting genomic fragments, they are blunt ended and ligated to a fosmid vector. The fosmids are then packed into lambda bacteriophages, which infect the E. coli cells. Since the replication and partitioning functions of a fosmid are derived from the conjugative Ffactor of E. coli, it will replicate as a single-copy vector in the host cell (Kim et al., 1992; Shizuya et al., 1992). The phage-infected E. coli clones are then plated on Luria–Bertani (LB) plates with chloramphenicol (Cam) and incubated overnight at 37 C to allow the colonies of single-fosmid-bearing E. coli to grow. An initial quality check on some of the fosmids is recommended by restriction analysis before the extensive plating and picking phase starts. During colony picking (either manually or using a colony picking robot), single colonies are transferred into single wells of a microtiter plate containing LB medium/Cam/glycerol mixture. Glycerol is included for cryopreservation, enabling safe thawing and refreezing of the E. coli clones. The cultures are grown overnight at 37 C, and before storing the library at 80 C, an additional replicate plate is produced and one replicate plate print (on solid LB agar) using an aluminum 384-pin stamp tool.
2. Protocols 2.1. Sampling and preservation of samples Hot spring samples were not preserved in the field, but were rather processed as soon as possible. We routinely took extra material for chemical analyses and microscopy, and stored or treated these immediately in the required way. If the aim of the analysis is to target a specific group or taxon, then preliminary studies involving quantitative techniques (q-PCR) or lowresolution community profiling techniques (DGGE, t-RFLP) may be used to gain initial insights into the size and community structure of that specific group. Likewise, treatment of soil after the sampling is a critical step in the construction of metagenomic libraries. Once sampled, soils can be stored at low temperature (e.g., 4 C) but should not be stored at temperatures below 0 C, as this could result in a preliminary lysis and thus loss of specific cell
Metagenomic Libraries from Soils and Hot Springs
325
types. For soil samples not undergoing immediate DNA extraction, we preferred not to process the soil by homogenization (e.g., by sieving) as this disturbs the soil matrix which may result in the release of nutrients or change other fundamental characteristics of the soil. This can influence the community structure of the soil.
2.2. Isolation of hmw DNA from environmental samples 2.2.1. Isolation of cells from hot spring filaments, mats, biofilms, and mud Samples taken from different hot springs require different approaches to obtain good-quality hmw DNA, based on the amount of clay minerals (pH-related) and prokaryotic cells present. Springs with pH < 5 usually contain a lot of clay minerals as the acidic conditions lead to weathering of the rocks along the spring edges. Hot springs with a pH > 5 are normally clear, with organisms appearing as filaments, biofilms, or mats. In these sites, clay minerals do not influence the DNA isolation. 2.2.1.1. Extraction of cells from acidic hot spring mud samples As the clay minerals of acidic hot springs (pH < 5) inhibit isolation of high-quality hmw DNA and other downstream molecular analysis, it is necessary to remove most of them before starting the DNA extraction. Use approximately 100–200 ml of original hot spring slurry and mix the sample by hand to ensure it is homogenous before starting.
Pipette the homogenized sample into standard 1.7 ml microcentrifuge tubes with a tapered, narrow bottom. Do not use microcentrifuge tubes with round bottom as firm pellets are not formed and usually detach in subsequent steps. “Scaling up” to larger tubes (e.g., 15 ml) has also resulted in losses of microbial cells. Spin the tubes briefly (5–10 s only) at full speed in a standard benchtop microcentrifuge. Most of the clay minerals are now pelleted. Carefully and immediately, transfer the supernatant to fresh tubes (1.7 ml microcentrifuge tube) and centrifuge for 20 min at 13,000g to harvest the cells. Resuspend the pellet carefully in 500 ml 1 TE buffer and immobilize the cells in agarose plugs before cell lysis (see Section 2.2.3). Please note that using this cell fractionation procedure, many of the cells attached to the clay minerals are lost. Therefore, in some cases (when samples were processed directly after sampling), we have included the following extra step that enabled us to extract more of the clay-attached cells. After mixing the acidic mud sample by hand, aliquot into 1.7 ml microcentrifuge tubes before placing in a shaking hot block (e.g., an
326
Laila J. Reigstad et al.
Eppendorf Thermomixer). Shake the sample for 30–60 min at 600 rpm using the same temperature of the spring. This detaches more of the cells from the clay minerals. Immediately centrifuge the samples for 5–10 s and continue the cell harvest and agarose immobilization as described above.
2.2.1.2. Extraction of cells from filamentous hot spring samples, mats, and biofilms (pH > 5)
Carefully transfer the sample into a sterilized or disposable mortar and grind. Two to five g wet weight is usually sufficient as cell density is quite high (107–108 cells/g) in this type of material. Usually the original sample contains enough liquid for grinding. Avoid adding any buffer as this might introduce bias. Carefully pipette the resulting cell suspension into standard 1.7 ml microcentrifuge tubes. Spin for 20 min at minimum speed of 13,000g to harvest the cells. Resuspend the cell pellet carefully in 500 ml 1 TE buffer (or cell lysis buffer, see below) for subsequent DNA extraction (see section 2.2.3).
2.2.2. Isolation of cells from soil samples The following procedure has been used successfully in our laboratory to isolate cells from various soils suitable for different subsequent DNA isolation procedures (see below). Aliquot 900 g of soil into six sterile 500 ml bottles and add 300 ml 0.1 M Tris–HCl (pH 7.2). Shake the bottles at 200 rpm overnight at 4 C to detach the cells from the soil particles. Add the slurry from three bottles into a Waring blender and homogenize for 2 5 min. The sediment is left to settle for 30 s before the supernatant is transferred into clean 500 ml GS3 centrifugation bottles (Nalgene). Repeat the procedure for the remaining three bottles. To separate the cells from the remaining soil particles, the mixture can be further centrifuged at 60g (400–600 rpm) rpm at 4 C for 15 min before transferring the supernatant into GS3 bottles and repeating the procedure. At this low centrifugation speed, soil particles are sedimented while the microbial cells remain suspended in the supernatant. Centrifuge the soil-free supernatant in a GS3 rotor (Sorvall) at 9950g (7500 rpm) at 4 C for 2–3 h to pellet the cells. Resuspend cell pellets in TE or lysis buffer (see next section).
Metagenomic Libraries from Soils and Hot Springs
327
2.2.3. Isolation of hmw DNA 2.2.3.1. Isolation of hmw DNA—Procedure 1 The isolation of hmw DNA from soil samples described here is based on a method by Zhou et al. (1996). The modifications by A. Treusch and R. Bartossek (partly published in Treusch et al., 2005) have led to both an increase in the DNA yield and reduced processing time. Cells are resuspended in 20 ml extraction buffer (100 mM Tris–HCl [pH 8.0], 100 mM EDTA [pH 8.0], 100 mM sodium phosphate [pH 8.0], 1.5 M NaCl, 1% cetyltrimethylammonium bromide [CTAB]; Zhou et al., 1996) and pooled.
Lyse the cells with the addition of lysozyme (2 mg/ml final concentration) and/or proteinase K (250 mg/ml, final concentration) and incubate (with shaking at 30 rpm): Lysozyme only: 37 C for 60 min. Lysozyme and proteinase K: 37 C for 60 min followed by 40 C for 60 min. Proteinase K only: 40 C for 120 min. [Note: If a specific prokaryotic group in the soil is of interest, the lysis procedure can be adjusted to achieve an optimal enrichment of this group. For example, if archaea are the group of interest, the addition of lysozyme can be omitted to avoid hydrolysis of peptidoglycan, thereby reducing the efficiency of bacterial cell lysis and thus passively enriching for archaea.] Add 1/6 volume of 10% SDS and incubate for 2 h at 65 C, inverting every 15 min. Centrifuge the mixture at 2700g (4000 rpm) for 30 min in the GS3 rotor to separate proteins (which appear on the top as a solid white layer) from the DNA which is in the supernatant. Carefully remove the lower (DNA-containing) liquid and place in a sterile 50 ml polypropylene centrifuge tube. If this DNA solution is not clear, add more extraction buffer and incubate for a further 1–3 h and repeat the last centrifugation step. The DNA solution can be coloured but should be clear for the organic extraction which is performed by adding 1 volume of chloroform:isoamyl alcohol (24:1) and centrifuging at 4400g for 30 min at 4 C. Transfer the aqueous phase into two sterile 250 ml GSA tubes (Nalgene). Precipitate the DNA by adding 0.7 volume of isopropanol (room temperature) and centrifuging at 16,000g for 30 min at 4 C. Wash the pellet with ice-cold 70% ethanol and centrifuge (16,000g, 15 min, 4 C). Remove the supernatant and air-dry the DNA pellets before slowly resuspending in 4–6 ml 1 TE (pH 7.85) using pipette tips with a
328
Laila J. Reigstad et al.
broad aperture to avoid shearing the DNA (these are produced by trimming the ends off standard tips using a pair of scissors or a scalpel prior to autoclaving). Store the DNA at 4 C (and not 20 C). As the DNA solution contains a high concentration of salt, a dialysis step must be performed. Dialysis tubing (Spectra/POR 2, 25 mm) is prepared by placing in deionized water and heating in a microwave oven until the water almost reaches the boiling point. The water is discarded and the procedure is repeated a further 10 times. The DNA solution is then transferred into dialysis tubing and placed into 4.5 l of 1 TE (pH 7.2) and incubated overnight at room temperature. The dialysis tubing should be fixed vertically so it does not float on the surface and potentially dry out. Transfer the DNA solution into 30 ml Corex tubes (DuPont Instruments) and precipitate by adding 1 volume of isopropanol, 1/10 volume of 3 M sodium acetate, and centrifuging at 14,000g at 4 C for 30 min in a SS-34 rotor (Sorvall). Wash the DNA pellet with ice-cold 70% ethanol and carefully resuspend the pellet in 300 ml 1 TE using wide-aperture tips. Store the hmw DNA at 4 C until further processing. 2.2.3.2. Isolation of hmw DNA—Procedure 2 In general, hmw DNA isolation procedures result in either hmw DNA in solution or hmw DNA immobilized in a supportive matrix. The method chosen is dependent on the sample material and on the size of DNA needed. The use of agarose plugs for immobilizing cells for DNA preparation is particularly necessary when producing BAC libraries which can sustain much larger inserts than fosmids (Beja et al., 2000b). However, we have also used this technique for the preparation of DNA for fosmid libraries as this procedure offers additional advantages during hmw DNA isolation. When lysing cells in a matrix, the DNA will not be subjected to mechanical shearing by, for example, centrifugation steps or pipetting. Another advantage is that embedded hmw DNA can be easily placed into an agarose gel without the requirement for pipetting, by simply cutting a short piece of the plug and inserting into a hole in the gel. As pipetting can shear hmw DNA, the agarose immobilization effectively avoids this. The procedure has essentially been adopted and modified from a protocol developed at California Institute of Technology (CALTECH) and has been slightly modified for the use of environmental samples (Stein et al., 1996).
Prepare 1% agarose solution in ddH2O using Ultra Pure Low Melt Agarose (Sigma) and transfer it to a 50 C water bath and mix gently by hand intermittently. After cell extraction directly from an environmental sample (see Sections 2.2.1 and 2.2.2), the cell pellet is resuspended in 1 TE. The cell concentration should be around 0.5–1 109 cells/ml. Preheat this to 50 C.
Metagenomic Libraries from Soils and Hot Springs
329
Carefully mix the 500 ml cell suspension with 500 ml 1% agarose (the final agarose concentration will be 0.5%, resulting in fairly fragile plugs). Immediately pipette 1 ml of the mixture into the open end of a sterile 1 ml syringe with the plunger drawn completely back. [Note: Prior to commencing the procedure, prepare 1 ml syringes by slicing off the tip of the syringe barrel by using a hot sterile scalpel, resulting in a large aperture and a uniform diameter from the opening.] Cover the opening of the syringe with parafilm and let it stand vertically (opening at the top, plunger at the bottom) in crushed ice for 1 h to completely solidify the agarose and prevent any potential DNAse activity. Carefully push the plunger and expel the agarose plug into a 15 ml polypropylene centrifuge tube containing 12 ml lysozyme buffer (100 mM EDTA in 10 mM Tris–HCl pH 8.0, and lysozyme added (to 1 mg/ml) just before incubation). Up to two plugs can be added in one tube. [Note: the agarose plugs in the 15 ml tubes should be placed horizontally during all incubation steps to support the plug and prevent it from breaking.] Lyse the immobilized cells in a two-step process: first, incubate the plug in 12 ml lysozyme buffer for 1 h at 37 C with 70 rpm horizontal shaking. Carefully pour off the lysozyme buffer and add 12 ml EPS buffer (0.5 M EDTA, 1% Lauroylsarcosin, 2 mg/ml proteinase K added just prior to incubation). The proteinase K not only digests proteins attached to the immobilized DNA but also inactivates nucleases that might otherwise degrade the DNA during purification. Incubate the tube at 50 C for 24 h with 70 rpm horizontal shaking. After 24 h, replace with fresh EPS buffer and incubate for another 24 h. Inactivate the proteinase K by removing the EPS buffer and adding 14 ml of 1 mM phenylmethanesulfonylfluoride (PMSF) in 1 TE buffer. Incubate for 1 h with 70 rpm horizontal shaking with the tube covered in foil as PMSF is light sensitive. Repeat this twice with fresh PMSF solution. PMSF inhibits serine proteases (trypsin, chymotrypsin). Therefore, in order to remove the PMSF afterward, dialyse the plugs by incubating in 1 TE for 1 h three times. The agarose plugs are then ready for storage at 4 C. Recommended storage buffer is 1 TE buffer with 200 mM EDTA. Before running the pulsed-field gel electrophoresis (PFGE), the storage buffer needs to be removed. Therefore, equilibrate the agarose plugs by incubating three times in 1 TAE for 30 min with 70 rpm horizontal shaking. To analyze the DNA content of the agarose plugs, cut a small piece of the plug (a few millimeters) and place horizontally in a well of the gel (Section 2.3.1). Seal the plug by adding 1% 50-60 C agarose solution and allow the agarose to solidify before running the PFGE.
330
Laila J. Reigstad et al.
2.3. DNA purification and size analysis using PFGE Before starting the production of a metagenomic library, the size range of the isolated environmental DNA should be determined (Section 2.3.1), gel purified (Section 2.3.2), and sheared into smaller sizes for cloning (Section 2.3.3). All three steps are performed and evaluated using PFGE.
2.3.1. Initial size analysis of the isolated DNA After isolation of environmental hmw DNA, the size of the DNA should be estimated by running the DNA with size markers in a PFGE (Fig. 13.2; for PFGE theory see Herschleb et al., 2007). If the hmw DNA is embedded in agarose plugs, a small piece (e.g., 0.5 cm) of the plug can be placed in the gel tray before the 1% agarose (A-2929, Sigma) solution is poured into the casting chamber. Cooling the agarose solution to about 50 C before pouring prevents the low melt agarose plugs from melting. Hmw DNA in a solution and size markers should be added to wells of the PFGE gel after casting the gel. The PFGE is performed using 0.5 TAE as running buffer. Gels in PFGE are never prestained with ethidium bromide (EtBr) or SybrGold, but are stained after the PFGE run. For size markers and running conditions, see Section 2.3.2.
A
B
1 2
3
4
5
6
7
>680 kb
267 kb
21 kb
Figure 13.2 High-molecular weight DNA from environmental samples. (A) Precipitating high-molecular weight DNA isolated from soil after the addition of isopropanol and 1/10 volume 3 M sodium acetate to 8 ml of 1 TE in 30 ml Corex tubes before centrifugation. (B) Pulsed-field gel electrophoresis of DNA from hot spring filaments. Lane 1: Mid-Range marker (New England Biolabs). Lane 2: Yeast Chromosomal marker (New England Biolabs). Lanes 3–6: hmw DNA from four different hot springs, all > 80 C and pH 5.5. Lane 7: l-DNA/EcoRI þ HindIII marker (Fermentas). The kilobase sizes of the longest marker bands are given. This pulsed-field gel was run for 20 h at 200 V, 5–50 s pulses, and cooling at 10 C. Under these conditions, DNA fragments of <680 kb were separated according to their size, while DNA fragments of > 680 kb in size were compressed forming a single band.
Metagenomic Libraries from Soils and Hot Springs
331
2.3.2. Purification of hmw DNA using a two-phased agarose gel in PFGE DNA isolated from soil and other habitats that are rich in organics is typically coextracted with contaminating polyphenolic compounds such as humic and fulvic acids. Those compounds are severely inhibitory to downstream enzymatic molecular procedures such as PCR and ligation and should be removed prior to cloning procedures. Protocols involving the use of CTAB or polyvinyl pyrrolidone (PVP) in extraction buffers have been developed, as these compounds are able to complex polyphenolics (CTAB) or retard electrophoretic mobility (PVP). Unfortunately, these compounds also inhibit enzymatic downstream procedures and therefore also have to be removed from DNA extractions. For these reasons, we have developed a two-phased agarose PFGE in our laboratory (Quaiser et al., 2002) that allows the removal of humic and fulvic acids from the hmw DNA and to subsequently purify the DNA from PVP. The first phase of the agarose gel contains 1% agarose (Sigma, A-2929) including 2% PVP (P5288, Sigma), in 0.5 TAE buffer. The second phase is only the 1% agarose in 0.5 TAE. During migration through the PVP phase, being approximately one-third of the total gel size (total gel dimensions: 14 13 cm), the phenolic compounds are separated from the hmw DNA. The continuing migration into the second gel phase separates the PVP from the hmw DNA. If the hmw DNA is embedded in agarose plugs, the plug can be placed in the gel tray before the agarose/PVP solution (cooled to 50 C) is poured into the casting chamber. Make sure to position the plugs such that the hmw DNA migrates through 2–3 cm of the agarose/PVP phase before entering the agarose phase. To ensure that PVP is removed from the hmw DNA afterwards, the hmw DNA should also migrate 2–3 cm in the agarose gel. Note that the type of agarose (low melt or standard) used in the second phase of the gel depends on the method chosen for recovering the hmw DNA after the electrophoresis (see Section 2.4). The running buffer in PFGE is 0.5 TAE. As in regular (one-dimensional) electrophoresis, markers are required to determine the size of the DNA using PFGE. Several hmw DNA PFGE size markers typically come pre-prepared as an agarose plug in a syringe tube. To load these PFGE size markers, a thin disc (1 mm thick) is cut off from the plug and placed into a well on the gel parallel to the environmental hmw DNA agarose plug, and is sealed by adding 1% low melt agarose, taking care that no air bubbles are trapped. Recommended agarose plug markers are Yeast Chromosomal marker (N0345S), Low Range marker (Cat no. 350S), and High Range marker (Cat no. 3551S; all New England Biolabs). In addition to the agarose plug markers, regular size markers prepared in solution can also be used in PFGE. The marker solutions are added into the wells after the gel is placed into the electrophoresis chamber and submerged in running buffer.
332
Laila J. Reigstad et al.
Before running PFGE, the electrophoresis system needs careful precleaning with running buffer. Additionally, it is recommended to perform a pre-run with fresh 0.5 TAE buffer for 20–30 min. This pre-run buffer is then replaced with fresh 0.5 TAE before the agarose gel is placed in the chamber. The program used for PFGE depends on the purpose of the run. For analytical purposes, a good starting point is a program with 200 V (6 V/cm) electrical pulses increasing from 1 to 12 s for 14 h at 14 C (based on a distance between electrodes of 33 cm as found in the CHEF-DR system; Biorad). For analytical runs with DNA > 500 kb, it might be necessary to use longer pulses as well as a longer running time, such as 200 V (6 V/cm) 5–50 s pulses, 20 h at 14 C (as in Fig. 13.2). For the subsequent staining of the hmw DNA in the PFGE gel, both standard EtBr and SybrGold (Invitrogen) staining procedures have been used successfully. 2.3.3. Adjusting DNA size by shearing For a metagenomic fosmid library, DNA inserts of 40–50 kb are needed in order to be successfully packaged into lambda bacteriophage heads. It is therefore sometimes necessary to carefully shear the purified hmw DNA into pieces of a specific size, that is, approximately 50 kb. However, the DNA may already be sheared due to pipetting, handling, and electrophoresis and therefore may not need further processing. If shearing is necessary, careful pipetting up and down using a narrow pipette tip might be sufficient. Passing the DNA solution two or three times through a clean Hamilton syringe can also be used. To collect the resulting 40–50 kb fragments, the following PFGE program is used: 200 V (6 V/cm), 0.1–1 s pulses for 16 h at 14 C, using a one-phased preparative PFGE gel (Section 2.3.1). Under these conditions, DNA of this size will be compressed in the gel. The DNA should then be cut out without UV exposure to avoid damage. Therefore, the gel containing the hmw DNA is cut out and removed and only the borders of the gel containing the size markers (and a small sample plug of the hmw DNA) are stained for localization (Fig. 13.3). The gel borders are stained and placed on the UV table, and the location of the hmw DNA bands marked by cutting thin lines in the gel on each side of the hmw DNA. The location of the hmw DNA in the nonstained lanes can then be estimated by carefully reassembling the gel pieces together on the lab bench. This enables the hmw DNA to be size selected and cut out without exposure to UV.
2.4. Isolation of hmw DNA from agarose matrix There are two methods which can be used for the isolation of the hmw DNA from slices of agarose obtained after gel electrophoresis: digestion of agarose using an agarase or using electroelution. Both methods can
333
Metagenomic Libraries from Soils and Hot Springs
A
1
2
2
1
B
C
1 % Agarose 2 % PVP 1 % Agarose
kb 97 48
kb 63 48 33
23 15
prestained
poststained
prestained
Figure 13.3 Preparative two-phase pulsed-field gel electrophoresis of hmw DNA for purification and size selection. Prestained parts of the gel are used for the marking of the position of the hmw DNA and flank the middle poststained part of the gel which contained the hmw DNA to be isolated. The gel consists of 1% agarose with the top layer containing additionally 2% PVP. Lane A: Mid-Range marker I (New England Biolabs), lane B: l-DNA/EcoRI þ HindIII marker (Fermentas), lane C: Low Range marker (New England Biolabs), lane 1: 1.5 ml hmw DNA, and lane 2: 12 ml hmw DNA. The conditions for the pulsed-field gel were: 18 h, 200 V (6 V/cm), 0.1–1 s pulses, and cooling to 14 C. Under these conditions, DNA fragments of >40 kb are compressed forming a single band.
potentially damage hmw DNA by mechanical shearing. A comparison of both methods using hmw DNA from Sulfolobus solfataricus showed that the amounts of DNA recovered were comparable. However, the size of the DNA isolated with agarase was smaller, albeit still sufficiently large for cloning into fosmids (R. Bartossek, data not shown). 2.4.1. Isolation of hmw DNA from agarose matrix using agarase A prerequisite for the isolation of hmw DNA using digestion by agarase (such as GELase, Epicentre Biotechnologies) is the use of low melting agarose in the second phase of the pulsed-field gel (see Section 2.3.2). After excision of the gel pieces containing the hmw DNA, the gel is divided into several smaller blocks and transferred into sterile 2 ml vials.
334
Laila J. Reigstad et al.
The gel is melted in agarase buffer (supplied by manufacturer) by incubation for 15 min at 68 C. After a 15 min equilibration step at 45 C, agarase is added and incubated for 2 h at 45 C. Ensure all agarose is dissolved. To stop the digestion reaction, the tubes are placed on ice. A subsequent centrifugation step at 9300g (10,000 rpm) at 4 C for 3 min is used to pellet possible traces of undigested gel. As the original gel slice is typically split among several microcentrifuge tubes, the DNA solution can be pooled and concentrated into a volume of 200 ml using a 2-ml microconcentrator (e.g., Vivaspin 100,000 MWCO column; Vivascience), at 4500g (7000 rpm) at 18 C. The DNA is washed by diluting in 2 ml 1 TE and concentrated again down to 200 ml before it can be stored at 4 C (but not frozen) until cloning (Section 2.5).
2.4.2. Isolation of hmw DNA from agarose matrix via electroelution Low melting agarose is not recommended for the electroelution procedure as it disintegrates easier than standard agarose and may be carried over, potentially inhibiting downstream procedures. Carefully transfer the excised gel pieces into dialysis tubes (preparation; Section 2.2.2) filled with 0.5 TAE (1–3 ml depending on gel size). Avoid introducing air bubbles. Close the dialysis tubes either by using dialysis membrane clamps or by tying knots. Place the dialysis tubes in a gel electrophoresis chamber with 0.5 TAE and fix them in a stable floating position, parallel to the electrodes. Carry out the electroelution at 200 V (6 V/cm) for 1–2 h with the whole electrophoresis chamber mounted in crushed ice to avoid the buffer heating using 60–70 V (1.5 V/cm) at 4 C. In some cases, most of the DNA is still in the gel piece after the 1–2 h run, so after harvesting this eluted DNA, new buffer is added to the dialysis tube and the elution is run for another 2 h. This two-step elution has proven successful for several DNA samples, minimizing the time the DNA is in the electric field. After the initial electrophoresis, swap the power cables to reverse the polarity of the direct current and perform electrophoresis for 1 min to detach the DNA from the dialysis tubing. Remove the DNA solution from the dialysis tube using a broad pipette tip. The volume of the DNA solution can then be reduced to 200 ml using a microconcentrator (as described above). After the elution, it is advisable to stain the gel piece to verify that the DNA was removed.
Metagenomic Libraries from Soils and Hot Springs
335
2.5. Cloning of hmw DNA The purified DNA is now ready for ligation to a fosmid vector. We have successfully used two different fosmid vectors: the pEpiFOS-5 (7.5 kb) and the CopyControl pCC1FOSTM (8.1 kb) (both from Epicentre Biotechnologies). Both fosmid vectors are maintained as a single copy in the E. coli host cell in the resulting library, but the CopyControl pCC1FOSTM vector has the advantage that the plasmid of recombinant clones of interest can be induced by up to 50 copies per cell immediately before DNA extraction and purification. This step greatly increases DNA yields, while maintaining the stability of the plasmid. The vectors contain E. coli F-factor-based partitioning, the chloramphenicol-resistance antibiotic selection marker and cos sites for the packaging of the DNA into phage heads. The DNA needs to be blunt ended before cloning, often referred to as end repair. The cloning procedure described here follows essentially that recommended by the manufacturer (Epicentre Biotechnologies). Therefore, we only highlight in detail those steps that have been modified by us. 2.5.1. End repair of DNA The fosmid vector is provided linearized at the unique Eco72I (CAC/GTG) site, blunt ended, and dephosphorylated. For the ligation to the fosmid vector, the environmental hmw DNA has to be blunt ended and 50 phosphorylated. This end modification of the DNA is performed using the end repair enzyme mix provided with the fosmid vector containing T4 DNA polymerase and T4 polynucleotide kinase. All reactions are prepared on ice. Due to possible DNA loss in downstream procedures, it is recommended that high concentrations of at least 3 mg of starting DNA are used, preferably even more. Incubations of the end repair reaction are performed at room temperature for 45 min, followed by 10 min at 70 C to stop the reaction. A subsequent standard phenol:chloroform:isoamyl alcohol extraction is performed to remove the enzymes, followed by DNA precipitation with isopropanol to concentrate the DNA. Dissolve the resulting DNA pellet in approximately 30 ml of 1 TE and check DNA for yield and size by running an aliquot in a regular agarose gel. The DNA is now ready for ligation. 2.5.2. Ligation of insert DNA to fosmid vector A 10:1 molar ratio of vector to insert DNA is recommended to obtain a maximum yield of transformants. The ratio is somewhat critical, as an excess of phosphorylated insert DNA can potentially result in ligation of more than one insert to the vector, yielding chimeric genome fragments. It is recommended to mix different vector:insert ratios and subsequently use the lowest insert:vector that still yields enough clones.
336
Laila J. Reigstad et al.
Perform the ligation in a 10 ml volume with 10 fmol insert DNA (265 ng DNA of ca. 40 kb size) and 100 fmol fosmid vector (0.5 mg) for 2 h at room temperature. Test two or three different ratios in the ligation step. Inactivate the ligase by incubating at 70 C for 10 min. The fosmid DNA can now be frozen at 80 C. After these first ligations and subsequent cloning (Section 2.8), the optimal insert:vector ratio can be defined and the remaining DNA ligated according to this optimal ratio.
2.6. In vitro packaging of DNA into lambda bacteriophage heads For the in vitro packaging of fosmid DNA into phage heads, the MaxPlax lambda packaging extracts (Epicentre Biotechnologies) are used. The procedure is performed according to the manufacturer. Based on our experience, we recommend a change in the phage dilution buffer: Stop the fosmid packaging into the phage heads by adding 500 ml of phage dilution buffer (50 mM Tris–HCl, pH 7.5; 10 mM MgSO4; 100 mM NaCl; 0.01% gelatine) and 25 ml chloroform. Mix carefully by inverting the tubes by hand. Centrifuge at 13,000 rpm for 30 s to separate the chloroform from the phage supernatant. It is not necessary to remove the chloroform, but it is recommended to perform a short spin prior to each use of the phage extracts. Store at 4 C. Storage for up to 1 week sometimes results in an increased number of packed phage heads but longer storage can result in lower efficiencies. An increase of efficiency can sometimes be reached by modifying the ratio of ligation extract to packaging extract.
2.7. Infection of the E. coli host cells with lambda bacteriophages Grow E. coli cells (EPI100-T1R Plating Strain, Epicentre Biotechnologies) in 1000 ml Erlenmeyer flasks with 100 ml LB medium supplemented with 10 mM MgSO4 (final concentration) and 0.2% maltose. It is recommended to prepare and store sterile 20% maltose stock solution in 1 ml aliquots at 4 C. Grow the culture under vigorous shaking (220 rpm) at 37 C until an optimal OD (600 nm) of 0.8–1.0 is reached. Transfer the culture to 250 ml tubes and harvest the cells by centrifugation at 4000g for 10 min at 4 C.
Metagenomic Libraries from Soils and Hot Springs
337
Resuspend the cell pellet in one of the 50 ml tubes with an appropriate amount (7–8 ml) of 10 mM MgSO4 to gain a final OD of 3. The pellet of the second 50 ml tube can be kept at 4 C overnight for later use. Store the culture for up to several hours on ice until the infection starts.
2.8. Titration of the fosmid library An initial infection test is carried out to estimate the efficiency of the fosmid-containing phage extracts. This will determine the optimal plating conditions for subsequent plating of all material. Fill three 1.7 ml microcentrifuge tubes with 200 ml EPI100-T1R cell culture stored in MgSO4 (see previous section). Add three different amounts of packaged phage particles to the three tubes; for example, try 10, 30, and 60 ml. Mix carefully by inverting the tubes two to three times. Incubate at room temperature for 30 min. Add 1 ml of LB broth to each tube to regenerate the infected EPI100T1R cells. Incubate at 37 C for 45 min and invert the tubes every 15 min. Harvest the cells at 10,000g at 4 C for 5 min in a tabletop centrifuge and resuspend the pellet in 100 ml LB broth. Plate the cells on prewarmed LB/Cam agar plates (12.5 mg/ml final) and incubate for 16–20 h at 37 C. Count the fosmid-containing E. coli colonies appearing on the LB/Cam plates (between 40 and >500). Based on this efficiency test, use large prewarmed Petri dishes (150 mm diameter) with LB/Cam and plate out the amount of packaged phage particles that will result in 200–250 clones per plate. Before plating the whole library, it is strongly recommended to quality test 10–20 fosmids (see Section 2.9).
2.9. Quality testing of fosmid clones Before starting to pick and store a large metagenomic fosmid library, it is highly recommended to characterize at least 10–20 fosmids by restriction analysis in order to check if the correct vector is present, to estimate the sizes of the inserts, and to estimate the range of their G þ C content (i.e., diversity). Transfer a small part of a colony (from the efficiency test plating described in previous section) to 10 ml of LB/Cam (12.5 mg/ml final). Incubate on a shaking rotor (200 rpm) at 37 C overnight (14–16 h).
338
Laila J. Reigstad et al.
Isolate the fosmid from 8 ml of the E. coli culture (to the last 2 ml, add sterile glycerol, mix, and freeze at 80 C for backup) by using a plasmid purification kit, such as the Qiagen Mini Prep Kit (Invitrogen; see Section 3.2). Remember to adjust the isolation protocol to low copy plasmids/cosmids/fosmids as stated by the manufacturer for the fosmid vector without copy control. Verify the fosmid output on a standard 1% agarose gel by analyzing 2 ml eluate. As a quality test for the vector and insert sizes, perform a restriction enzyme digest using the enzyme NotI that cuts the region flanking the insert, but hydrolyzes only infrequently chromosomal DNA, because it has an 8-bp recognition site with 100% G þ C content. Electrophorese the digestion mixture on an agarose gel, preferably a 1% pulsed-field gel (PFGE settings: 10 h at 180 V, using 0.1–2.0 s pulses at 14 C) or a 20 cm long regular 1% agarose gel, running at low power (30 V) over night. The vector should be seen in all of the fosmid preparations (Fig. 13.4A) as a DNA band of 7.5 or 8.1 kb for the EpiFOSTM-5 fosmid vector or the CopyControl pCC1FOSTM vector, respectively. In addition to the vector size, the approximate length of the fosmid insert can be estimated. In parallel to NotI digestion, it is helpful to cut with another restriction endonuclease with lower G þ C content. Figure 13.4B shows examples of EcoRI-digested recombinant plasmids. Please note that we sometimes had problems to clone AT-rich DNA (35–40% G þ C content) efficiently into the CopyControl pCC1FOS fosmid, while cloning of the same DNA into the pEpiFOS-5 fosmid was unproblematic. We are not aware of the underlying reasons for this, but have repeatedly observed very low cloning efficiency and/or fosmids of unusual nature (e.g., those which are not cut with NotI) when cloning A þ T-rich DNA.
3. Growing, Picking, Replicating, and Storage of the Fosmid Library The picking of colonies can be done either manually or by the use of a robot (like Qpix2, Genetix). Either choice, it is important that all steps handling the metagenomic libraries are performed in a sterile laminar flow. Plate the optimal amount of the packaged phage particles (see Section 2.8) on large prewarmed LB/agar/Cam dishes (150 mm diameter), estimated to give 200–250 colonies/plate. During picking, single colonies are transferred to individual wells on a 384-well microtiter plates (X7001, Genetix) containing 60 ml LB media with 12.5 mg/ml Cam and
339
Metagenomic Libraries from Soils and Hot Springs
A
1
2
3
4
5
6
7
8
9
10
11
12 21 kb
10 kb 8 kb
Vector
6 kb
B
1
2
3
4
5
6
7
8
9 10 11
12 13 14 21 kb
10 kb 8 kb 6 kb
Figure 13.4 Quality control of randomly chosen fosmids from a soil metagenomic library. (A) Nine fosmids digested with restriction enzyme NotI to separate vector from insert and to control insert sizes. Arrow indicates band of EpiFOSTM-5 fosmid vector of 7.5 kb (Epicentre Biotechnologies). Lane 1: GeneRuler marker (Fermentas). Lanes 2–10: fosmid clone patterns after 3 h NotI digestion. Lane 11: GeneRuler marker (Fermentas). Lane 12: l-DNA/EcoRI þ HindIII marker (Fermentas). (B) Eleven fosmids digested with the 6-bp recognition-cutter EcoRI for 3 h. EcoRI cuts only once in the fosmid vector. The digestion patterns thereby highlight fosmid inserts differences. Both PFGE gels were run for 10 h at 180 V, using 0.1–2.0 s pulses at 14 C.
7.5% glycerol. If picking is performed manually, it is recommended to use an eight-channel dispensing pipette for filling the wells of the 384-well microtiter plates. Work in a hood with sterile air flow, and fill the amount of plates that will be picked during this day. The colony transfer can be done using sterile wooden tooth picks. One well on each plate is left inoculated as a control for contamination. As soon as a plate (referred to as the master plate) is picked, immediately cover it with the lid, wrap it in clingfilm, and incubate it at 37 C for 18–20 h (without shaking). For future screening, backups should be produced from each master plate, before it is stored at 80 C. Beside producing replicate/backup plates in further 384-well microtiter plates, we also inoculate all grown cultures onto a solid LB/agar/Cam plate. For both of these direct replications, a flame-proof 384-pin replicator is needed.
340
Laila J. Reigstad et al.
Dip the 384-pin replicator into 70% ethanol for sterilization and afterward flame off the alcohol. Repeat twice. Let the replicator pins allow to cool before carefully placing the replicator in the master plate and leave it for a few seconds. Then carefully transfer the replicator into a fresh microtiter plate (referred to as backup plate) with wells filled with 60 ml LB/Cam/glycerol as described previously. Leave the replicator in the backup plate for a few seconds before removing it and placing it directly onto the plate with solid LB/agar/ Cam. It is necessary to carefully hold the replicator to prevent a deep puncturing of the agar. Keep the replicator on the LB/agar/Cam plate for about 30 s to enhance the chance that all 383 colonies will grow. Incubate the freshly inoculated backup plate and the large LB/agar/Cam plate at 37 C for 14–16 h. The master plate is immediately stored at 80 C. After overnight incubation, the backup plate is stored at 80 C, while the LB/agar/Cam plate is stored at 4 C until all 383 colonies are being collected for DNA preparation (next section).
3.1. Screening of specific genes in the fosmid library There are two different approaches to screen for specific genes or clones in the fosmid library. The screening can either be based on expressed protein activity, or based on DNA sequence. We present here the method for screening for a particular DNA target sequence. This can be done quite efficiently by generation of a clone pool of 383 fosmids of each 384microtiter plate in the fosmid library. The resulting DNA pools are then used as templates in PCRs with specific primers to target the desired gene. In this way, only 70 PCRs are needed to screen a library of ca. 27,000 clones (representing 1 Gb of DNA from the environment). Such 383-fosmid pools are made as following. A replica of all 383 colonies of one master microtiter plate is transferred onto a LB/agar/Cam plate and incubated for 18–20 h at 37 C as described in Section 3.0. The clones are then washed from the plate with 5 ml LB media using a plate spreader (e.g., a bent and sterilized Pasteur pipette). The cells are collected and pelleted at 4000 g at 4 C for 10 min. From the resulting cell pellet, the pooled fosmid DNA can be isolated using a plasmid preparation kit. (Remember to follow the manufacturer’s instructions for low copy number plasmids/fosmids/cosmids.)
Metagenomic Libraries from Soils and Hot Springs
341
If a pooled template DNA is positive, the individual clones on this microtiter plate can be identified by colony hybridization or by PCR screens of pooled rows and columns. A second, faster but more expensive way of screening a 384-well plate by PCR is to run 384 reactions using a sterilized 384-pin replicator to transfer a small amount of each culture directly into the freshly prepared and aliquoted PCR mixture in a 384-well PCR plate (10 ml final PCR volume per reaction).
3.2. Fosmid sequencing Besides screening for specific DNA sequences, automated sequencing of insert ends is often performed to analyze the metagenomic libraries in large scale (Treusch et al., 2004). For this purpose, it is advisable to use a fosmid vector with inducible copy number, in order to reduce the costs for DNA preparation. The same principle also holds for manual sequencing of single fosmids. If the copy of the plasmid can be induced, preparation of pure DNA is easy. If a single-copy vector has been employed, we found that using the Qiagen midi prep kit containing the Top10 gravity flow columns works best for getting high-quality DNA, provided that the few protocol changes are followed with regard to those for low copy plasmids. Purifying fosmid DNA from a 60–80 ml E. coli culture was sufficient using the single-copy vector (see Section 2.9). Sequencing of a complete single-fosmid DNA can be either done by producing a subclone library of smaller fragments in regular plasmids for Sanger sequencing or by employing direct sequencing (e.g., pyrosequencing (454) technology) on the recombinant fosmid DNA.
3.3. General conclusions Metagenomics is a rapidly evolving field as it is dependent on efficient sequencing technologies that are currently developing quickly with respect to increasing capacity and to lowering costs. Because of these developments, high-throughput sequencing technologies are increasingly used directly on environmental DNA obviating the need of the time consuming and costly library constructions. However, one has to note that large-insert metagenomic libraries once constructed and characterized represent a sustainable and storable biological resource that can be reused and employed for various questions, which might not even been asked at the time of sampling or library construction. They also offer the opportunity to isolate a full gene, a gene cluster, or operon, of which only sequence tags might have been found in direct high-throughput sequencing (Fig. 13.5). Further, large-insert libraries are particularly useful, when the isolation of gene clusters or
342
Laila J. Reigstad et al.
Soil fosmid 54d9 nirK
amo amo B A 16S
23S
C Sargasso sea plankton
Cenarchaeum symbiosum
Figure 13.5 Schematic representation of genome fragments of archaea with amoA, amoB, and/or amoC genes (encoding subunits of ammonia monooxygenase) indicating their potential capacity to oxidize ammonia. From the analysis of a large-insert fosmid from soil (54d9, upper panel), it became clear that amo genes are directly linked to the ribosomal rRNA genes of archaea (Treusch et al., 2005). The finding of homologous genes in a metagenomic shotgun sequencing project of marine plankton (middle panel; Venter et al., 2004) and on fosmids of the marine symbiont Cenarchaeum symbiosum (Hallam et al., 2006) indicated that the same metabolism might be widespread in nature.
other large contiguous genomic regions are desired for subsequent expression studies, as is the case, for example, in biotechnological screening procedures (Kakirde et al., 2010; Lorenz and Eck, 2005) or when the physiological pathways of microorganisms are studied that reside in low abundance in the microbial community (e.g., in Bartossek et al., 2010; Beja et al., 2000a).
REFERENCES Bartossek, R., Nicol, G. W., Lanzen, A., Klenk, H. P., and Schleper, C. (2010). Homologues of nitrite reductases in ammonia-oxidizing archaea: Diversity and genomic context. Environ. Microbiol. 12, 1075–1088. Beja, O., Aravind, L., Koonin, E. V., et al. (2000a). Bacterial rhodopsin: Evidence for a new type of phototrophy in the sea. Science 289, 1902–1906. Beja, O., Suzuki, M. T., Koonin, E. V., et al. (2000b). Construction and analysis of bacterial artificial chromosome libraries from a marine microbial assemblage. Environ. Microbiol. 2, 516–529. Collins, J., and Hohn, B. (1978). Cosmids: A type of plasmid gene-cloning vector that is packageable in vitro in bacteriophage lambda heads. Proc. Natl. Acad. Sci. USA 75(9), 4242–4246. DeLong, E. F. (2005). Microbial community genomics in the ocean. Nat. Rev. Microbiol. 3(6), 459–469. Gans, J., Wolinsky, M., and Dunbar, J. (2005). Computational improvements reveal great bacterial diversity and high metal toxicity in soil. Science 309, 1387–1390.
Metagenomic Libraries from Soils and Hot Springs
343
Hallam, S. J., Konstantinidis, K. T., Putnam, N., et al. (2006). Genomic analysis of the uncultivated marine crenarchaeote Cenarchaeum symbiosum. Proc. Natl. Acad. Sci. USA 103, 18296–18301. Handelsman, J. (2004). Metagenomics: Application of genomics to uncultured microorganisms. Microbiol. Mol. Biol. Rev. 68, 669–685. Herschleb, J., Ananiev, G., and Schwartz, D. C. (2007). Pulsed-field gel electrophoresis. Nat. Protoc. 2, 677–684. Kakirde, K. S., Parsley, L. C., and Liles, M. R. (2010). Size does matter: Application-driven approaches for soil metagenomics. Soil Biol. Biochem. 42(11), 1911–1923. Kim, U. J., Shizuya, H., de Jong, P. J., Birren, B., and Simon, M. I. (1992). Stable propagation of cosmid sized human DNA inserts in an F factor based vector. Nucleic Acids Res. 20(5), 1083–1085. Lee, S., and Hallam, S. J. (2009). Extraction of high molecular weight genomic DNA from soils and sediments. J. Vis. Exp. 10(33), 10.3791/1569, pii: 1569. Lorenz, P., and Eck, J. (2005). Metagenomics and industrial applications. Nat. Rev. Microbiol. 3(6), 510–516. Martin-Cuadrado, A. B., Rodriguez-Valera, F., Moreira, D., et al. (2008). Hindsight in the relative abundance, metabolic potential and genome dynamics of uncultivated marine archaea from comparative metagenomic analyses of bathypelagic plankton of different oceanic regions. ISME J. 2, 865–886. Monaco, A. P., and Larin, Z. (1994). Construction of yeast artificial chromosome libraries by pulsed-field gel electrophoresis. Trends Biotechnol. 12(7), 280–286. Quaiser, A., Ochsenreiter, T., Klenk, H. P., et al. (2002). First insight into the genome of an uncultivated crenarchaeote from soil. Environ. Microbiol. 4, 603–611. Reigstad, L. J., Richter, A., Daims, H., Urich, T., Schwark, L., and Schleper, C. (2008). Nitrification in terrestrial hot springs of Iceland and Kamchatka. FEMS Microbiol. Ecol. 64, 167–174. Reigstad, L. J., Jorgensen, S. L., and Schleper, C. (2010). Diversity and abundance of Korarchaeota in terrestrial hot springs of Iceland and Kamchatka. ISME J. 4, 346–356. Rondon, M. R., August, P. R., Bettermann, A. D., et al. (2000). Cloning the soil metagenome: A strategy for accessing the genetic and functional diversity of uncultured microorganisms. Appl. Environ. Microbiol. 66, 2541–2547. Schleper, C., DeLong, E. F., Preston, C. M., Feldman, R. A., Wu, K. Y., and Swanson, R. V. (1998). Genomic analysis reveals chromosomal variation in natural populations of the uncultured psychrophilic archaeon Cenarchaeum symbiosum. J. Bacteriol. 180, 5003–5009. Schleper, C., Jurgens, G., and Jonuscheit, M. (2005). Genomic studies of uncultivated archaea. Nat. Rev. Microbiol. 3(6), 479–488. Shizuya, H., and Kouros-Mehr, H. (2001). The development and applications of the bacterial artificial chromosome cloning system. Keio J. Med. 50, 26–30. Shizuya, H., Birren, B., Kim, U. J., Mancino, V., Slepak, T., Tachiiri, Y., and Simon, M. (1992). Cloning and stable maintenance of 300-kilobase-pair fragments of human DNA in Escherichia coli using an F-factor-based vector. Proc. Natl. Acad. Sci. USA 89, 8794–8797. Stein, J. L., Marsh, T. L., Wu, K. Y., Shizuya, H., and DeLong, E. F. (1996). Characterization of uncultivated prokaryotes: Isolation and analysis of a 40-kilobase-pair genome fragment from a planktonic marine archaeon. J. Bacteriol. 178, 591–599. Strous, M., Pelletier, E., Mangenot, S., Rattei, T., Lehner, A., Taylor, M. W., Horn, M., Daims, H., Bartol-Mavel, D., Wincker, P., Barbe, V., Fonknechten, N., et al. (2006). Deciphering the evolution and metabolism of an anammox bacterium from a community genome. Nature 440(7085), 790–794.
344
Laila J. Reigstad et al.
Taupp, M., Lee, S., Hawley, A., Yang, J., and Hallam, S. J. (2009). Large insert environmental genomic library production. J. Vis. Exp. 23(31), 10.3791/1387, pii: 1387. Torsvik, V., Ovreas, L., and Thingstad, T. F. (2002). Prokaryotic diversity—Magnitude, dynamics, and controlling factors. Science 296, 1064–1066. Treusch, A., and Schleper, C. (2005). Environmental genomics: A novel tool to study uncultivated microorganisms. In “Handbook of Genome Research,” (C. W. Sensen, ed.). Wiley-VCH, Verlag GmbH, Weinheim, Germany. Treusch, A., and Schleper, C. (2006). The microbial soil flora: Novel approaches for accessing the phylogenetic and physiological diversity of prokaryotes. In “Intestinal Microorganisms of Termites and Other Soil Invertebrates,” (H. Konig and A. Varma, eds.). Springer Verlag, Berlin, Heidelberg, Germany. Treusch, A. H., Kletzin, A., Raddatz, G., et al. (2004). Characterization of large-insert DNA libraries from soil for environmental genomic studies of Archaea. Environ. Microbiol. 6, 970–980. Treusch, A. H., Leininger, S., Kletzin, A., Schuster, S. C., Klenk, H. P., and Schleper, C. (2005). Novel genes for nitrite reductase and Amo-related proteins indicate a role of uncultivated mesophilic crenarchaeota in nitrogen cycling. Environ. Microbiol. 7, 1985–1995. Urich, T., Lanzen, A., Qi, J., Huson, D. H., Schleper, C., and Schuster, S. C. (2008). Simultaneous assessment of soil microbial community structure and function through analysis of the meta-transcriptome. PLoS One 3, e2527. Venter, J. C., Remington, K., Heidelberg, J. F., et al. (2004). Environmental genome shotgun sequencing of the Sargasso Sea. Science 304, 66–74. Yooseph, S., Sutton, G., Rusch, D. B., et al. (2007). The Sorcerer II Global Ocean Sampling expedition: Expanding the universe of protein families. PLoS Biol. 5, e16. Zhou, J., Bruns, M. A., and Tiedje, J. M. (1996). DNA recovery from soils of diverse composition. Appl. Environ. Microbiol. 62, 316–322.
C H A P T E R
F O U R T E E N
Characterizing Bacterial Gene Expression in Nitrogen Cycle Metabolism with RT-qPCR James E. Graham,*,† Nicholas B. Wantland,† Mark Campbell,* and Martin G. Klotz*,† Contents 1. Why Study Bacterial Transformation of Reactive Nitrogen in the Environment? 2. Nucleic Acids as Markers of N-Metabolic Activity 2.1. RNA analyses have distinct advantages in determining microbial contributions to the nitrogen cycle 2.2. Quality RNA is key 2.3. cDNA synthesis is both necessary and problematic 2.4. PCR primers must be chosen (and chosen again) carefully 2.5. Determining relative mRNA expression levels requires a reliable internal standard 2.6. Protocol: Bacterial RNA isolation 3. Gene Expression in Bacteria That Facilitate Reactive Nitrogen Transformations 3.1. N-cycle organisms and reactive nitrogen transformation pathways 3.2. Laboratory culture of aerobic N-cycle bacteria with emphasis on expression studies 3.3. Using genome-informed metabolic reconstruction of catabolic pathways to select target genes 4. Future Directions of the Approach Acknowledgments References
346 347 347 348 351 351 352 354 356 356 360 361 364 365 366
* Department of Biology, University of Louisville, Louisville, Kentucky, USA Department of Microbiology and Immunology, University of Louisville, Louisville, Kentucky, USA
{
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00014-2
#
2011 Elsevier Inc. All rights reserved.
345
346
James E. Graham et al.
Abstract Recent advances in DNA sequencing have greatly accelerated our ability to obtain the raw information needed to recognize both known and potential novel modular microbial genomic capacity for nitrogen metabolism. With PCRbased approaches to quantifying microbial mRNA expression now mainstream in most laboratories, researchers can now more efficiently propose and test hypotheses on the contributions of individual microbes to the biological accessibility of nitrogen upon which all other life depends. We review known microbial roles in these key nitrogen transformations, and describe the necessary steps in carrying out relevant gene expression studies. An example experimental design is then provided characterizing Nitrosococcus oceani mRNA expression in cultures responding to ammonia. The approach described, that of assessing microbial genome inventory and testing putative modular gene expression by mRNA quantification, is likely to remain an important tool in understanding individual microbial contributions within microbial community activities that maintain the Earth’s nitrogen balance.
1. Why Study Bacterial Transformation of Reactive Nitrogen in the Environment? Nitrogen is a key element of life and the competition for its acquisition in natural environments is fierce. In its most common gaseous state, dinitrogen gas (N2) comprises 80% of our atmosphere but it is nonreactive, and therefore not directly assimilated by most life forms. Nitrogen availability was severely limited in the primordial environments where life is thought to have first existed in the form of precell nucleic acids and polypeptides, and evolved into the simple metabolic systems of self-replicating RNAs and cells (Glansdorff et al., 2008; Lane et al., 2010; Martin et al., 2008; Nitschke and Russell, 2009; and references therein). With the stabilization of the three lineages (domains) of cellular organisms, nitrogen has become an essential part of all information polymers (nucleic acids and protein) and the universal storage molecules for energy (ATP) and reductant (NADH, NADPH, FADH2). Before the invention of industrial ammonia production by Haber and Bosch in 1906, fixation of atmospheric dinitrogen occurred only via a limited group of microorganisms and abiotically by lightning. Discovery of the industrial conversion of dinitrogen into reactive inorganic “fixed” forms of N was a blessing for agriculture, and likely the most significant contribution to date toward meeting the growing nutritional needs of the world’s population. However, the extensive application of reactive fixed N in the form of fertilizer and manure has also led to a dangerous redistribution of environmental nitrogen, creating levels of fixed N estimated to be
mRNA Expression in N-Cycle Metabolism
347
3.5-fold above natural levels (Rockstro¨m et al., 2009). Together with increasing combustion of coal and fossil fuels (which also produce highly reactive N oxides or NOx), excessive input of ammonium fertilizer has left a massive human ecological “footprint” on the natural N-cycle. Nitrous oxide (N2O) is 300 times more persistent than CO2 in the atmosphere, and is the major factor in ozone destruction. The continued expanding application of reactive N is now linked to a growing number of environmental problems, for example, harmful algal blooms and global warming (Duce et al., 2008; Galloway et al., 2008; Gruber and Galloway, 2008). Recent global assessments of N2O production identify the Mediterranean, Baltic and North Seas, the Caribbean, and the Southeast Asian coast line spanning from China to India as the most productive regions of reactive N in the world (Galloway et al., 2008). Understanding the specific contributions of different microbes and their metabolic capacities to the global N-cycle is therefore of critical importance to our continued existence and the well being of planet Earth. Recent advances in our ability to obtain sequences corresponding to entire microbial genomes now allows for relatively efficient identification of potential contributions in the N-cycle by comparative bioinformatics. Methods to assess relevant changes in gene expression by analysis of RNA have also been greatly simplified in the last half-decade, providing similarly powerful tools capable of identifying novel metabolic contributions to the global nitrogen cycle. Here we describe one of these approaches, and how they have allowed the authors to advance our knowledge of the potential contributions of individual microbes in individual biological nitrogen transformations upon which all life forms depend.
2. Nucleic Acids as Markers of N-Metabolic Activity 2.1. RNA analyses have distinct advantages in determining microbial contributions to the nitrogen cycle Complex microbial communities contribute combined nitrogen transformation activities constituting the N-cycle. It was recognized early on that it is important to identify individual microorganisms contributing to this process (“Who is there?”), and recent key findings confirm that many of the relevant microbes are still poorly described, or even unknown. More importantly perhaps, individual microbes are now known to contribute to multiple processes, for example, ammonification, nitrification, and denitrification by ammonia-oxidizing bacteria (Klotz and Stein, 2010; Wrage et al., 2001, 2004). The N-cycle research community has therefore now come to realize that investigation of the molecular basis for these
348
James E. Graham et al.
transformation processes must go beyond identification of only the functional cohorts involved. Answering this second main question “What is everybody doing?” then requires assessment of the individual molecular inventories that facilitate all the steps of relevant transformation processes. A central feature of this new understanding and corresponding approach is the view of microbial metabolism in terms of functional modules rather than key enzymatic activities, which must then have clear genetic boundaries. Whereas the unity of biosynthesis (confirmed by genome-informed analyses of microbial metabolism) makes the discovery and study of anabolic processes comparatively simple, the identification and concomitant study of catabolic processes remains more difficult due to both a vast diversity and high redundancy in participating inventory, and the multitude of ways to regulate their availability (expression) and function (activity). Universal approaches to characterizing and evaluating individual contributions at the molecular level are limited, but one that can be applied to all microbes (including those that are still elusive to culture in laboratories) is the examination of relevant gene expression at the RNA level. While protein-encoding RNA is an intermediate in gene expression, coupled transcription and translation of gene products in bacteria and archaea increases the probability that steady-state mRNA levels will reflect protein expression levels. Regulation of prokaryotic gene expression has traditionally been viewed as taking place primarily at the RNA level. A few recent studies have followed global changes in both cellular protein and mRNA levels in bacteria growing in different environments (Hamilton et al., 2009; Taniguchi et al., 2010; Xia et al., 2006). Useful correlations indicating likely relevant metabolism were found, particularly among those genes whose expression changed most. Posttranscriptional regulatory mechanisms in bacteria obviously can play dominant roles, and protein abundance per mRNA also varies widely among different E. coli transcripts (Lu et al., 2007). While increased steady-state mRNA levels then do not alone guarantee an increase in any associated metabolic activity, it is also difficult to hypothesize why regulated mRNA levels in bacterial cells would rise if not to increase production of the encoded proteins. RNA like DNA (but not protein) has the unique property of allowing very accurate quantification by amplification with the polymerase chain reaction (PCR), extending to the very low levels typically present in natural sources.
2.2. Quality RNA is key All RNA-based analyses of gene expression are entirely dependent on the extent to which RNA can be obtained directly and without alteration from microbes in environments of interest. After making every effort to collect microbes while minimizing changes to their environments (and corresponding RNA expression patterns, individual transcripts having
mRNA Expression in N-Cycle Metabolism
349
half-lives (on the order of minutes) we can prevent further changes by blocking the enzymatic activities that normally determine relative mRNA levels in bacterial cells. Both reduced temperature and chemical inhibition of cellular RNases have been found to be effective. Although mesophilic bacteria are known to respond to reduced temperature in the 10–15 C range by reducing turnover of a limited number of cold shock mRNAs (Gualerzi et al., 2003)), further reduced transcriptional and translational elongation rates at temperatures near freezing is expected to minimize this potential issue for microbes not adapted to life at low temperatures. Alternately, chemical reagents that quickly penetrate bacterial cells (often without lysis) including ethanol (Williams et al., 2003) and chaotropic salts (Chirgwin et al., 1979; Chomczynski and Sacchi, 1987) are able to quickly stop changes in cellular mRNA levels associated with removing bacteria from environments of interest. However, these must also be applied in a very timely way. While this is easy enough to appreciate, the relevant timescale being seconds often remains a real issue, particularly for those collaborating in these kinds of studies. Successful isolation of intact RNA is then dependent on effective disruption of bacterial cells and purification away from contaminating DNA and proteins, while maintaining inhibition of cellular ribonucleases. Fortunately even the most difficult to lyse bacteria are typically sensitive to the grinding action of dense zirconium beads when used in a high speed (e.g., 6.5 m/s) reciprocal shaker like a Savant Forma FP-120 or BioSpec Mini-BeadBeater. It is of course unlikely that relative transcript abundances will be maintained with any enzymatic treatment (e.g., lysozyme or protease) that requires incubation at 37 C in a compatible buffer. Commercial formulations of lysis buffers often containing guanidine thiocyanate typically contain proprietary detergents that may improve RNA yield and quality relative to the original N-lauroyl sarcosine (sarkosyl) (Chomczynski and Sacchi, 1987) for some organisms, but not others. Similarly, additional cold organic extractions with acidic phenol and chloroform may increase (and less often decrease) the desired removal of proteins, carbohydrates, and glycolipids, and do influence subsequent spectrometric and electrophoretic analyses (Fig. 14.1). A systematic approach to different inhibitors and purification regimes including increasing lysis buffer to cell pellet ratio is often the best approach, and may become necessary to work with less well-described organisms (Luo and Stevens, 1997). Addition of a LiCl RNA precipitation step (Cathala et al., 1983) will often help reduce carryover of bacterial genomic DNA to levels allowing effective deoxynuclease treatment, as commercial silica-based column resins may show very little discrimination for binding RNA relative to DNA in different lysates. Inclusion of fresh beta-mercaptoethanol (Chomczynski and Sacchi, 1987) in the working lysis buffer, or better adding dithiothreitol (DTT) powder directly to any lysis buffer, can also usually improve results by inhibiting refolding of some RNases.
350
James E. Graham et al.
A 1
2 3a 3b 4a 4b 5a 5b 6a 6b 23 S 16 S
B
1
2 3a 3b 4a 4b 5a 5b
6a 6b
Figure 14.1 RNA extraction and analysis on nondenaturing agarose gels. Mycobacterium tuberculosis H37Rv, a difficult to lyse bacterium, was grown in standard laboratory broth to mid-logarithmic phase (2 108 bacteria/mL). Bacterial RNA was extracted by Savant FP120 “bead beating” with silica–zirconium beads in quadruplicate from 4 108 bacteria pelleted in 2 mL microcentrifuge tubes. All parallel extractions, as described in the text, involved precipitation of RNA with 2.5 M LiCl, while panel (B) shows corresponding RNAs obtained after a second ethanol–ammonium acetate precipitation. Lanes contain (1) standard DNA markers, (2) bacteriophage MS2 RNA loading control, (3) H37Rv RNA obtained in duplicate phenol–chloroform extractions, (4) by organic extraction followed by DNase I treatment, (5) by silica column binding, and (6) by silica column binding with DNase treatment. Variable yields with organic extraction as well as changes in gel migration from residual contaminants including nucleases, or additional ethanol precipitation (B6), can be seen following different purification methods. Samples were loaded in standard urea loading buffer on a nondenaturing gel in a buffer after heating for 1 min at 65 C.
Although RNA quality can be easily assessed by visualization of rRNA bands on a conventional agarose gel (Fig. 14.1), somewhat larger amounts of material (1–5 mg) are needed for electrophoresis than for most experimental RT-qPCR assays. Access to an Aligent capillary electrophoresis apparatus will allow laser-induced fluorescent dye binding relative to standards, allowing analyses of nanogram RNA quantities. Care must be taken in interpreting these data as mechanical disruption of hard-to-lyse bacterial cells can lead to variations in the apparent 28S/16S rRNA ratios determined as a proxy for integrity of sample relevant mRNAs. rRNAs are also likely less sensitive to degradation by the nucleases involved in normal mRNA turnover that are released during RNA isolation. Alternately, the RTqPCR assays described below once developed are a very sensitive approach
mRNA Expression in N-Cycle Metabolism
351
to verifying mRNA integrity (e.g., comparison of relative reference mRNA levels in replicate and independent RNA preparations).
2.3. cDNA synthesis is both necessary and problematic Perhaps the “weakest link” in current RNA analysis methods is the conversion of RNA obtained from bacteria growing in environments of interest into cDNA. Although having the advantage of greatly stabilizing the research material (from enzymatic and chemical decay), in vitro synthesis of cDNA with viral reverse transcriptases is typically inefficient, giving at best about 30–80% conversion to first-strand cDNA (as incorporated radio nucleotide) with enzyme manufacturer’s protocols (and often less, in our experience) (Sieber et al., 2010; Stahlberg et al., 2004). Various suggestions including using longer random primers (9–15 mers) (Stangegaard et al., 2006) and reverse transcriptase primers targeting only specific transcripts of interest (Diercks et al., 2009) have been shown to increase efficiency. However, this area remains problematic and is not routinely assessed by experimenters, particularly with regard to potential differences in efficiency with different individual mRNA templates at different absolute and relative levels. Ruling out relevant difference in reverse transcriptase template efficiency would require relatively difficult comparative efforts with in vitro synthesized relevant RNAs. However, as described below, these issues are likely minimized when comparing steadystate transcript levels by RT-qPCR targeting the identical region of relevant transcripts in a microorganism residing in varying environments.
2.4. PCR primers must be chosen (and chosen again) carefully While current efforts typically choose “any region” of RNA for quantitative determinations, it’s quite clear that RT-qPCR results are highly dependent on the specific region targeted by amplification primers (PoretPeterson et al., 2008). Primers for quantitative PCR are frequently selected using popular software (e.g., Primer3, from M.I.T., Primer Express, from Applied Biosystems) to identify 200-bp target regions of average GC content lacking homopolymeric tracts and corresponding primers unlikely to form secondary structures or capable or pairing with one another. However, many other experiments require manual selection of primers based on specific residue polymorphisms to discern different messages and sources. Because bacterial and archaeal functional genes generally lack introns selection of exon boundaries as target sites is usually not an option. Therefore “no-RT” controls need to be included with every new RNA template to determine residual genomic DNA levels. Differences in detection of different transcript regions by RT-qPCR result from a combination of both “artificial” differences in templating efficiency (for both reverse transcriptase and amplifying DNA polymerase)
352
James E. Graham et al.
in addition to the real differences in steady-state levels for different regions along an mRNA among transcripts present in bacterial cells. For example, among the few mRNAs whose decay pathways have been characterized in E. coli, there is often an initial endonucleotyic cut made in the upstream region, followed by exonucleolytic decay from both original and new 30 ends. Steady-state levels for different regions within transcripts then are determined by both their rate of synthesis and rate of degradation. Eubacterial RNA synthesis proceeds at an average rate of about 40–80 nucleotide per second (Proshkin et al., 2010), and is also highly variable within different template regions (Dennis et al., 2009). For transcripts with short half-lives and longer polycistronic messages, normal RNA decay pathways are already altering measured steady-state levels even before synthesis of the mRNA is complete. These activities are then strongly influenced by ribosome occupancy in terms of which regions along the RNA are more resistant to normal degradation. In terms of copies of mRNA per coding region, direct pyrosequencing of different bacterial transcriptomes by approaches such as RNA-seq indicate that levels of most mRNAs are normally distributed at very low level or stochastic levels of less than one per cell, and that these levels then can easily change by 100-fold or more (Passalacqua et al., 2009; Taniguchi et al., 2010; Wurtzel et al., 2010). The authors’ experiences would suggest that more modest changes in the range of 6- to 10-fold as determined by RT-qPCR are more typical when assaying levels of relevant individual mRNAs (Poret-Peterson et al., 2008; Price et al., 2008). Even when we are able to chose primers whose efficiency in PCR we can show to be similar on dilutions of corresponding bacterial genomic DNA, without direct determinations we are not sure that target regions are equally efficient as template for reverse transcriptase (e.g., containing relevant secondary structure) nor that they are representative of the coding region of the transcript on the whole. If this is a concern, then multiple transcript regions may need to be taken into account in estimating relative mRNA abundance levels, with the understanding that the least abundant region is likely to be limiting in terms of producing the encoded peptide. In experiments designed to determine potential bacterial metabolic contributions to the N-cycle, RNA will often be obtained from bacteria collected from or cultured in different environments. These issues and sources of errors in quantification will be reduced in these experiments in comparing detection of the same specific transcript region by RT-qPCR in different bacteria.
2.5. Determining relative mRNA expression levels requires a reliable internal standard Although addition of an external RNA standard to a fixed amount of extracted total RNA prior to RT-qPCR might be used to determine absolute mRNA expression levels in highly similar specimens (Liu et al.,
mRNA Expression in N-Cycle Metabolism
353
2009; Smith et al., 2003) typically different microbial cultures or samples will contain large differences in numbers of cells. Bacteria grown under different conditions also often differ in the efficiency of extracting nucleic acids. While measuring total RNA (i.e., rRNA) or genomic DNA or enumerating microbes would provide a means of correcting for this variability, these measurements raise additional issues minimized if an mRNA whose steadystate levels remains constant under relevant conditions can be identified. Better even average mRNA levels for a group of reference genes (Vandesompele et al., 2002) or so-called “housekeeping” transcripts (Pfaffl et al., 2004) can be used to compare levels of mRNAs of interest in bacteria from different environments. Previously, rpoD, rpoB, gyrB, sigA, rssA, recA, and microbial cohort-specific functional genes have served as reliable internal references in different studies comparing mRNA expression levels of interest. The process of detecting PCR reaction products as the reaction proceeds, or “real-time” PCR (Higuchi et al., 1993) has greatly improved the efficiency of gene expression studies. Combining a preliminary reverse transcriptase activity with florescence-monitored PCR, or as suggested as a standard nomenclature “RT-qPCR” (Bustin et al., 2009) also provides the extraordinary sensitivity needed to compare typical baseline stoichiometric transcripts levels of less than one mRNA per cell in small number of bacteria (Palmer et al., 2003). RT-qPCR can also allow discrimination between nearly identical molecules, for example transcripts from paralogous genes within a single genome differing by a single nucleotide, or those from highly similar species contributing to N-cycle metabolism as a consortium. Methods to detect amplification of targeted regions in RT-qPCR include both intercalating dyes binding double stranded nucleic acid (i.e., ethidium bromide and SYBR green) as well as target-hybridizing oligonucleotides bearing dual fluorescent markers (e.g., TaqMan chemistry). Initial detection of signals above background at discrete PCR cycle numbers then provides a cycle number or threshold (or Ct value) reflecting the number of cDNA copies of the transcript region of interest present in the sample. Among the issues potentially impacting these determinations are the previously described RNA quality, target selection, and template efficiencies, and include selecting appropriate experimental design, quantification method, and data and statistical analyses, as well as lack of standard nomenclature in describing results (Bustin et al., 2009). Among the most widely used approaches is one suited to determining potential microbial N-cycle contributions, that of determining relative expression levels (rather than absolute levels indicated by constructing a standard curve). A reference transcript or group of transcripts can be identified or validated using existing or pilot studies, and used as an internal standard for determining changes in steady-state mRNA levels for genes of interest from samples taken from microbes in two different environments. A comparative Ct method can then be used to compare difference in detection threshold (Ct) for the
354
James E. Graham et al.
transcript of interest and for the reference transcript among microbes in two different environments (as one would compare a treated and untreated sample). A specific approach developed by Pfaffl and colleagues (Pfaffl et al., 2002) allows for comparison of multiple reference and experimental transcripts levels with both PCR replicates and treatment groups. With a statistical approach called REST (Relative Expression Software Tool), relative expression levels in microbes can be compared if serial dilutions of each RNA or cDNA are first compared for efficiency of amplification (Bustin and Nolan, 2004), and limited differences corrected for when comparing targeted regions in each sample. REST then uses a pairwise randomization test to calculate a measure of the statistical significance of the reported fold-change in steady-state mRNA level based on these data. Planning a successful RT-qPCR experiment will need to take into consideration the specific type and amount of available sample, and will require choosing among available cDNA priming methods, reverse transcriptases, and PCR instrumentation and monitoring approaches. In the authors experience, good results have been obtained with random-priming total RNA extracted from bacterial pellets with either 9-mer or 15-mer deoxyoligonucleotides (Stangegaard et al., 2006), using RNAse H MMLV reverse transcriptases (Superscript II and III, Invitrogen, Carlsbad, CA) and 5 mg of RNA templates standard 20 mL reactions as described by the enzyme manufacturer. Care is taken to denature template with primers in 0.1 mM EDTA containing Tris–HCl buffer, and not exceeding 70 C. We then dilute the reaction products at least threefold for single-tube triplicate SYBR Green qPCR reactions for each primer pair (i.e., reference mRNA or transcript of interest), avoiding any possibility of competing PCR reactions. A strategy of using master and submaster mixtures divided across all similar reactions proves critical in our experience, as does the using a lightweight benchtop microcentrifuge to bring reactants to the bottom of tubes. We also find that although some oligodeoxnucleotide primers are very stable, other sequences are not at all, requiring even monthly synthesis, even when routinely resuspending new primers at high concentration (e.g., 3 mg/mL and storing in single-use aliquots at 70 C). Nolan et al. (2006) have previously described very detailed step-by-step protocols for qPCR, including important optimizations that will be appropriate and important in all RTqPCR analyses.
2.6. Protocol: Bacterial RNA isolation Preferred approach (most Gram-negative and readily lysed species, based on Emory and Belasco, 1990) 1. Grow 100 mL culture to mid-log phase
mRNA Expression in N-Cycle Metabolism
355
2. Pour directly into four prechilled Oak Ridge centrifuge tubes (50 mL) on wet ice 3. Centrifuge at 4 C and 9000 rpm for 5 min, return to ice 4. Decant and resuspend each in 10 mL cold 300 mM glucose/50 mM Tris–HCl (pH 7.0) 5. Centrifuge at 4 C and 9000 rpm for 5 min, return to ice 6. Resuspend pellets in 500 mL cold 300 mM glucose/100 mM NaOAc (pH 4.0) 7. Transfer 125 mL to four cold microfuge tubes 8. Add 50 mL of 20% SDS, vortex and place in 65 C block for 3 min (should visibly clear on lysis) 9a. Add 500 mL of water equilibrated distilled phenol, vortex, 65 C for 3 min 9b. Alternately, proceed with Qiagen RNA-Easy as in 2b below without bead beating 10. Return to ice and add 100 mL of chloroform:isoamyl alcohol (CIA 24:1), vortex 11. Ice 3 min, spin 2 min, and remove aqueous phase 12. Add 500 mL phenol, vortex, add 100 mL CIA, vortex, ice 13. Spin, collect aqueous phase, extract with CIA 14. Precipitate with 0.6 vol of isopropanol, ice 10 min, spin 20 min at room temperature 15. Resuspend in 100 mL of “D” solution (see below) and reprecipitate with ethanol 16. Wash pellet by resuspending in 70% ethanol, spin, and dry briefly at 37 C 17. Check 1/20 of prep for rRNA on regular TAE agarose gel as for DNA. Load in urea buffer after heating to 55 C for 1 min 18. DNAse according to enzyme manufacturer’s instructions and recheck on gel 19. Store RNA in 5 mg aliquots as ethanol–amonium acetate precipitates For tougher bacteria including mycobacteria (based on Chomczynski and Sacchi, 1987) 1. Proceed through step 5 above 2a. Immerse Oak Ridge tube with pellet in 70 C water beaker and add 70 C “D” solution (4 m guanidinium thiocyanate, 25 mM Na-citrate (7.0), 0.5% sarcosyl, 0.1 M BME). 2b. Alternately, keep on ice and instead add Qiagen RNA-Easy lysis buffer after adding fresh DTT powder to the working aliquot. (Increase the ratio of lysis buffer to cell pellet until consistent results are obtained.) 3. Pipette to resuspend bacteria, and transfer to multiple 2 mL screw-cap microfuge tubes with 0.5 mL of zirconium beads (BioSpec Bead
356
4. 5. 6. 7.
James E. Graham et al.
Beater). (For RNA-Easy, now heat tubes in block to 65 C for 1 min and return to ice.) Shake at maximum speed 5 1 min in FastA or Bead-Beater, alternating to ice as heat develops. Spin at maximum 1 min, and collect aqueous as above, adding NaOAc (pH 4.0) to 0.1 M prior to phenol extraction as in steps 12 and 13 above. DNAse according to enzyme manufacturer’s instructions setting after setting aside an aliquot for analytical gel comparison Aliquot RNA obtained to multiple tubes and precipitate with ethanolamonium-acetate for subsequent analytical and experimental analyses. Notes: 1% SDS seems to be a better RNase-inhibiting lysis buffer than chaotropic salts with some Gram-negative bacteria. The ratio of lysis buffer to cell pellet is critical, and must first be determined for each species with by performing small-scale extractions with decreasing buffer. The use of water equilibrated phenol, 5:1 ratio of phenol to CIA, and extracting on ice are often able to remove the bulk of the DNA. If not, better results may be obtained by first precipitating RNA with 2.5 M LiCl (final), and then removing remaining contaminants by washing RNA bound to silica-glass matrix columns available from several manufacturers. Check RNA obtained by resuspending a precipitate in urea gel loading buffer and electrophoresis on a nondenaturing agarose gel (as shown in Fig. 14.1). If the first procedure above gives good appearance, avoid the bead beating which shears contaminating DNA (otherwise seen as a single MW single band), and may not be as good as hot SDS in preserving mRNAs. If the first procedure fails or gives very low yields, use the second method. Bacteria typically have 5–20 mg of RNA per 109 cells. RNA prepared by any approach MUST be stored as multiple precipitates in ethanol, and a glycogen carrier will greatly help verify precipitation and successful ethanol washes.
3. Gene Expression in Bacteria That Facilitate Reactive Nitrogen Transformations 3.1. N-cycle organisms and reactive nitrogen transformation pathways The nitrogen cycle includes a wide array of intermediates that are classified as either fixed (solid or liquid) or volatile (gaseous), or as inert (N2) or reactive (all other intermediates). The major fixed reactive nitrogen species
357
mRNA Expression in N-Cycle Metabolism
include ammonium (NH4þ), nitrite (NO2), and nitrate (NO3) and their interconversion through intermediates such as hydroxylamine (NH2OH) or nitroxyl (nitrosyl hydride, HNO) and their removal via fixed (hydrazine, N2H4) or volatile (nitric oxide, NO; nitrous oxide, N2O) intermediates to dinitrogen (N2) is facilitated by a diverse set of molecular inventory employed by numerous microorganisms. Since the interconversions represent redox processes, most of them are either coupled to dissimilatory catabolic electron flow tied to oxidative phosphorylation and anaerobic respiration or part of anabolic electron sink reactions during nitrogen assimilation (see Fig. 14.2). Dissimilatory nitrate reduction to dinitrogen, the major microbial nitrogen removal process in marine ecosystems, occurs in form of two major pathways under hypoxic and anoxic conditions, respectively: classical denitrification with nitrous oxide as a mandatory intermediate and denitrifying ammonia oxidation also known as anammox (Fig. 14.2; Klotz and Stein, 2010). In classical denitrification, the transformation of nitrate to nitrite to 0 N2
4
1
5 +1
N2O
–2
N2H4
–3
4
NH4+
5
NH3
7 +2
NO
5
4
– +3 NO2
4
7 +5
3
Mineralization
–3 R~NH2
2
6 2
Assimilation
NH2OH
8
–1 8
HNO +1
NO3–
Figure 14.2 Processes in the microbial nitrogen cycle reproduced from Klotz and Stein (2010). The oxidation state of each intermediate is indicated. The pathway for archaeal ammonia oxidation is putative as based on genomic inference (Walker et al., 2010). (1) Dinitrogen fixation. (2) Aerobic oxidation of ammonia to nitrite by bacteria. (3) Aerobic oxidation of nitrite to nitrate by bacteria. (4) Classical denitrification. (5) Denitrifying anaerobic ammonia oxidation (Anammox). (6) Respiratory ammonification. (7) Assimilatory ammonification. (8) Aerobic oxidation of ammonia to nitrite by archaea. The dots indicate aerobic hydroxylamine oxidation and dissimilatory nitrite reduction pathways of aerobic nitrifier denitrification.
358
James E. Graham et al.
nitric oxide to nitrous oxide and often also to dinitrogen, nitrite reduction to nitric oxide is the rate-limiting step that is catalyzed by either coppercontaining NirK or cytochrome cd-1 NirS nitrite reductase enzymes (Zumft, 1997; Zumft and Kroneck, 2006). The genes encoding their catalytic subunits (nirK and nirS) have been used extensively as targets to study the structure of nitrite reducer communities in aquatic and terrestrial environments, and these studies were often amended with probing for genes encoding nitric oxide (i.e., norB, norZ) and/or nitrous oxide (nosZ, nosW) reductases to identify the classical denitrifier community (Avrahami et al., 2002; Braker and Tiedje, 2003; Braker et al., 1998, 2000, 2001; Falk et al., 2010; Oakley et al., 2007; Prieme et al., 2002; Santoro et al., 2006; Simon et al., 2004). Classical denitrification constitutes one of the main forms of anaerobic respiration and is performed by a great diversity of heterotrophic bacteria including many pathogens of humans and other animals. Classical denitrification has long been considered the only pathway for nitrogen loss from marine and terrestrial ecosystems (Zumft, 1997; Zumft and Kroneck, 2006). However, since 1999 evidence for denitrification during anaerobic oxidization of ammonia (anammox) as another major pathway for nitrogen removal has emerged (Fig. 14.2; Dalsgaard et al., 2005; Francis et al., 2007; Jetten et al., 2005; Kuenen, 2008; Schmidt et al., 2003; Strous et al., 1999). NO-forming nitrite reductase-encoding genes have been identified in the genomes of anammox bacteria; however, nitrous oxide-forming nitric oxide reductase genes are absent from anammox bacterial genomes ( Jetten et al., 2009; Strous et al., 2006). Because nitrite-derived nitric oxide is the sole oxidant of ammonia in the anammox process ( Jetten et al., 2009), both divergent denitrification pathways compete fiercely for nitrite (Kartal et al., 2007). Likewise, the molecular inventory responsible for denitrifying N-removal competes for the same nitrite pool with the inventory involved in ammonification, which retains the transformed nitrogen in the system. Both assimilatory nitrate reduction to ammonia (ANRA) and dissimilatory (respiratory) nitrate reduction to ammonia (DNRA) interchangeably employ one of the molybdopterine guanine dinucleotide-based enzymes for nitrate reduction: periplasmic dissimilatory (napA) and the cytoplasmic soluble (nasA) and membrane-bound respiratory (narG) nitrate reductases; any of which may also participate in the nitrate reduction step of denitrification (Fig. 14.2). Detection of nitrate reduction inventory per se is thus not useful for identifying or discriminating between either form of denitrification as well as ammonification. On the other hand, ammonifiers use dedicated sets of enzymes and reductant shuttles for the reduction of nitrite to ammonia. For ANRA, microbes employ assimilatory cytoplasmic ferredoxin-dependent (the nirA gene product in Cyanobacteria and Epsilonproteobacteria) or NADH-dependent (the nirB/nasB gene product in Beta- and Gammaproteobacteria) nitrite reductases, both of which contain a single siroheme and a [4Fe–4S]
mRNA Expression in N-Cycle Metabolism
359
center (Malm et al., 2009; Martiny et al., 2009; Moreno-Vivian et al., 1999). For DNRA, the major enzyme is the respiratory pentaheme cytochrome c nitrite reductase (nrfA; Pittman et al., 2007; Simon, 2002; Smith et al., 2007). A novel dual N assimilation and respiratory mechanism employing the reverse hydroxylamine-ubiquinone redox module (HURM; Klotz and Stein, 2008) pathway (haoA’þcycB) has been reported recently (Campbell et al., 2009). Interestingly, the nrfAH and haoA’þcycB inventories are homologues (Bergman et al., 2005; Kim et al., 2008; Klotz et al., 2008). Ammonia, whether available in the environment, obtained by nitrogen fixation or by ammonification from NOx, is another important pool of reactive nitrogen. When not assimilated into biomass by respective pathways employing glutamate dehydrogenase, GS-GOGAT or alanine dehydrogenase or removed from the system by the anammox process, the major transformation pathway is nitrification (Fig. 14.2). Nitrification is defined as the aerobic oxidation of ammonia to nitrite followed by the aerobic oxidation of nitrite to nitrate. Together with DNRA, ANRA, assimilatory, and respiratory ammonification, nitrification represents one of the key transformation processes between different fixed nitrogen intermediates (Fig. 14.2; Allen et al., 2001; Brandes et al., 2007; Butler and Richardson, 2005; Ferguson and Richardson, 2005; Jepson et al., 2006; Klotz and Stein, 2008; Lin and Stewart, 1998; Moreno-Vivian et al., 1999; Potter et al., 2001; Simon, 2002; Smith et al., 2007; Tavares et al., 2006; and references therein). Although nitrifying bacteria and the nitrification process have been studied for more than 100 years (Arp and Bottomley, 2006; Bock et al., 1991; Prosser, 1989; Winogradsky, 1892), our knowledge of the molecular underpinnings of both was restricted to sequences of genes encoding rRNA and the key enzymes involved in nitrogen transformations; this has changed dramatically the genomic era (Arp et al., 2007; Klotz and Stein, 2010; and references therein). In addition, the discovery of broadly distributed ammonia-oxidizing archaea (de la Torre et al., 2008; Hallam et al., 2006; Hatzenpichler et al., 2008; Ko¨nneke et al., 2005; Leininger et al., 2006; Martens-Habbena et al., 2009; Nicol and Schleper, 2006; Prosser and Nicol, 2008; Walker et al., 2010) and cohorts of taxonomically diverse methanotrophic bacteria with the ability to nitrify (Nyerges and Stein, 2009; PoretPeterson et al., 2008) has extended the list of nitrifying microorganisms significantly. While the ammonia-oxidizing archaea also aerobically denitrify without a nitrous oxide intermediate (Bartossek et al., 2010; Klotz and Stein, 2010; Schleper and Nicol, 2010; Walker et al., 2010), AOB and nitrifying methanotrophs are also capable of (aerobic) nitrifier denitrification (Sutka et al., 2003, 2006; Wrage et al., 2001, 2004) because they produce and release NO and N2O in the presence of oxygen. The recently described anaerobic methane-oxidizing bacterium, Methylomirabilis oxyfera in the deep-branching phylum NC10, also has the genetic potential to nitrify (oxidize ammonia to nitrite via hydroxylamine using particulate
360
James E. Graham et al.
methane monooxygenase and hydroxylamine oxidoreductase) in an anoxic environment by using the dioxygen produced by dismutation of NO (Ettwig et al., 2010). Because the dismutation of NO also produces dinitrogen (Ettwig et al., 2010), the anaerobic oxidation methane by M. oxyfera is thus coupled to denitrification (Ettwig et al., 2008, 2009) without a nitrous oxide intermediate (Ettwig et al., 2010). It thus appears that M. oxyfera harbors the necessary inventory to facilitate a closed nitrogen cycle within the cell (nitrification, ammonification, denitrification), which may allow this bacterium to thrive in environments with varying external ammonia and nitrite concentrations. The regulation of expression of relevant genetic inventory is likely very complex and presents itself as a likely target for testing hypotheses by applying the described methodology for the detection and quantification of steady-state mRNA levels using RT-qPCR.
3.2. Laboratory culture of aerobic N-cycle bacteria with emphasis on expression studies To illustrate the workflow for the investigation of gene expression in nitrogen cycle microorganism, we will describe one for the marine Gammaproteobacterium, Nitrososoccus oceani, a microbe with the ability to nitrify, denitrify, and ammonify. In particular, we chose to present the transcriptional state of a subset of genes involved in nitrification and denitrification that exhibited differential expression in response to treatment with the reactive nitrogen compounds ammonia, and hydroxylamine. Growth conditions. N. oceani ATCC19707 was grown in artificial seawater medium composed of 29.2 g NaCl, 1.7 g (NH4)SO4, 0.75 g KCl, 0.25 g NaHCO3, 4.1 g MgCl26H2O, 1.5 g CaCl22H2O, 0.02 g NaCO3 H2O, 7.5 g MgSO4 7H2O, 0.016 g K2HPO4, 0.011 K2HPO4 3H2O, 0.001 g Fe EDTA, 0.1 mg Na2MoO4 2H2O, 0.2 mg MnCl2 4H2O, 0.1 mg ZnSO47H2O, 0.002 mg CoCl2 6H2O, and 0.02 mg CuSO45H2O per L distilled H2O. Phenol red (0.001 g per L distilled H2O) was added as a pH indicator and the pH of medium adjusted to 6.9 with HCl prior to autoclaving (final pH 8.0). The final concentration of ammonium in this maintenance medium is 12.5 mM, which amounts to an availability of ammonia at approximately 0.144 mM (Table 14.1). Ammonia but not ammonium is the sole source of energy and reductant for obligate lithotrophic AOB (Hyman and Arp, 1992, 1995). N. oceani cultures were grown in the dark at 30 C in volumes of 0.2 L (in 0.5 L flasks) or 0.6 L (in 2 L flasks) and were monitored daily for pH change due to nitrite (NO2) production (pink to yellow) and adjusted to an approximate pH 8 with addition of 0.25 M K2CO3. To obtain sufficient biomass for RNA isolation, the cultures were harvested in the late exponential or early stationary growth phase by centrifugation (8000 g, 15 min, 4 C), resuspended in fresh artificial
361
mRNA Expression in N-Cycle Metabolism
Table 14.1 pH dependent availability of ammonia in growth media
pH 6.9
pH 7.6
pH 8.0
(NH4)2SO4 (mM)
Equivalent NH3 (mM)
0.05 mM 5.0 mM 12.5 mM 0.05 mM 5.0 mM 12.5 mM 0.05 mM 5.0 mM 12.5 mM
0.00005 0.005 0.012 0.00024 0.0237 0.0593 0.00058 0.058 0.144
seawater medium and this step was repeated two or three times every 4 weeks until sufficient biomass was obtained. Isolation of nucleic acids at this point usually yields 2–3 mg total DNA or 15–30 mg total RNA. Prior to the 24-h experimental treatment, N. oceani cells were harvested at mid-exponential growth phase and washed twice with NH3-free artificial seawater medium. The washed cells were resuspended in 0.2 L artificial seawater medium containing 0.05 mM (NH4)2SO4 amended with 2.4 g HEPES per L to prevent acidification of medium upon NO2 production during the experiments (pH buffered at 7.6). For the experiments investigating gene expression at different concentrations of ammonia, cultures were maintained at either 0.05 mM (NH4)2SO4 or 5 mM (NH4)2SO4 for 24 h or at 0.05 mM (NH4)2SO4 for 20 h, followed by a 4 h exposure to 5 mM (NH4)2SO4. Cultures treated with hydroxylamine (NH2OH) were maintained at 0.05 mM (NH4)2SO4, for 23.5 h followed by exposure to NH2OH at a final concentration of 0.2 mM for 0.5 h. Stock solutions of NH2OH were prepared with autoclaved distilled H2O, filter sterilized, and used immediately. After each of the incubations, the cultures were harvested at 8000g for 10 min at 4 C and used immediately for RNA extraction as described above in Section 1.6.
3.3. Using genome-informed metabolic reconstruction of catabolic pathways to select target genes N. oceani encodes a greater than average diversity in the oxidative branch of its catabolic electron transport flow (Klotz and Stein, 2010; Klotz et al., 2006) suggesting the need for complex regulation. This diversity might be responsible for the bacterium’s ability to thrive in oligotrophic marine environments with varying salt and oxygen concentrations. Also, while AOB found in freshwater and soil environments can physically associate with a diverse array of NOB to form nitrification aggregates, the marine
362
James E. Graham et al.
AOB cannot as to prevent the highly likely sinking out of the photic zone. In particular, while the inventory in the reductive branch of catabolic electron flow that facilitates nitrification is nonredundant and encoded single copies of respective genes (amoCABD, haoAB-cycAB), the oxidative branch contains several redundant players implementing energy conservation (e.g., complexes CIII and CIV), electron disposal (e.g., cytochrome c peroxidases), and electron-flow-coupled reactive nitrogen removal (e.g., NIR and NOR) (Arp et al., 2007; Klotz and Stein, 2010; Klotz et al., 2006). To selectively incorporate particular inventory into its respirasome complement at any given time, the transcription of their encoding genes needs to be differentially regulated. For the purpose of this example, we chose the genes listed in Table 14.2. Cells were grown into late exponential growth phase as described above, denied ammonia for 24 h and divided into equal batches. One batch culture was provided 5 mM (NH4)2SO4 for 4 h or 0.2 mM NH2OH for 30 min before total RNA was isolated from both cultures and further processed
Table 14.2 Selected genes targeted for analysis of transcript levels Gene
Enzyme complex
Process involved
amoA
Ammonia monooxygenase Hydroxylamine oxidoreductase [2Fe–2S]-protein of Complex III Monoheme cytochrome c552 Monoheme cytochrome c552 CyoA subunit of Complex IV CyoA subunit of Complex IV Soluble cytochrome c peroxidase Soluble cytochrome c peroxidase Multi-copper nitrite reductase Cyt c subunit of cNOR Soluble Cyt c 0 -beta putative NOR
Oxidation of NH3 to NH2OH
haoA Noc_0299 Noc_0751 Noc_3050 Noc_3047 Noc_1767 Noc_1263 Noc_2697 nirK norC cytS
Oxidation of NH2OH to NO2 Electron flow to periplasmic cyt c Electron shuttle between CIII and CIV Electron shuttle between CIII and CIV Cyt c oxidation and electron flow to O2 as the terminal e acceptor Cyt c oxidation and electron flow to peroxide as the terminal e acceptor Accept e and reduce of NO2 to NO Accept e for reduction of NO to N2O Accept e for reduction of NO to N2O
363
mRNA Expression in N-Cycle Metabolism
for cDNA synthesis. Real-time fluorescent PCR was performed using a Bio-Rad iCycler (Bio-Rad, Hercules, CA, USA), designed primers (designed as described in Section 1.4), Superscript III reverse transcriptase (Invitrogen), and cDNA as the template (prepared as described in Section 1.6) to determine steady-state mRNA levels, which was normalized using the 16S rRNA gene and statistical analysis (REST; see Section 1.5) to calculate the normalized expression ratio. Even though not all of the pertinent electron flow inventory has been included in this example, Fig. 14.3 indicates that N. oceani has a diverse complement of quinol-oxidizing inventory. The results in Figure 14.3 suggest that this inventory is differentially expressed in response to availability of ammonia as well as to exposure to hydroxylamine. Ammonia differentially induces expression of both oxygen-dependent (Noc_1767, Noc_3047), peroxide-dependent (Noc_1263, Noc_2697), and N-oxide-dependent (nirK, norC, cytS) electron sink inventory thereby providing simultaneously for nitrification, aerobic denitrification, and peroxide detox capacity. Hydroxylamine, the useable reductant and thus a direct link to the cell’s redox state, and ammonia, the source of nitrogen for assimilation and energy that requires the activation of oxygen by recycled electrons before it can be 50 45 40
Expression ratio
35 30 25
5 mM (NH4)2SO4
20
0.2 mM NH2OH
15 10 5 0
amoA haoA 0299 (AMO) (HAO) (CIII)
cytS 0751 3050 3047 1767 1263 2697 nirK norC (c552) (c552) (CIV) (CIV) (CCP) (CCP) (NirK) (cNOR) (Cyt c⬘-b)
Figure 14.3 Expression ratios for selected genes in the ETC of N. oceani. Pertinent genes are indicated by their designated name or by locus tag (Noc_xxxx). The triangle and dotted line indicates an expression ratio of 2, determine by REST as described in the text.
364
James E. Graham et al.
dehydrogenated to NH2OH, are causing different transcriptional responses and thus different steady-state transcript levels when supplied after cells were denied any source of energy and reductant for 20 h.
4. Future Directions of the Approach Improvements in DNA sequencing that are now replacing the Sanger dideoxy termination approach are allowing sequencing of genetic elements representing entire microbial genomes in a single day. These “next generation” approaches (Ansorge, 2009) are based on amplifying individual template molecules attached to beads in an emulsion that allows for physical separation, and then trapping beads in an etched chip capable of transmitting light produced by pyrophosphate hydrolysis to a detector by fiber optics (see Chapter 12). While full sequence assembly and annotation remains a formidable obstacle, the approach at a minimum allows identification of relevant inventory and specific alleles potentially encoding contributors to relevant nitrogen metabolism. Pyrosequencing now makes it feasible to compare both different strains and closely related isolates where whole-genome sequencing has previously been prohibitive. Somewhat simpler plasmid cloning approaches known as selective capture of transcribed sequences (SCOTS) and genome fragment enrichment (GFE) developed by one of the authors may also be useful in future studies by identifying target cDNA sequences for RT-qPCR assays (Graham and Clark-Curtiss, 1999; Shanks et al., 2006). Both of these techniques have the advantage of requiring only small number of cells, including those present in larger mixed natural populations, determining either relevant genetic capacity (GFE) or relevant active gene expression (SCOTS). Such directed studies assessing individual microbial or gene family expression have so far for the most part been limited to laboratory monocultures, although the concept and approaches now possible are not. Going from gene expression studies to appreciation of the full complexity of microbial community metabolism remains a formidable challenge, but any overall progress in that direction will likely involve first defining individual potential microbial contributions. Similarly, at least two approaches may hold promise for improving the least reliable and efficient step in RT-qPCR, that of faithfully representing RNA as cDNA. While subtractive hybridization is not new (Straus and Ausubel, 1990), its application to cDNA has always been problematic relative to identifying differences between genomic DNAs (e.g., Plum et al., 1997). Given the typical ratio of rRNA to medium bacterial mRNA abundance of about a million to one, physical removal of rRNA from total RNA by subtractive hybridization of bacterial cDNAs has great potential to “throw the baby out with the bathwater.” Recent quantitative analyses are showing
mRNA Expression in N-Cycle Metabolism
365
that subtraction by hybridizing oligonucleotides as used in available commercial kits is partially successful, but can only make modest improvements in the ratios of rRNAs to mRNA (He et al., 2010). Additional rounds of subtraction did not improve results, an aspect the authors have also seen. Results of ongoing studies in other laboratories will next be needed to determine if the fidelity of mRNA ratios remain intact in the rRNA subtraction process. Secondly, efforts to raise the amount of available starting material for RT-qPCR linear preamplification of RNA could be helpful when culture is limiting or species of interest are not abundant in the environment. Transcribing cDNA copies with phage RNA polymerase has the potential to increase RNA template for RT-qPCR studies. By including phage promoter sequences in the 50 regions of deoxynucleotide primers, known biases in amplifying complex mixture of DNA sequences simultaneously by exponential PCR are potentially avoided, at least theoretically. Of course such approaches will still require an initial relatively inefficient cDNA synthesis, which is a concern because differences in efficiency are well known for RNA polymerase templates. However, improvements in primer design and approaches to linear amplification by RNA synthesis do remain an area with promise in efforts to study microbial gene expression and contributions to nitrogen metabolism. N-cycle research has only recently revealed several major new microbial players and processes, and it is highly likely that our present state of knowledge is still quite far from “knowing it all.” Detailed investigation of the molecular underpinnings of pathways in the organisms that facilitate these new and previously described N-cycle processes suddenly appears as a somewhat less daunting task given recent progress in instrumentation and investigative strategies. Next generation sequencing technology, for example, will also allow high fidelity sequencing of multiple genomes and transcriptomes at the levels of populations and communities (metagenomics, metatranscriptomics; see Chapters 12 and 13). Other approaches in development are aimed at characterization of both cellular and community proteomes (see Wessels et al., 2011, and chapter 18 by Burton and Hickey, pp. 435–463). Nevertheless, investigating responses of individual organisms to particular environments and signals relevant to nitrogen will likely remain a fundamental tool with which we increase our understanding of microbial contributions to the N-cycle.
ACKNOWLEDGMENTS The authors thank Christopher T. Price for his comments on the manuscript. M. G. K. was supported by NSF grant EF-0412129 and incentive funds from the University of Louisville Office of the Executive Vice President for Research (EVPR). J. E. G. received support from NIH NIAID, U.S. CRDF, and the University of Louisville.
366
James E. Graham et al.
REFERENCES Allen, A. E., Booth, M. G., Frischer, M. E., Verity, P. G., Zehr, J. P., and Zani, S. (2001). Diversity and detection of nitrate assimilation genes in marine bacteria. Appl. Environ. Microbiol. 67, 5343–5348. Ansorge, W. J. (2009). Next-generation DNA sequencing techniques. New Biotechnol. 25, 195–203. Arp, D. J., and Bottomley, P. J. (2006). Nitrifiers: More than 100 years from isolation to genome sequences. Microbe 1, 229–234. Arp, D. J., Chain, P. S. G., and Klotz, M. G. (2007). The impact of genome analyses on our understanding of ammonia-oxidizing bacteria. Annu. Rev. Microbiol. 61, 21–58. Avrahami, S., Conrad, R., and Braker, G. (2002). Effect of soil ammonium concentration on N2O release and on the community structure of ammonia oxidizers and denitrifiers. Appl. Environ. Microbiol. 68, 5685–5692. Bartossek, R., Nicol, G. W., Lanzen, A., Klenk, H.-P., and Schleper, C. (2010). Homologues of nitrite reductases in ammonia-oxidizing archaea: Diversity and genomic context. Environ. Microbiol. 12, 1075–1088. Bergman, D. J., Hooper, A. B., and Klotz, M. G. (2005). Structure and sequence conservation of genes in the hao cluster of autotrophic ammonia-oxidizing bacteria: Evidence for their evolutionary history. Appl. Environ. Microbiol. 71, 5371–5382. Bock, E., Koops, H.-P., Harms, H., and Ahlers, B. (1991). The biochemistry of nitrifying organisms. In “Variations in Autotrophic Life,” ( J. M. Shively and L. L. Barton, eds.), pp. 171–200. Academic Press Limited, San Diego, CA. Braker, G., and Tiedje, J. M. (2003). Nitric oxide reductase (norB) genes from pure cultures and environmental samples. Appl. Environ. Microbiol. 69, 3476–3483. Braker, G., Fesefeldt, A., and Witzel, K. P. (1998). Development of PCR primer systems for amplification of nitrite reductase genes (nirK and nirS) to detect denitrifying bacteria in environmental samples. Appl. Environ. Microbiol. 64, 3769–3775. Braker, G., Zhou, J., Wu, L., Devol, A. H., and Tiedje, J. M. (2000). Nitrite reductase genes (nirK and nirS) as functional markers to investigate diversity of denitrifying bacteria in pacific northwest marine sediment communities. Appl. Environ. Microbiol. 66, 2096–2104. Braker, G., Ayala-del-Rio, H. L., Devol, A. H., Fesefeldt, A., and Tiedje, J. M. (2001). Community structure of denitrifiers, bacteria, and archaea along redox gradients in Pacific Northwest marine sediments by terminal restriction fragment length polymorphism analysis of amplified nitrite reductase (nirS) and 16S rRNA genes. Appl. Environ. Microbiol. 67, 1893–1901. Brandes, J. A., Devol, A. H., and Deutsch, C. (2007). New developments in the marine nitrogen cycle. Chem. Rev. 107, 577–589. Bustin, S. A., and Nolan, T. (2004). Basic RT-PCR considerations. In “A-Z of Quanitative PCR,” (S. A. Bustin, ed.), Vol. 1, pp. 359–395. International University Line, La Jolla, CA. Bustin, S. A., Benes, V., Garson, J. A., Hellemans, J., Hugger, J., Kubista, M., Mueller, R., Nolan, T., Pfaffl, M. W., Shipley, G. L., Vandesompele, J., and Wittwer, C. T. (2009). The MIQE guidelines: Minimum information for publication of quantitative real-time PCR experiments. Clin. Chem. 55, 611–622. Butler, C. S., and Richardson, D. J. (2005). The emerging molecular structure of the nitrogen cycle: An introduction to the proceedings of the 10th annual N-cycle meeting. Biochem. Soc. Trans. 33, 113–118. Campbell, B. J., Smith, J. L., Hanson, T. E., Klotz, M. G., Stein, L. Y., Lee, C. K., Wu, D., Robinson, J. M., Khouri, H. M., Eisen, J. A., and Cary, S. C. (2009). Adaptations to
mRNA Expression in N-Cycle Metabolism
367
submarine hydrothermal environments exemplified by the genome of Nautilia profundicola. PLoS Genet. 5, e1000362. Cathala, G., Savouret, J. F., Mendez, B., West, B. L., Karin, M., Martial, J. A., and Baxter, J. D. (1983). A method for isolation of intact, translationally active ribonucleic acid. DNA (Mary Ann Liebert, Inc.) 2, 329–335. Chirgwin, J. M., Przybyh, A. E., MacDonald, R. J., and Rutter, W. J. (1979). Isolation of biologically active ribonucleic acid from sources enriched in ribonuclease. Biochemistry 18, 5294–5299. Chomczynski, P., and Sacchi, N. (1987). Single-step method of RNA isolation by acid guanidinium thiocyanate-phenol-chloroform extraction. Anal. Biochem. 162, 156–159. Dalsgaard, T., Thamdrup, B., and Canfield, D. E. (2005). Anaerobic ammonium oxidation (anammox) in the marine environment. Res. Microbiol. 156, 457–464. de la Torre, J. R., Walker, C. B., Ingalls, A. E., Ko¨nneke, M., and Stahl, D. A. (2008). Cultivation of a thermophilic ammonia oxidizing archaeon synthesizing crenarchaeol. Environ. Microbiol. 10, 810–818. Dennis, P. P., Ehrenberg, M., Fange, D., and Bremer, H. (2009). Varying rate of RNA chain elongation during rrn transcription in Escherichia coli. J. Bacteriol. 191, 3740–3746. Diercks, A., Kostner, H., and Ozinsky, A. (2009). Resolving cell population heterogeneity: Real-time PCR for simultaneous multiplexed gene detection in multiple single-cell samples. PLoS ONE 4, e6326. Duce, R. A., LaRoche, J., Altieri, K., Arrigo, K. R., Baker, A. R., Capone, D. G., Cornell, S., Dentener, F., Galloway, J., Ganeshram, R. S., Geider, R. J., Jickells, T., et al. (2008). Impacts of atmospheric anthropogenic nitrogen on the open ocean. Science 320, 893–897. Emory, S. A., and Belasco, J. G. (1990). The ompA 5’ untranslated RNA segment functions in Escherichia coli as a growth-rate-regulated mRNA stabilizer whose activity is unrelated to translational efficiency. J. Bacteriol. 172, 4472–4481. Ettwig, K. F., Shima, S., van de Pas-Schoonen, K. T., Kahnt, J. R., Medema, M. H., Op den Camp, H. J. M., Jetten, M. S. M., and Strous, M. (2008). Denitrifying bacteria anaerobically oxidize methane in the absence of Archaea. Environ. Microbiol. 10, 3164–3173. Ettwig, K. F., van Alen, T., van de Pas-Schoonen, K. T., Jetten, M. S. M., and Strous, M. (2009). Enrichment and molecular detection of denitrifying methanotrophic bacteria of the NC10 phylum. Appl. Environ. Microbiol. 75, 3656–3662. Ettwig, K. F., Butler, M. K., Le Paslier, D., Pelletier, E., Mangenot, S., Kuypers, M. M. M., Schreiber, F., Dutilh, B. E., Zedelius, J., de Beer, D., Gloerich, J., Wessels, H. J. C. T., et al. (2010). Nitrite-driven anaerobic methane oxidation by oxygenic bacteria. Nature 464, 543–548. Falk, S., Liu, B., and Braker, G. (2010). Isolation, genetic and functional characterization of novel soil nirK-type denitrifiers. Syst. Appl. Microbiol. 33, 337–347. Ferguson, S. J., and Richardson, D. J. (2005). The enzymes and bioenergetics of bacterial nitrate, nitrite, nitric oxide and nitrous oxide respiration. In “Respiration in Archaea and Bacteria: Diversity of Procaryotic Respiratory Systems,” (D. Zannoni, ed.), Vol. 2, pp. 169–206. Springer, Dordrecht, The Netherlands. Francis, C. A., Beman, J. M., and Kuypers, M. M. M. (2007). New processes and players in the nitrogen cycle: The microbial ecology of anaerobic and archaeal ammonia oxidation. ISME J. 1, 19–27. Galloway, J. N., Townsend, A. R., Erisman, J. W., Bekunda, M., Cai, Z., Freney, J. R., Martinelli, L. A., Seitzinger, S. P., and Sutton, M. A. (2008). Transformation of the nitrogen cycle: Recent trends, questions, and potential solutions. Science 320, 889–892. Glansdorff, N., Xu, Y., and Labedan, B. (2008). The Last Universal Common Ancestor: Emergence, constitution and genetic legacy of an elusive forerunner. Biol. Direct 3, 29.
368
James E. Graham et al.
Graham, J. E., and Clark-Curtiss, J. E. (1999). Identification of Mycobacterium tuberculosis RNAs synthesized in response to phagocytosis by human macrophages by selective capture of transcribed sequences (SCOTS). Proc. Natl. Acad. Sci. USA 96, 11554–11559. Gruber, N., and Galloway, J. N. (2008). An Earth-system perspective of the global nitrogen cycle. Nature 451, 293–296. Gualerzi, C. O., Giuliodori, A. M., and Pon, C. L. (2003). Transcriptional and posttranscriptional control of cold-shock genes. J. Mol. Biol. 331, 527–539. Hallam, S. J., Mincer, T. J., Schleper, C., Preston, C. M., Roberts, K., Richardson, P. M., and DeLong, E. F. (2006). Pathways of carbon assimilation and ammonia oxidation suggested by environmental genomic analyses of marine Crenarchaeota. PLoS Biol. 4, e95. Hamilton, S., Bongaerts, R. J., Mulholland, F., Cochrane, B., Porter, J., Lucchini, S., Lappin-Scott, H. M., and Hinton, J. C. (2009). The transcriptional programme of Salmonella enterica serovar Typhimurium reveals a key role for tryptophan metabolism in biofilms. BMC Genomics 10, 599. Hatzenpichler, R., Lebedeva, E. V., Spieck, E., Stoecker, K., Richter, A., Daims, H., and Wagner, M. (2008). A moderately thermophilic ammonia-oxidizing crenarchaeote from a hot spring. Proc. Natl. Acad. Sci. USA 105, 2134–2139. He, S., Wurtzel, O., Singh, K., Froula, J. L., Yilmaz, S., Tringe, S. G., Wang, Z., Chen, F., Lindquist, E. A., Sorek, R., and Hugenholtz, P. (2010). Validation of two ribosomal RNA removal methods for microbial metatranscriptomics. Nat. Methods 7, 807–812. Higuchi, R., Fockler, C., Dollinger, G., and Watson, R. (1993). Kinetic PCR analysis: Real-time monitoring of DNA amplification reactions. Biotechnology (Nature Publishing Company) 11, 1026–1030. Hyman, M. R., and Arp, D. J. (1992). 14C2H2- and 14CO2-labeling studies of the de novo synthesis of polypeptides by Nitrosomonas europaea during recovery from acetylene and light inactivation of ammonia monooxygenase. J. Biol. Chem. 267, 1534–1545. Hyman, M. R., and Arp, D. J. (1995). Effects of ammonia on the de novo synthesis of polypeptides in cells of Nitrosomonas europaea denied ammonia as an energy source. J. Bacteriol. 177, 4974–4979. Jepson, B. J. N., Marietou, A., Mohan, S., Cole, J. A., Butler, C. S., and Richardson, D. J. (2006). Evolution of the soluble nitrate reductase: Defining the monomeric periplasmic nitrate reductase subgroup. Biochem. Soc. Trans. 34, 122–126. Jetten, M. S., Cirpus, I., Kartal, B., van Niftrik, L., van de Pas-Schoonen, K. T., Sliekers, O., Haaijer, S., van der Star, W., Schmid, M., van de Vossenberg, J., Schmidt, I., Harhangi, H., et al. (2005). 1994-2004: 10 years of research on the anaerobic oxidation of ammonium. Biochem. Soc. Trans. 33, 119–133. Jetten, M. S. M., Niftrik, L. V., Strous, M., Kartal, B., Keltjens, J. T., and Op den Camp, H. J. M. (2009). Biochemistry and molecular biology of anammox bacteria. Crit. Rev. Biochem. Mol. Biol. 44, 65–84. Kartal, B., Kuypers, M. M. M., Lavik, G., Schalk, J., Op den Camp, H. J. M., Jetten, M. S. M., and Strous, M. (2007). Anammox bacteria disguised as denitrifiers: Nitrate reduction to dinitrogen gas via nitrite and ammonium. Environ. Microbiol. 9, 635–642. Kim, H. J., Zatsman, A., Upadhyay, A. K., Whittaker, M., Bergmann, D., Hendrich, M. P., and Hooper, A. B. (2008). Membrane tetraheme cytochrome cM552 of the ammoniaoxidizing Nitrosomonas europaea: A ubiquinone reductase. Biochemistry 47, 6539–6551. Klotz, M. G., and Stein, L. Y. (2008). Nitrifier genomics and evolution of the N-cycle. FEMS Microbiol. Lett. 278, 146–156. Klotz, M. G., and Stein, L. Y. (2010). Genomics of ammonia-oxidizing bacteria and insights to their evolution. In “Nitrification,” (B. B. Ward, D. J. Arp, and M. G. Klotz, eds.), pp. 57–93. ASM Press, Washington, DC.
mRNA Expression in N-Cycle Metabolism
369
Klotz, M. G., Arp, D. J., Chain, P. S. G., El-Sheikh, A. F., Hauser, L. J., Hommes, N. G., Larimer, F. W., Malfatti, S. A., Norton, J. M., Poret-Peterson, A. T., Vergez, L. M., and Ward, B. B. (2006). Complete genome sequence of the marine, chemolithoautotrophic, ammonia-oxidizing bacterium Nitrosococcus oceani ATCC 19707. Appl. Environ. Microbiol. 72, 6299–6315. Klotz, M. G., Schmid, M. C., Strous, M., Op den Camp, H. J. M., Jetten, M. S. M., and Hooper, A. B. (2008). Evolution of an octaheme cytochrome c protein family that is key to aerobic and anaerobic ammonia oxidation by bacteria. Environ. Microbiol. 10, 3150–3163. Ko¨nneke, M., Bernhard, A. E., de la Torre, J. R., Walker, C. B., Waterbury, J. B., and Stahl, D. A. (2005). Isolation of an autotrophic ammonia-oxidizing marine archaeon. Nature 437, 543–546. Kuenen, J. G. (2008). Anammox bacteria: From discovery to application. Nat. Rev. 6, 320–326. Lane, N., Allen, J. F., and Martin, W. (2010). How did LUCA make a living? Chemiosmosis in the origin of life. Bioessays 32, 271–280. Leininger, S., Urich, T., Schloter, M., Schwark, L., Qi, J., Nicol, G. W., Prosser, J. I., Schuster, S. C., and Schleper, C. (2006). Archaea predominate among ammonia-oxidizing prokaryotes in soils. Nature 442, 806. Lin, J. T., and Stewart, V. (1998). Nitrate assimilation in bacteria. In “Advances in Microbial Physiology,” (R. K. Poole, ed.), Vol. 39, pp. 1–30. Academic Press, Oxford. Liu, Z. L., Palmquist, D. E., Ma, M., Liu, J., and Alexander, N. J. (2009). Application of a master equation for quantitative mRNA analysis using qRT-PCR. J. Biotechnol. 143, 10–16. Lu, P., Vogel, C., Wang, R., Yao, X., and Marcotte, E. M. (2007). Absolute protein expression profiling estimates the relative contributions of transcriptional and translational regulation. Nat. Biotechnol. 25, 117–124. Luo, X. Z., and Stevens, S. E., Jr. (1997). Isolation of full-length RNA from a thermophilic cyanobacterium. BioTechniques 23, 904–906, 908, 910. Malm, S., Tiffert, Y., Micklinghoff, J., Schultze, S., Joost, I., Weber, I., Horst, S., Ackermann, B., Schmidt, M., Wohlleben, W., Ehlers, S., Geffers, R., et al. (2009). The roles of the nitrate reductase NarGHJI, the nitrite reductase NirBD and the response regulator GlnR in nitrate assimilation of Mycobacterium tuberculosis. Microbiology 155, 1332–1339. Martens-Habbena, W., Berube, P. M., Urakawa, H., de la Torre, J. R., and Stahl, D. A. (2009). Ammonia oxidation kinetics determine niche separation of nitrifying Archaea and Bacteria. Nature 461, 976–979. Martin, W., Baross, J., Kelley, D., and Russell, M. J. (2008). Hydrothermal vents and the origin of life. Nat. Rev. Microbiol. 6, 805–814. Martiny, A. C., Kathuria, S., and Berube, P. M. (2009). Widespread metabolic potential for nitrite and nitrate assimilation among Prochlorococcus ecotypes. Proc. Natl. Acad. Sci. USA 106, 10787–10792. Moreno-Vivian, C., Cabello, P., Martinez-Luque, M., Blasco, R., and Castillo, F. (1999). Prokaryotic nitrate reduction: Molecular properties and functional distinction among bacteria nitrate reductases. J. Bacteriol. 181, 6573–6584. Nicol, G. W., and Schleper, C. (2006). Ammonia-oxidising crenarchaeota: Important players in the nitrogen cycle? Trends Microbiol. 14, 207. Nitschke, W., and Russell, M. (2009). Hydrothermal focusing of chemical and chemiosmotic energy, supported by delivery of catalytic Fe, Ni, Mo/W, Co, S and Se, forced life to emerge. J. Mol. Evol. 69, 481–496. Nolan, T., Hands, R. E., and Bustin, S. A. (2006). Quantification of mRNA using real-time RT-PCR. Nat. Protoc. 1, 1559–1582.
370
James E. Graham et al.
Nyerges, G. R., and Stein, L. Y. (2009). Ammonia co-metabolism and product inhibition vary considerably among species of methanotrophic bacteria. FEMS Microbiol. Lett. 297, 131–136. Oakley, B. B., Francis, C. A., Roberts, K. J., Fuchsman, C. A., Srinivasan, S., and Staley, J. T. (2007). Analysis of nitrite reductase (nirK and nirS) genes and cultivation reveal depauperate community of denitrifying bacteria in the Black Sea suboxic zone. Environ. Microbiol. 9, 118–130. Palmer, S., Wiegand, A. P., Maldarelli, F., Bazmi, H., Mican, J. M., Polis, M., Dewar, R. L., Planta, A., Liu, S., Metcalf, J. A., Mellon, J. W., and Coffin, J. M. (2003). New real-time reverse transcriptase-initiated PCR assay with single-copy sensitivity for human immunodeficiency virus type 1 RNA in plasma. J. Clin. Microbiol. 41, 4531–4536. Passalacqua, K. D., Varadarajan, A., Ondov, B. D., Okou, D. T., Zwick, M. E., and Bergman, N. H. (2009). Structure and complexity of a bacterial transcriptome. J. Bacteriol. 191, 3203–3211. Pfaffl, M. W., Horgan, G. W., and Dempfle, L. (2002). Relative expression software tool (REST) for group-wise comparison and statistical analysis of relative expression results in real-time PCR. Nucleic Acids Res. 30, e36. Pfaffl, M. W., Tichopad, A., Prgomet, C., and Neuvians, T. P. (2004). Determination of stable housekeeping genes, differentially regulated target genes and sample integrity: BestKeeper–Excel-based tool using pair-wise correlations. Biotechnol. Lett. 26, 509–515. Pittman, M. S., Elvers, K. T., Michael, L. L., Jones, A., Poole, R. K., Park, S. F., and Kelly, D. J. (2007). Growth of Campylobacter jejuni on nitrate and nitrite: Electron transport to NapA and NrfA via NrfH and distinct roles for NrfA and the globin Cgb in protection against nitrosative stress. Mol. Microbiol. 63, 575–590. Plum, G., Brenden, M., Clark-Curtiss, J. E., and Pulverer, G. (1997). Cloning, sequencing, and expression of the mig gene of Mycobacterium avium, which codes for a secreted macrophage-induced protein. Infect. Immun. 65, 4548–4557. Poret-Peterson, A. T., Graham, J. E., Gulledge, J., and Klotz, M. G. (2008). Transcription of nitrification genes by the methane-oxidizing bacterium, Methylococcus capsulatus strain Bath. ISME J. 2, 1213–1220. Potter, L., Angove, H., Richardson, D., and Cole, J. (2001). Nitrate reduction in the periplasm of Gram-negative bacteria. In “Advances in Microbial Physiology,” (R. K. Poole, ed.), Vol. 45, pp. 51–86. Academic Press, Oxford. Price, C. T., Bukka, A., Cynamon, M., and Graham, J. E. (2008). Glycine betaine uptake by the ProXVWZ ABC transporter contributes to the ability of Mycobacterium tuberculosis to initiate growth in human macrophages. J. Bacteriol. 190, 3955–3961. Prieme, A., Braker, G., and Tiedje, J. M. (2002). Diversity of nitrite reductase (nirK and nirS) gene fragments in forested upland and wetland soils. Appl. Environ. Microbiol. 68, 1893–1900. Proshkin, S., Rahmouni, A. R., Mironov, A., and Nudler, E. (2010). Cooperation between translating ribosomes and RNA polymerase in transcription elongation. Science (New York, NY) 328, 504–508. Prosser, J. I. (1989). Autotrophic nitrification in bacteria. Adv. Microb. Physiol. 30, 125–181. Prosser, J. I., and Nicol, G. W. (2008). Relative contributions of archaea and bacteria to aerobic ammonia oxidation in the environment. Environ. Microbiol. 10, 2931–2941. Rockstro¨m, J., Steffen, W., Noone, K., Persson, A., Chapin, F. S., Lambin, E. F., Lenton, T. M., Scheffer, M., Folke, C., Schellnhuber, H. J., Nykvist, B., de Wit, C. A., et al. (2009). A safe operating space for humanity. Nature 461, 472–475. Santoro, A. E., Boehm, A. B., and Francis, C. A. (2006). Denitrifier community composition along a nitrate and salinity gradient in a coastal aquifer. Appl. Environ. Microbiol. 72, 2102–2109.
mRNA Expression in N-Cycle Metabolism
371
Schleper, C., and Nicol, G. W. (2010). Ammonia oxidizing archaea—Genomes, physiology and ecology. In “Advances in Microbial Physiology,” (R. K. Poole, ed.), Vol. 57, pp. 1–41. Academic Press, Oxford. Schmidt, I., Sliekers, O., Schmid, M., Bock, E., Fuerst, J., Kuenen, J. G., Jetten, M. S. M., and Strous, M. (2003). New concepts of microbial treatment processes for the nitrogen removal in wastewater. FEMS Microbiol. Rev. 27, 481–492. Shanks, O. C., Santo Domingo, J. W., and Graham, J. E. (2006). Use of competitive DNA hybridization to identify differences in the genomes of bacteria. J. Microbiol. Methods 66, 321–330. Sieber, M. W., Recknagel, P., Glaser, F., Witte, O. W., Bauer, M., Claus, R. A., and Frahm, C. (2010). Substantial performance discrepancies among commercially available kits for reverse transcription quantitative polymerase chain reaction: A systematic comparative investigator-driven approach. Anal. Biochem. 401, 303–311. Simon, J. (2002). Enzymology and bioenergetics of respiratory nitrite ammonification. FEMS Microbiol. Rev. 26, 285–309. Simon, J., Einsle, O., Kroneck, P. M. H., and Zumft, W. G. (2004). The unprecedented nos gene cluster of Wolinella succinogenes encodes a novel respiratory electron transfer pathway to cytochrome c nitrous oxide reductase. FEBS Lett. 569, 7. Smith, R. D., Brown, B., Ikonomi, P., and Schechter, A. N. (2003). Exogenous reference RNA for normalization of real-time quantitative PCR. Biotechniques 34, 88–91. Smith, C. J., Nedwell, D. B., Dong, L. F., and Osboni, A. M. (2007). Diversity and abundance of nitrate reductase genes (narG and napA), nitrite reductase genes (nirS and nrfA), and their transcripts in estuarine sediments. Appl. Environ. Microbiol. 73, 3612–3622. Stahlberg, A., Hakansson, J., Xian, X., Semb, H., and Kubista, M. (2004). Properties of the reverse transcription reaction in mRNA quantification. Clin. Chem. 50, 509–515. Stangegaard, M., Dufva, I. H., and Dufva, M. (2006). Reverse transcription using random pentadecamer primers increases yield and quality of resulting cDNA. BioTechniques 40, 649–657. Straus, D., and Ausubel, F. M. (1990). Genomic subtraction for cloning DNA corresponding to deletion mutations. Proc. Natl. Acad. Sci. USA 87, 1889–1893. Strous, M., Kramer, E. H. M., Logemann, S., Muyzer, G., van De Pas-Schoonen, K. T., Webb, R. E., Kuenen, J. G., and Jetten, M. S. M. (1999). Missing lithotroph identified as new planctomycete. Nature 400, 446–449. Strous, M., Pelletier, E., Mangenot, S., Rattei, T., Lehner, A., Taylor, M. W., Horn, M., Daims, H., Bartol-Mavel, D., Wincker, P., Barbe, V.Aˆ.R., Fonknechten, N., et al. (2006). Deciphering the evolution and metabolism of an anammox bacterium from a community genome. Nature 440, 790–794. Sutka, R. L., Ostrom, N. E., Ostrom, P. H., Gandhi, H., and Breznak, J. A. (2003). Nitrogen isotopomer site preference of N2O produced by Nitrosomonas europaea and Methylococcus capsulatus Bath. Rapid Commun. Mass Spectrom. 17, 738–745. Sutka, R. L., Ostrom, N. E., Ostrom, P. H., Breznak, J. A., Gandhi, H., Pitt, A. J., and Li, F. (2006). Distinguishing nitrous oxide production from nitrification and denitrification on the basis of isotopomer abundances. Appl. Environ. Microbiol. 72, 638–644. Taniguchi, Y., Choi, P. J., Li, G. W., Chen, H., Babu, M., Hearn, J., Emili, A., and Xie, X. S. (2010). Quantifying E. coli proteome and transcriptome with single-molecule sensitivity in single cells. Science (New York, NY) 329, 533–538. Tavares, P., Pereira, A. S., Moura, J. J. G., and Moura, I. (2006). Metalloenzymes of the denitrification pathway. J. Inorg. Biochem. 100, 2087–2100. Vandesompele, J., De Preter, K., Pattyn, F., Poppe, B., Van Roy, N., De Paepe, A., and Speleman, F. (2002). Accurate normalization of real-time quantitative RT-PCR data by geometric averaging of multiple internal control genes. Genome Biol. 3, Research0034-1 - 12.
372
James E. Graham et al.
Walker, C. B., de la Torre, J. R., Urakawa, H., Klotz, M. G., Manning, G., Pinel, N., Arp, D. J., Brochier-Armanet, C., Bruce, D. A., Chain, P. S. G., Chan, P., GolabgirAnbarani, A., et al. (2010). The genome of Nitrosopumilus maritimus reveals a close functional relationship to the globally distributed marine Crenarchaeota. Proc. Natl. Acad. Sci. USA 107, 8818–8823. Wessels, H. J. C. T., Gloerich, J., der Biezen, E. v., Jetten, M. S. M., and Kartal, B. (2011). Liquid chromatography–mass spectrometry-based proteomics of Nitrosomonas. In “Research on Nitrification and Related Processes, Part A,” (M.G. Klotz, ed.), Methods in Enzymology, Vol. 486, pp. 465–482. Academic Press (Elsevier Inc.), Oxford. ISBN: 978-0-12-381294-0. Williams, D. L., Oby-Robinson, S., Pittman, T. L., and Scollard, D. M. (2003). Purification of Mycobacterium leprae RNA for gene expression analysis from leprosy biopsy specimens. BioTechniques 35, 534–536. Winogradsky, S. (1892). Contributions a la morphologie des organismes de la nitrification. Arch. Sci. Biol. 1, 88–137. Wrage, N., Velthof, G. L., van Beusichem, M. L., and Oenema, O. (2001). Role of nitrifier denitrification in the production of nitrous oxide. Soil Biol. Biochem. 36, 229–236. Wrage, N., Velthof, G. L., Oenema, O., and Laanbroek, H. J. (2004). Acetylene and oxygen as inhibitors of nitrous oxide production in Nitrosomonas europaea and Nitrosospira briensis: A cautionary tale. FEMS Microbiol. Ecol. 47, 13–18. Wurtzel, O., Sapra, R., Chen, F., Zhu, Y., Simmons, B. A., and Sorek, R. (2010). A singlebase resolution map of an archaeal transcriptome. Genome Res. 20, 133–141. Xia, Q., Hendrickson, E. L., Zhang, Y., Wang, T., Taub, F., Moore, B. C., Porat, I., Whitman, W. B., Hackett, M., and Leigh, J. A. (2006). Quantitative proteomics of the archaeon Methanococcus maripaludis validated by microarray analysis and real time PCR. Mol. Cell. Proteomics 5, 868–881. Zumft, W. G. (1997). Cell biology and molecular basis of denitrification. Microbiol. Mol. Biol. Rev. 61, 522–616. Zumft, W. G., and Kroneck, P. M. H. (2006). Respiratory transformation of nitrous oxide (N2O) to dinitrogen by bacteria and archaea. In “Advances in Microbial Physiology,” (R. K. Poole, ed.), Vol. 52, pp. 107–227. Academic Press, Oxford, UK.
C H A P T E R
F I F T E E N
The Utility of Functional Gene Arrays for Assessing Community Composition, Relative Abundance, and Distribution of AmmoniaOxidizing Bacteria and Archaea B. B. Ward1 and N. J. Bouskill Contents 374 375 375 379 380 381 384 389
1. 2. 3. 4. 5. 6. 7. 8. 9.
Introduction DNA Microarrays: Introduction to Microarrays Probe Selection Target Preparation Array Printing, Hybridization, and Scanning Factors That Influence Hybridization Results Array Applications Possibilities and Limitations Detailed Protocol for Functional Gene Microarrays Using Oligonucleotide Probes References
390 394
Abstract Ammonia-oxidizing bacteria (AOB) and archaea (AOA) transform ammonium to nitrite, an essential step in the complete mineralization of organic matter, leading to the accumulation of nitrate in oxic environments. The diversity and community composition of both groups have been extensively explored by sequence analysis of both 16S rRNA and amoA (encoding the critical enzyme, ammonia monooxygenase subunit A) genes. In this chapter, the power of the amoA gene as a phylogenetic marker for both AOB and AOA is extended to the development and application of DNA microarrays. Functional gene microarrays provide high throughput, relatively high resolution data on community
Department of Geosciences, Princeton University, Princeton, New Jersey, USA Earth Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California, USA
1
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00015-4
#
2011 Elsevier Inc. All rights reserved.
373
374
B. B. Ward and N. J. Bouskill
composition and relative abundance, which is especially useful for comparisons among environments, and between samples in time and space, targeting the microbial group that is responsible for a biogeochemical transformation of interest, such as nitrification. In this chapter, the basic approaches to the design of probes to represent the target groups AOB and AOA are described, and the protocols for preparing hybridization targets from environmental samples are provided. Factors that influence the hybridization results and determine the sensitivity and specificity of the assays are discussed. A few examples of recent applications of amoA microarrays to explore temporal and spatial patterns in AOB and AOA community composition in estuaries and the ocean are presented. Array data are lower resolution than sequencing, but much higher throughput, thus allowing robust statistics and reproducibility that are not possible with large clone libraries. For specific functional groups, arrays provide more direct information in a more economical format than is possible with next generation sequencing.
1. Introduction Both ammonia-oxidizing bacteria (AOB) and the more recently discovered ammonia-oxidizing archaea (AOA) perform the critical step of oxidation of ammonia to nitrite in the nitrogen cycle of aquatic and terrestrial environments. Although many AOB are available in culture, and much has been learned from their genomes, extensive sequencing of both 16S rRNA and ammonia monooxygenase subunit a (amoA) genes from environmental samples demonstrates that the most abundant AOB in the environment are not represented in the culture collection. Similarly, many more operational taxonomic units (OTUs) corresponding to sequences of amoA genes from AOA are known than are represented in the very limited culture collection of AOA. Therefore, molecular methods are crucial for investigations of the distribution and ecology of ammoniaoxidizing microorganisms. The very existence of AOA was first discovered on the basis of amoA gene sequence information (Treusch et al., 2005; Venter et al., 2004) and initial clone library studies confirmed that AOA are widespread in the environment (Francis et al., 2005). Clone libraries targeting the functional genes of nitrifying bacteria continue to be the most common tool for these investigations. In this chapter, we describe a methodology building on sequence information obtained from clone libraries that provides a high-throughput approach for investigating the distribution and community composition of AOB and AOA assemblages without additional sequencing.
Functional Gene Microarrays for AOB and AOA
375
2. DNA Microarrays: Introduction to Microarrays Functional gene microarrays provide a method for rapid, high resolution, high-throughput analysis of microbial community composition. They are applicable to DNA or RNA samples from any environment and for any target organism or gene for which a suitable sequence database exists or can be obtained. Hybridization data provide relative quantification of abundance and distribution of different archetypes or OTUs, such that robust comparisons can be made between samples, even though absolute quantification (i.e., number of organisms possessing each gene type) is not yet possible. Here we describe the development and application of DNA microarrays for the study of AOB and AOA. The rationale for focusing on these organisms is their essential role in the nitrogen cycle of aquatic and terrestrial environments, including wastewater treatment and agricultural systems. AOB and AOA are both relatively constrained taxonomically, as far as is presently known, so these groups can be comprehensively targeted and studied using the functional gene approach. A microarrays is a small solid support, usually a glass slide, plastic, or silicon thin film, on which a large number of discrete samples of biological materials (e.g., DNA) are fixed in an orderly arrangement. Those described here are based on glass microscope slide substrates. The slides are commercially coated (e.g., Corning, Agilent) with materials that allow DNA to be precisely bound to the substrate, but do not produce innate fluorescence or allow nonspecific binding of DNA, RNA, or other biological materials. The probes (DNA fragments representing the genes to be detected, see below) are printed robotically (DeRisi et al., 1997) and bound to the slide in a precise pattern. The targets (complementary DNA derived from DNA or RNA from the unknown sample, see below) are prepared by coupling a fluorescent tag to the sample DNA. The fluorescent target is then hybridized to the array, and the target molecules bind to the specific probes with complementary sequences. The amount of fluorescence associated with each probe is then quantified by laser scanning. The overall process is represented in the flow chart in Fig. 15.1 for reference throughout the steps described in the following sections.
3. Probe Selection Both AOB and AOA arrays use the amoA (ammonia monooxygenase subunit A) gene as the basis of detection of the two microbial groups. At present, the public databases contain thousands of sequences for both AOA
376
B. B. Ward and N. J. Bouskill
Align potential probe sequences
ATCGGTTAACTCGGGG......... ATCGCTTAACTTGGGG.......... TTCGCTTAACTCGGGG.......... TTCGCTTAACTTGGGG..........
Collect sample, extract DNA/RNA ATCGGTTAACTCGGGG.......... ATCGCTTAACTTGGGG.......... TTCGCTTAACTCGGGG.......... TTCGCTTAACTTGGGG..........
Make cDNA
Design/select probes, verify with in silico and experimental methods
Synthesize specific oligos, with 20-mer internal standard
Digest genomic DNA
Print probes onto array Amplify DNA/cDNA linearly using Klenow polymerase, incorporate dUaa 13463577
+
+ Scan and analyze Conjugate Cy3 to dUaa labeled fragment
Hybridize target and 20-mer standard to array
Figure 15.1 Flow chart of main steps in target and probe preparation and array analysis. The steps in the protocol for target preparation and hybridization are described more fully in the following detailed protocol.
and AOB amoA genes. Depending on the hybridization conditions and array format, the amount of sequence diversity between probe and target that allows hybridization can vary, and is not always predictable from
Functional Gene Microarrays for AOB and AOA
377
sequence or thermodynamic data alone (Pozhitkov et al., 2006). Perfect match (PM) (i.e., 100% sequence identity between probe and target sequence) probe–target pairs usually hybridize well, and the stringency of hybridization conditions constrains the binding of mismatch (MM) targets. The degree of mismatch that still allows binding depends on the length of the probe and target fragments, the GC content and melting temperature, the location of mismatch basepairs (the stretch of matching or mismatched regions), and in some cases, the secondary structure (e.g., presence of hairpin structures). The empirical testing of probe design criteria and the behavior of target–probe interactions is well described by He et al. (2005). For oligonucleotide probes, the intensity of hybridization signal varies with the degree of probe–target sequence identity (He et al., 2005; Taroncher-Oldenburg et al., 2003). That is, under normal hybridization conditions with targets prepared from complex environmental samples, most probes are not 100% specific. A small amount of PM target can yield as strong a signal as a much larger amount of MM target. Thus, the challenge is to devise a probe set with appropriate specificity to distinguish between ecologically relevant sequence types. In most applications, 50 and 70 bp oligonucleotide probes bind well with targets within 85% sequence identity (He et al., 2005; Taroncher-Oldenburg et al., 2003). Thus for the AOA and AOB arrays, we have designated the probes as archetype probes, implying that the signal represents the relative abundance of an archetype, or group of sequences with 85–87% identity. This level of resolution is appropriate for AOB, for which the culture collection can inform the question of ecologically relevant distinctions. For cultivated AOB, 16S rRNA sequence divergence of 2–8% defines the genus level (Koops et al., 2003). amoA sequence varies by less than 80% within species, and by much more between species in the same genus (Purkhold et al., 2000). Using 85% as the cutoff (15% divergence), we have developed an algorithm (Bulow et al., 2008) that identifies an optimal probe set from the set of all homologous sequences. The optimal probe set contains the minimal number of probes required to allow all known sequences to hybridize with at least one (and preferably only one) of the probes. The algorithm performs essentially the same function as OTU definition according to DOTUR (Schloss and Handlesman, 2005) and other groups have developed similar criteria for probe selection (He et al., 2005, 2007). The archetype probe suite that should allow detection of all known AOB amoA sequences contains about 30 probes (Bouskill et al., 2010), and a similar number suffices to cover the entire known sequence database for AOA amoA sequences. The oligonucleotide probes are synthesized commercially. Even with robotic printing and high quality substrates, the intensity of hybridization can vary across the surface of a single array. Therefore, some
378
B. B. Ward and N. J. Bouskill
form of internal standardization is desirable. The standard approach for expression arrays in disease diagnostics is to employ a two-color competitive hybridization method. Two competing targets are prepared with different fluorescent tags (e.g., red and green), typically one representing the “control” condition and one prepared from “treatment” conditions. The two targets are then competitively hybridized to the same array, and the relative abundance for each target is determined from the fluorescence ratio (FR) between the two colors. The most commonly used fluorescent markers are Cy3 and Cy5, which are reactive water-soluble fluorescent dyes of the cyanine dye family: Cy3 (green: 550 nm excitation, 570 nm emission) and Cy5 (red: 650 nm excitation, 670 nm emission). In environmental samples, it is not obvious how to find or construct a “control” or “normal” sample. In theory, one could produce a mixture of every known sequence represented on the array and use that as the control. We have decided that this approach is not useful because the array hybridizes to all sequences within the 15% limit, not just the PM targets, and it is impossible to manufacture targets of every possible sequence variant for every probe. This has led some investigators to forego the two-color ratio approach altogether and to rely on single color, scaling the fluorescence intensity of each feature to that of a PM control (e.g., Bodrossy and Sessitsch, 2004). If hybridization is not perfectly even across the array, then the single color method may be prone to experimental artifacts, because it would be difficult to include sufficient PM probes to allow calibration of every feature. We have devised an alternative approach that includes controls and an internal standard two-color method to allow standardization at multiple levels. Firstly, the probe oligonucleotide (70 bp) is synthesized as a 90-mer with the additional 20 bp representing a nonsense sequence that is identical for every probe. The experimental target is labeled with one fluorescent tag, typically Cy3. In each hybridization experiment, a Cy5-labeled reference oligonucleotide, complementary to the nonsense 20-mer, is included in the hybridization mixture, and this 20mer binds to the complementary part of the 90-mer. Thus, each feature produces a Cy5 signal, regardless of the presence or absence of specific targets. When the specific target binds, each feature then yields a Cy3/Cy5 ratio. Since each probe includes both 70-mer and 20-mer, the ratio represents the ratio of unknown to standard binding and this ratio is not dependent upon the absolute amount of probe or target. Secondly, every block of features on the array includes a probe called “Mixall,” which is a mixture of all probes on the array. Any variation of hybridization quality across the array will be reflected in the intensity of Mixall signal, allowing for normalization of feature signal within each block. In practice, we usually find that data quality is excellent using the internal standard ratio without Mixall normalization, but the Mixalls provide a quality control check.
Functional Gene Microarrays for AOB and AOA
379
4. Target Preparation The crucial step in target preparation is the incorporation of a fluorescent molecule into the DNA or cDNA to be hybridized to the array (see protocol; Fig. 15.1). The cyanine dyes are usually synthesized with Nhydroxysuccinimidyl (NHS) esters on the nitrogen side chains. These reactive groups bind to aliphatic amine groups. Therefore, in order to bind to DNA, the DNA must first be modified to incorporate aminomodified nucleotides, which can then be chemically linked to the esterified dye. The DNA modification is obtained by incorporating a modified nucleotide into the target DNA, and this can be done in the following three ways. (a) PCR targets: Use of specific PCR products as hybridization targets has the advantage of specificity and sensitivity. Because all the DNA in the target preparation comprises the specific gene fragment of interest, small mass of target is sufficient for a strong reaction, and nonspecific hybridization is minimized. Depending on the array format, 50–200 ng of PCR target suffices for a single array hybridization experiment. (i) One-step direct labeling: Incorporate the Cy3-modified nucleotides into the target molecule during the PCR step. Instead of an equimolar mixture of the four dNTPs, some of the dCTP is replaced with Cy3- or Cy5-modified dCTP (in a 1:1 or 2:1 ratio) (Taroncher-Oldenburg et al., 2003). Perform three replicate PCRs and combine the products before hybridization. (ii) Two-step labeling: Instead of an equimolar mixture of the four dNTPs, part of the dTTP is replaced with amino-allyl modified dUTP (dUaa; in a ratio of up to 1:10 dTTP:dUaa). After PCR, the purified fragment is chemically linked to Cy3- or Cy5-NHS ester. (iii) Three-step indirect labeling of PCR products: Perform the PCR as usual with an equimolar mixture of dNTPs. Then perform a nonlinear amplification of the PCR product using random primers and the Klenow polymerase. During the Klenow reaction, replace the equimolar dNTP mixture with the mixture containing dUaa (previous protocol). After the Klenow reaction, the purified product is chemically linked to Cy3- or Cy5-NHS ester. The indirect method involves the most steps but is often preferable because substitution of modified nucleotides often reduces the efficiency and yield of the PCR reaction in the one- and two-step labeling protocols. The Klenow reaction can amplify 25 ng of PCR product into 1000 ng of randomly labeled product and is therefore very useful for preparing targets from difficult PCR products. This 40fold amplification is the level cited in the guidelines for a typical
380
B. B. Ward and N. J. Bouskill
Klenow reaction use in labeling kits. We find that the main variable in determining the yield is the dUaa concentration. Under the conditions prescribed here, a yield even better than 40-fold is often obtained. (b) Whole DNA (WDNA) targets: Although specific and sensitive, PCR targets have all the problems of bias and selectivity of standard PCR. Therefore, it may be preferable to avoid PCR in target preparation. Instead of labeling a PCR product, as in (iii) above, simply perform the Klenow reaction with 25 ng of total DNA or total cDNA extract. Total genomic extracts are usually first digested with a restriction enzyme to allow better access to the DNA during the Klenow reaction. If low sample DNA concentration is a problem, the DNA or cDNA can first be amplified using whole genome amplification (Wu et al., 2006), in which case as little as 1 ng of original DNA or cDNA extract is sufficient. For WDNA targets, it is necessary to use 500–1000 ng or more of target DNA in each hybridization because most of the target preparation is not specific for any of the probes on the array. An advantage of WDNA targets, however, is that many different unrelated genes can be spotted on the same slide and all detected with the same target preparation.
5. Array Printing, Hybridization, and Scanning The probe oligonucleotides are printed onto Corning Ultragaps or Erie Scientific Epoxy Silane slides using a DeRisi style arrayer (DiRisi et al., 1997) and pins from Parallel Synthesis. The printing step can be performed by a local array facility or a number of commercial companies to your specifications. Dried slides are stored in a desiccator until ready to use. Slides are cross-linked at 70 mJ using a Stratagene Stratalinker just prior to hybridization, or baked at 80 C for 2 h prior to storage. If it is necessary to minimize excessive background hybridization, slides can be prehybridized using Blocking Agent. Prepare the hybridization mixture immediately before use. The mixture typically contains the labeled target, a control target (if using the two-color competitive approach) or control oligonucleotide (for the internal standard approach), and a hybridization buffer containing blocking agents. Quickly add the mixture to the slide or coverslip and seal. Incubate with gentle mixing at the desired temperature for 16 h. After hybridization, the slides are washed to remove excess target, dried, and scanned. The scanning procedures are platform specific and cannot be addressed generally here. After scanning, the arrays are analyzed using commercial software to quantify fluorescence of each dye in each feature.
Functional Gene Microarrays for AOB and AOA
381
The fluorescence data are subjected to various filters to identify significant signals using the following steps: (1) Calculate the signal intensities for each feature by subtracting the background fluorescence for each channel (i.e., the wavelengths 532 nm (Cy3) and 635 nm (Cy5)). (2) Calculate the mean background fluorescence across both channels and for all features (i.e., amoA archetypes, controls) and identify significant signals as those having a signal intensity two standard deviations above the mean background fluorescence. (3) Calculate the ratio of Cy3:Cy5 fluorescence for each feature. For methods using a ratio of two dyes, remove from further analysis any features that do not have significant signal for both wavelengths. For single color analysis, features with no significant signal above background are considered zero. Compute the average of replicate features for each probe for the subsequent analysis. To subject the array data to subsequent statistical analysis, the absolute signal strength, the FR, or a relative fluorescence ratio (RFR) can be used, depending on the approach. For the internal standard approach used for the AOA and AOB arrays described here, RFR is the most robust measure. RFR is calculated as the contribution of each probe to the sum of FR for all probes in the set (e.g., all AOA amoA probes on the array).
6. Factors That Influence Hybridization Results For arrays containing hundreds or thousands of probes, it is not realistic to perform empirical validation tests for each probe. Such testing of some of the earlier applications with simpler arrays has been described (Bodrossy et al., 2003; He et al., 2005; Taroncher-Oldenburg et al., 2003). For large arrays, the predicted specificity is usually evaluated by computing various physical parameters for the probes: free energy of binding (http:// frontend.bioinfo.rpi.edu/applications/mfold/cgi-bin/dna-form1.cgi), percent identity with high identity MM targets, etc. (e.g., He et al., 2005, 2010). The principles derived from these characterizations are generally applied and a posteriori tests rely on reproducibility and internal correlations for validation of results. It is useful to illustrate a few general principles of array behavior, however, so that protocols can be optimized within the constraints of the array format. (a) Hybridization conditions: As with any hybridization based assay, the stringency of the hybridization and wash conditions are critical to the sensitivity and specificity of the assay. When using a small array containing a small number of relatively similar probes (e.g., all representing the same gene fragment), the GC ratio of all the probes is similar and one hybridization temperature can be optimal for all the probes. In complex
382
B. B. Ward and N. J. Bouskill
arrays, in which many different genes are represented, a single temperature may not be optimal for all probes because some genes have higher GC content than others, and thus their hybrids will be stable at higher temperatures. In selecting the probe region for multiple genes (see above for probe selection criteria), melting temperature is one of several features to be optimized. Similarly, the stringency of wash conditions after hybridization can influence specificity and cross reactivity. Longer low temperature washes tend to produce the best results, but stringency and signal strength must be balanced to obtain the best sensitivity for targets of interest. This will always require optimization with the targets and probe sets for each study. (b) Cross reactions: The characteristics of oligonucleotide probes were discussed above. Using optimized probe selection and hybridization conditions can yield highly specific and reproducible results, but some degree of nonspecific hybridization, that is, cross reactions, is probably unavoidable and cannot always be detected experimentally. A good way to address this problem is to include multiple probes for the same target organism. Multiple positive reactions are thus robust proof of target presence, while a mixture of positive and negative reactions would imply nonspecific reactions for some of the probes. This approach dramatically increases the number of probes required and the bioinformatics requirements, but is currently possible through commercial applications such as Nimblegen (http://www.nimblegen.com). (c) Length of incubation: Hybridizations are conveniently carried out “overnight,” a time period that ranges from 8 to 16 h. Target binding kinetics follow a Langmuir function (Dai et al., 2002), so that PM targets require longer to reach equilibrium than do MM targets. Thus, longer hybridization times should yield higher specificity of binding. (d) Concentration of target: The intensity of hybridization signal should increase with increasing target concentration. For an AOB amoA array, which was spotted with 25 pmol of probe in each feature, the relationship between concentration of PM target and fluorescence is shown in Fig. 15.2. It follows the generally expected linear increase in fluorescence at lower target concentrations, but appears to saturate, as all probe hybridization sites are filled (Held et al., 2003). Thus, it would be desirable for unknown targets to be present in the linear range of the response curve: if all targets are present at saturating concentrations, then no differences in signal will be discerned. In practice of course, it is not possible to optimize the concentration of every unknown target. The least amount of target that yields a strong signal is perhaps the best approach. The unknown sample, however, contains an undefined mixture of target and nontarget molecules, such that targets of similar total DNA concentration may contain quite variable amounts and mixtures of potential target molecules. There is essentially no way to
383
Functional Gene Microarrays for AOB and AOA
7 104 6 104 5 104
FR
4 104 3 104 2 104 1 104 0
0
10
20
30
40
50
60
70
DNA conc. (ng)
Figure 15.2 Fluorescence ratio (Cy3/Cy5 ¼ archetype fluorescence/internal standard oligo fluorescence) as a function of amount of target in hybridization mixture. The target was prepared using the three-step PCR protocol (amoA gene amplified with amoA-1F and amoA-2R primers (Rotthauwe et al., 1997)) from a culture of Nitrosospira multiformis, which is a member of AOB archetype A3.
account for this variability, which is a good reason to use relative abundance (percent of total signal) data in comparing microarray results for different samples. (e) Sensitivity: It would be useful to know the detection limit for individual target sequences in unknown samples, but this is not simple to determine. Figure 15.2 shows that 1 ng of labeled PM target produces a statistically significant signal. How much sediment must be extracted, or water must be filtered, in order to end up with a target that contains 1 ng of an individual archetype target? For mixed unknown samples, a large volume of water, often 4 L or more, is usually filtered and extracted. From this DNA extract a minimum of 25 ng of total DNA can generally produce 1000 ng of labeled target, the standard amount of mixed WDNA target recommended for the AOA array. Most of the 1000 ng in the target does not represent specific target molecules, however, and it’s not possible to determine how much of the mixed target represents a single sequence. If one could design quantitative PCR primers with the exact specificity of the archetype probes, this comparison could be made. But it is not generally possible to obtain
384
B. B. Ward and N. J. Bouskill
such specificity with qPCR. All of the archetype probe sequences can be obtained with one or two sets of amoA primers, and those are the primers most often used for qPCR of total AOA (Francis et al., 2005; Wuchter et al., 2006). As mentioned above in the protocols for WDNA target preparation, 1000 ng of target can be obtained from as little as 1 ng of total DNA extract using whole genome amplification, so sensitivity is not a great limitation to the array technology. (f) Probe/target capacity: Although all probe/target pairs follow the general relationship of increasing hybridization with increasing target concentration, the ratio of hybridization strength to target concentration (i.e., the slope of the linear portion of the curve in Fig. 15.2) varies among probe/target pairs. This is referred to as the probe capacity and cannot always be predicted from the thermodynamic properties of the PM or MM molecules (Held et al., 2003; Pozhitkov et al., 2006). For an AOB array, we showed that even among PM probe/target pairs, this capacity varies greatly (Ward et al., 2007). This means that the absolute hybridization signal cannot be interpreted in terms of absolute target concentration. In addition, the capacity varies between PM and MM probe/ target pairs for the same probe. In an unknown sample mixture, it is not known what portion of the signal is due to PM versus MM hybridizations. In an attempt to optimize specificity for highly similar probes, Marcelino et al. (2006) developed a mathematical approach for analysis of microarray data. Although not generally applicable to all array formats, this paper (Marcelino et al., 2006) is a useful resource for discussion of the hybridization behavior of oligonucleotide probes and targets. In practice, protocols are usually optimized and then performed consistently in order to remove variability from factors such as hybridization time and total DNA concentration.
7. Array Applications To illustrate the application of the functional gene microarray approach to study of AOB and AOA, we present a few recent examples. Both AOA and AOB are present in most environments, and their relative abundance often varies in correlation with environmental variables (e.g., Santoro et al., 2008), particularly in estuarine environments. AOB are more abundant in the upper freshwater reaches of Chesapeake Bay, where they exhibit an annually repeating pattern of community assembly (Bouskill et al., 2010). Using an AOB amoA array containing 26 betaproteobacterialAOB archetype probes representing all published sequences, 4 years of sampling showed that the assemblage varied consistently with season
385
Functional Gene Microarrays for AOB and AOA
(Bouskill et al., 2010). The water column was sampled three to four times each year over a 4-year period and the relative abundance of all known AOB lineages examined simultaneously. The AOB assemblages varied predictably with season. While assemblages were often dominated by estuarine archetypes (typical of estuaries that experience wide salinity ranges), seasonally reoccurring dynamics were also observed for “rare” archetypes (i.e., those that were rarely a major component of the RFR). An example of AOB assemblage variation over time is shown for a station in the upper Chesapeake Bay at 1 m above the bottom (Fig. 15.3,
TP1_D 25 RFR
20 15 10 5 0 2001
2002
2003
2004
TP2_D
RFR
20 15 10 5 0 2001
2002
2003
2004
TP3_D 40 RFR
30 20 10 0 2001
2002
2003
2004
August
2001
May
October October August
2002
2003
2004
Figure 15.3 Temporal classification of covarying archetypes based on K-means discrimination analysis at 1 m above the bottom in upper Chesapeake Bay. The left panel represents the RFR of individual archetypes in each temporal pattern (TP) over time. The identification of the archetype is not relevant for the overall analysis, which is to determine the seasonal behavior of the archetype as a whole. The right panel shows a centroid compiled from the cumulative behavior of all the archetypes in each cluster over time. This centroid is without magnitude and incorporates the trend of the RFR signals in each cluster through time.
386
B. B. Ward and N. J. Bouskill
left panel). Applying a discrimination analysis to the array dataset yielded a time series analysis in which different archetypes were classified by their temporal RFR patterns. Here the 26 AOB amoA archetypes grouped into three significant clusters, with three distinctly different temporal patterns (TPs), regardless of the absolute magnitude of the hybridization signal. The three TPs identified at the deep depth showed strong seasonal reoccurrence, as illustrated in the centroid for each group (Fig. 15.3, right panel). The profile of TP1-D appears to be an October signal (except for Oct. 2002), TP2-D was a repeating August pattern and TP3-D appeared as a spring pattern with peaks in all four April samples. The array was also sensitive enough to demonstrate community resilience following a significant perturbation event to the surface water (Bouskill et al., 2010). The assemblage changed dramatically in response to flooding caused by a hurricane, but the “normal” assemblage returned within a few months. Following the hurricane flooding, the community was dramatically altered; the estuarine archetypes disappeared and the assemblage was streamlined down to two archetypes. Physiological characteristics for the two archetypes could explain their success under the flood conditions caused by the hurricane. Resilience was demonstrated by the return to a “normal” assemblage following removal of the perturbation. For reasons of cost and labor, it would have been impractical to attempt to detect the patterns found in this dataset using clone libraries or either Sanger or next generation sequencing. The current AOA array (Bouskill et al., submitted) contains 31 archetype probes, and was developed from the public database of amoA sequences in 2009. amoA sequences continue to accumulate in the public database rapidly and most of them are the result of clone library studies using the same primer sets. Recent checks of newly published sequences shows that the current probe set should cover the vast majority if not all of them. The AOA array has been used to characterize community composition in samples from diverse environments (estuaries to oceans, sediments, and water column) around the world (Chesapeake Bay, Pacific, Atlantic, and Indian Oceans) (Bouskill et al., submitted). For two samples, the community composition derived from targets prepared by PCR and WDNA are compared in Fig. 15.4. In both cases, the RFR values derived from both target methods are very similar; the RFRs estimated from the two targets are highly correlated. The same dominant archetypes were identified by both methods and greater variability is associated with detection of archetypes that are responsible for less than 5% of the total signal. Nevertheless, both targets contained some signal from most of the archetypes, and the array analysis yields greater diversity estimates than obtained from a typical clone library. This suggests that use of PCR to obtain amoA sequences for AOA does not dramatically bias the estimates of community composition for targets derived from the same DNA extraction. This may not be true for every probe set and probably depends on the PCR primers and the divergence of the target genes.
387
Functional Gene Microarrays for AOB and AOA
A
ETSP_St.10_80 m 0.25 WDNA
0.015
WDNA-generated targets
0.2
0.15
R2 = 0.686
0.01 0.005
R2 = 0.964
0 0
0.002
0.004
0.006
0.008
0.01
PCR
0.1
0.05
0
0
0.05
0.1 0.15 PCR-generated targets
0.2
0.25
B Sargasso Sea_100 m 0.04 2
WDNA
WDNA-generated targets
R = 0.8765
0.03
0.3
0.02 0.01 0
0.2
R2 = 0.9854 0
0.01
0.02
0.03
0.04
PCR
0.1
0
0
0.05
0.1
0.15 0.2 PCR-generated targets
0.25
0.3
0.35
Figure 15.4 Comparison of RFR signals from targets prepared from the same sample by the three-step protocol for amoA PCR fragments and whole DNA (WDNA). (A) Eastern Tropical South Pacific Station 10 80 m and (B) Sargasso Sea 100 m, April 2004.
Using WDNA targets, we compared the relative abundance of AOA archetypes (RFR) among three samples (Fig. 15.5). Each colored bar represents the percent of total fluorescence (RFR) attributed to a particular archetype as the average of duplicate arrays prepared from the same target preparation. In the deep water (1 m above the sediment) of the seaward end of Chesapeake Bay (CB_300D) and 100 m depth of the open ocean of the
388
B. B. Ward and N. J. Bouskill
AOA32_CN8C_20_EF382433 0. AOA31_EF500_19O12_EF106947 AOA29_DS2_1_EF382468 AOA28_DS2_6_EF382473 0. AOA27_HB_29_EU022786
Relative fluorescence ratio (RFR)
100 90
AOA26_AOAC-S_SA09_EU339380 AOA25_DS2_2_EF382469 AOA24_DS4_20_EF382456 0. AOA23_HF770_22G04_EF106902 AOA22_AJ41-4_EU553368 AOA21_HF770_36M12_EF106908 0. AOA20_CN8C_17_EF382430
80 70 60 50 40 30 20 10 0 CB300_D_2003 (Coastal)
SS_M (Open Ocean)
ETSP_St.23_20 m (Offshore)
AOA19_MG85-37_EU553389 AOA18_TOB_61_DQ501021 AOA17_JCS82-4_EU553403 0. AOA16_HB_13_EU022770 AOA15_S33_A_12_EU025184 AOA14_CB3_14 0. AOA13_DS2_16_EF382483 AOA12_R60-70_278_DQ534884 AOA11_AOAC-U_SB06_EU339389 AOA10_AOAB_SH04_EU339454 0. AOA9_GOC-C-450-2_EU340536 AOA8_BS2-130MD3_EF414247 AOA7_AOAC-S_SA10_EU339381 AOA6_QY-A38_EF2072146 0. AOA5_TOB_159_DQ501119 AOA4_TOB_44_DQ501003 AOA3_GEO_OT2_AM260489 0. AOA2_BS80E_D4_EF414277 AOA1_OA-SA10-64_AB373281
Figure 15.5 Stacked bar plots comparing AOA community composition in three samples using targets prepared by the three-step protocol using WDNA.
Sargasso Sea (SS_M), archetype AOA12 is a major component. The clone library sequences that define this archetype were all derived from soils or estuarine sediments. The relative dominance of this archetype in the Sargasso Sea is not consistent with the robust biogeography of clone library sequences (Francis et al., 2005; Prosser and Nicol, 2008), which would suggest we should expect quite different assemblages in Chesapeake Bay and the Sargasso Sea. The Chesapeake Bay and Sargasso Sea samples were also similar in the relative contribution of archetypes AOA4 (sequences derived from various sediment environments, and including the hot spring enrichment culture, Nitrososphaera gargensis) and AOA26 (representing soil phylotypes). The appearance of sediment clades in the Sargasso Sea sample is unexpected, but unlikely due to artifacts of the method, such as cross reactions between probes. The level of identity between these probes representing sediment clades and those representing oceanic clades (<79%) is well below the threshold for cross reactivity in this format and there are no internal regions of very high identity within the 70 bp probe sequence. The array may be detecting sequences that are not amplified with the primers used to build the clone libraries upon which the biogeography of AOA has been described. The community composition of the Chesapeake Bay and Sargasso Sea samples was, however, quite different from the community composition found at 20 m depth at a 4000 m deep station in the Eastern Tropical South Pacific (ETSP) (Fig. 15.5). The dominant archetype in the ETSP sample was AOA9, which represents sequences obtained from deep ocean water with low oxygen content. AOA2, which represents AOA sequences from shallower depths in the water column, was also important only in the
Functional Gene Microarrays for AOB and AOA
389
ETSP sample. AOA21, representing sequences derived from deep ocean water, and AOA31, representing sequences derived from the water column of Monterey Bay, CA, were both much more important in the ETSP than either of the other two samples. Interestingly, archetype AOA1, which includes the cultivated ammonia-oxidizing archaeon, Nitrosopumilus maritimus, and a large number of published AOA amoA sequences from clone libraries, did not make a significant contribution to the array signal from any of these samples, suggesting once again that even this cultivated type with oligotrophic characteristics (Martens-Habbena et al., 2009) is not representative of many natural assemblages.
8. Possibilities and Limitations Microarrays have been developed and applied for many different additional functional groups, including nitrogen fixers (Moisander et al., 2007; Zhang et al., 2007), methane oxidizers (Bodrossy et al., 2006), denitrifiers (Bulow et al., 2008), sulfate reducers (Loy et al., 2002, based on 16S rDNA genes, rather than functional genes), among others. The most ambitious functional gene microarray developed to date is the GeoChip, now in its third generation (GeoChip 3.0; He et al., 2010) with 27,812 50bp oligonucleotide probes representing 292 genes or enzymes, including ammonia oxidation. The GeoChip and the many other smaller more focused arrays mentioned here all share some similar attributes, advantages, and limitations. Because the sequence must be known to be included on the array, the array cannot be used to discover new functional gene sequences. The probes may hybridize with sequences that are similar to but different from known sequences, but those new sequences are not retrieved for further analysis, and totally unknown genes that might fulfill the same function cannot be discovered with the array. Therefore, it is not an exploratory tool. Arrays do, however, make it possible to detect and describe the diversity of known genes with greater breadth and less expense than clone libraries (DeSantis et al., 2007). For example, a typical small clone library might contain 20–100 clones, usually 20–30 (Francis et al., 2005). In a typical environment, where one or a few phylotypes are dominant, many of those clones would be redundant. The total number of different OTUs typically reported for a clone library study of AOA with an OTU definition of 5% is on the order of 4–12 (Francis et al., 2005). Even with a much coarser OTU definition (15% for the array), many more OTUs, up to the total number of probes on the array, might be detected in each sample analyzed on the array (Fig. 15.4). If natural assemblages are often structured by a few abundant and many rare types, then a typical clone library would not include most of them, especially the rare types, while the array can detect them, in both PCR and WDNA preparations.
390
B. B. Ward and N. J. Bouskill
Neither clone libraries nor array hybridization yields reliable quantitative information, but in combination with qPCR, improvement is likely possible. Clone libraries offer greater resolution because exact sequences are obtained, but are constrained by time and expense to much less coverage than is possible with arrays. Because most sequences have been derived by PCR, the array approach cannot be free of PCR bias, but this can be minimized by the use of WDNA targets to avoid PCR bias in sample analysis. Clone libraries are very rarely replicated, while replicate sample analysis is rapid and simple for microarrays. Next generation sequencing may eventually replace microarray analysis, but this may not be soon. For focused analysis of specific functional groups, microarrays provide highthroughput analysis for which every datum is relevant, avoiding the necessity of extensive bioinformatics to sift through millions of reads to find the few sequences of importance for a particular functional gene.
9. Detailed Protocol for Functional Gene Microarrays Using Oligonucleotide Probes I. Target preparation starting from PCR products or genomic DNA (or cDNA made from RNA) extracted from an environmental sample. This protocol contains the steps required for dUaa labeling during a Klenow random priming reaction followed by conjugation with Cy dyes. 1. Begin with clean target DNA. When using PCR products, prepare at least three standard PCR reactions of the target sequence (or more if necessary to obtain enough for a few reactions at 25 ng each at the Klenow stage). Combine all the products and clean them using Qiaquick columns (standard Qiaquick protocol, Qiagen), so that you elute the pooled products in 2 30 mL of water or EB. Reduce this volume down to 20 mL or less (using a speed vac) if necessary to concentrate prior to the random priming reaction (see below). Measure the DNA concentration (using Pico Green, Invitrogen) after this step in order to select the appropriate volume for the next step. When using total genomic DNA (WDNA), it is necessary to cut the DNA into smaller fragments for labeling. Use any four cutter restriction enzyme. Clean up the digested DNA or cDNA with Qiaquick colums (standard protocol) or with an EtOH precipitation. Measure the DNA concentration of the genomic DNA. Use 50 ng in the digest: DNA HinF1 Buffer Water
x mL to contain 50 ng 0.1 mL (or 1 unit) 5 mL 50 (sum of above volumes) ¼ mL
391
Functional Gene Microarrays for AOB and AOA
Incubate 2 h 37 C. Add 5 mL 3 M Na-acetate and 100 mL 100% EtOH, mix well, ppt 15 min on ice. Spin 15 min in microfuge, remove supernatant with a pipet. Add 50–100 mL 70% EtOH, mix well, spin 5 min, remove supernatant with pipet. Dry 10 min at 40 C in the speed vac. Measure the DNA concentration after this step in order to select the appropriate volume for the next step. If using cDNA, it’s probably already in fragments, so proceed directly to the labeling reaction, assuming your cDNA is clean (if in doubt, Qiaquick). 2. Use the cleaned product in a random priming labeling reaction using the BioPrime kit (Invitrogen). Only the random primers (octomers), the buffer and the Klenow, not the dNTP mix from the kit, are used in the reaction. Make your own dNTP mix (below) containing dUaa Reaction mixture: 2.5 random primer mix DNA (25 ng) plus water to total volume 1.2 mM dNTP mix with dUaa (see below) Klenow enzyme
20 mL 24 mL 5 mL 1 mL
Mix the random primers and diluted DNA and heat at 95 C for 5 min, then put on ice. Add the dNTP mix and the enzyme, mix gently, and incubate at 37 C for 2–4 h. Add 5 mL stop buffer and proceed. Klenow dNTP mix (10 reactions worth): 10 mM dACG mix 10 mM dTTP 10 mM dUaa dH2O
19.8 mL 2.2 mL 24.2 mL 3.8 mL
3. Clean up the random priming reaction following the standard Qiaquick protocol except that modified EB and PE buffers (see below), not the Qiagen buffers, must be used. Use phosphate buffer (see below) for washes (2–3 is enough) and elute in 2 30 mL water or phosphate EB (see recipes below) (NOT Qiaquick’s EB!). Store product frozen at this stage or dry down to pellet and store pellet frozen. In general, use the PO4 buffers for cleanup when cleaning dUaa preps—the Qiaquick buffers contain Tris and the Cy3 can couple to the amino groups.
392
B. B. Ward and N. J. Bouskill
EtOH precipitation works very well here too (50 mL reaction, add 5 mL. 5 N NaOAc þ 100 mL 100% EtOH, wash with 70% EtOH). Resuspend the pellet in 50 mL of water. Measure the DNA concentration using PicoGreen. Aliquot the volume containing up to 1000 ng of dUaa DNA into a clean tube and reduce it to dryness using a speed vac. PO4 buffers 1. 1 M K2HPO4 ¼ 17.4 g/100 mL 1 M KH2PO4 ¼ 13.6 g/100 mL 2. 9.5 mL 1 M K2HPPO4 þ 0.5 mL 1 M KH2PO4 ¼ 1 M KPO4, pH 8.5 3. 0.5 mL 1 M KPO4 þ 15.25 mL dH2O þ 84.5 mL EtOH ¼ PO4 wash buffer (use this instead of Qiaquick PE) 4. 10 mL 1 M KPO4 þ 2.49 mL dH2O ¼ PO4 EB (use instead of Qiaquick EB)
4. Couple the Cy3 dye to the dUaa labeled DNA as follows. First, dissolve one dye pellet (40,000 pmol each, Monofunctional NHSester Cy3, GE Lifesciences) in 45 mL of DMSO. Keep it frozen and use in aliquots of 4.5 mL each (see below). The dye is not very stable in water or DMSO so do not make up more than you will use. Hydrate the dry dUaa DNA pellet (upto 1000 ng DNA) from step 3 in 4.5 mL of 100 mM NaCO3 buffer (pH 9) for 15 min. Then add 4.5 mL of the dissolved dye pellet, mix with the pipet without bubbling, and incubate in the dark for 3 h to overnight. Add 4.5 mL of 4 M hydroxylamine to quench the reaction and incubate a further 15 min in the dark (this last step is not necessary if you move immediately to the clean up step). Clean up the labeled product with the Qiaquick kit but follow these directions. Add 25 mL dH2O to the reaction before adding 200 mL PB buffer Add 3 mL of 3 M NaOAc, then mix the pink solution and add it to the column and spin through. Do 5 750-mL washes with PE or the alternate wash buffer (see above) Elute in 2 30-mL washes of EB or water Save 1 mL for PG and Cy3 quantification and dry down the rest of the eluted target, store frozen. Do two conjugation reactions of 1000 ng each and combine them. Measure the DNA concentration and perform the hybridization with up to 1000 ng per array. For PCR products, 200 ng suffices, but for WDNA targets, 500–1000 ng is preferable.
Functional Gene Microarrays for AOB and AOA
393
II. Hybridization protocol. This protocol is designed for use with Agilent gasket slides (http://www.agilent.com). It can be modified by scaling the volumes (and Cy5 amount) appropriately for 2-, 4-, and 8-well slides. The volumes given here are for 4-well slides. Total volume per well: 2-well gaskets: 200 mL 4-well gaskets: 100 mL 8-well gaskets: 80 mL 1. Hybridization mixtures Make hybridization mixture on ice: 50 – (x þ 1) mL H2O 50 mL 2 Agilent buffer x mL Cy3-target (e.g., 1000 ng worth for mixed environmental sample WDNA target) 1 mL Cy5-ref oligo (i.e., 0.5 pmol for 2-well slides, less for 8-well) 2. Working quickly, or preferably in an ozone free room, mix the hybridization mixture briefly (do not vortex) and heat at 95 C 5 min in wet block covered with foil. Cool on ice 2 min. Set up the gasket: Place the gasket coverslip in an Agilent hybridization chamber with the gasket side up. Apply the entire 100 mL hybridization mixture to one well inside gasket. Add mixtures to all gaskets (the volume will be about half of the gasket volume). Carefully place the array slide on top of coverslip, print side down. Close and secure hyb chamber Knock the chamber sharply on the counter to make all the bubbles coalesce into one large one in each gasket. It is important that the bubbles do not stick to the edges, make sure the entire solution flows when you turn the chamber. Place the hybridization chamber in the prewarmed hybridization oven and be sure to balance each chamber with another in exactly the opposite position in the rack. 3. Incubate at 60 or 65 C (depending on probe set) in the oven rotating overnight (16 h or longer). 4. Prepare the wash solutions (below).
394
B. B. Ward and N. J. Bouskill
Open the hybridization chamber, place slide and gasket (still stuck together) in a container of Wash #1. Use forceps to pry the coverslip off the slide while submerged. Be careful not to touch the slide with your fingers except on the edge, and try not to break the slide. 5. Transfer slide quickly to 2nd batch of Wash #1. Wash in a closed plasticware container (or for a single slide use a 50-mL tube) on shaker 20 min at 100 rpm. Cover so that the slide is not exposed to light. Transfer the slide to a container of Wash #2 and shake in the dark for 20 min. Transfer the slide to a container of Wash #3 and shake in the dark for 20 min. Remove the slide from the wash and dry it with a short spin in slide minicentrifuge or place the slide in a 50-mL tube supported by tissue paper in the bottom (do not let it touch the slide) and spin at 1000 rpm for 1 min in a table top centrifuge. Wash recipes: Wash #1 (1 L per use) Wash #2 (0.5 L per use) Wash #2 (0.5 L per use)
50 mL 20 SSC 10 mL 10% SDS up to 1 L in dH2O 50 mL 20 SSC up to 1 L in dH2O 5 mL 20 SSC up to 1 L in dH2O
After washing, store the slide in an ozone free room or desiccator in the dark until scanning. Slides are relatively stable at this point and can be stored or rescanned if necessary.
REFERENCES Bodrossy, L., and Sessitsch, A. (2004). Oligonucleotide microarrays in microbial diagnostics. Curr. Opin. Microbiol. 7, 245–254. Bodrossy, L., Stralis-Pavese, N., Murrell, J. C., Radajewski, S., Weilharter, A., and Sessitsch, A. (2003). Development and validation of a diagnostic microbial microarray for methanotrophs. Environ. Microbiol. 5, 566–582. Bodrossy, L., Stralis-Pavese, N., Donrad-Koszler, M., Weilharter, A., Reichenauer, T. G., Schofer, D., and Sessitsch, A. (2006). mRNA-based parallel-detection of active methanotroph populations by use of a diagnostic microarray. Appl. Environ. Microbiol. 72, 1672–1676.
Functional Gene Microarrays for AOB and AOA
395
Bouskill, N. J., Eveillard, D., O’Mullan, G. D., Jackson, G. A., and Ward, B. B. (2010). Seasonal and annual reoccurrence in ammonia-oxidizing bacterial population structure. Environ. Microbiol. Doi: 10.1111/j.1462-2920.2010.02362.x. Bouskill, N. J., Eveillard, D., Chien, D. M., Jayakumar, A., and Ward, B. B. (submitted). Distribution and abundance of ammonia-oxidizing organisms across environmental gradients. Bulow, S. E., Francis, C. A., Jackson, G. A., and Ward, B. B. (2008). Sediment denitrifier community composition and nirS gene expression investigated with functional gene microarrays. Environ. Microbiol. 10, 3057–3069. Dai, H. Y., Meyer, M., Stepaniants, S., Ziman, M., and Stoughton, R. (2002). Use of hybridization kinetics for differentiating specific from non-specific binding to oligonucleotide microarrays. Nucleic Acids Res. 30, e86. DeRisi, J. L., Iyer, V. R., and Brown, P. O. (1997). Exploring the metabolic and genetic control of gene expression on a genomic scale. Science 278, 680–686. DeSantis, T. Z., Brodie, E. L., Moberg, J. P., Zubieta, I. X., Piceno, Y. M., and Andersen, G. L. (2007). High-density universal 16S rRNA microarray analysis reveals broader diversity than typical clone library when sampling the environment. Microb. Ecol. 53, 371–383. DiRisi, J. L., Iyer, V. R., and Brown, P. O. (1997). Exploring the metabolic and genetic control of gene expression on a genomic scale. Science 278, 680–686. Francis, C., Roberts, K., Beman, J., Santoro, A., and Oakley, B. (2005). Ubiquity and diversity of ammonia-oxidizing archaea in water columns and sediments of the ocean. Proc. Natl. Acad. Sci. USA 102, 14683–14688. He, Z., Wu, L., Li, X., Fields, M., and Zhou, J. (2005). Empirical establishment of oligonucleotide probe design criteria. Appl. Environ. Microb. 71, 3753–3760. He, Z., Gentry, T. J., Schadt, C. W., Wu, L., Liebich, J., Chong, S. C., Huang, Z., Wu, W., Gu, B., Jardine, P., Criddle, C., and Zhou, J. (2007). GeoChip: A comprehensive microarray for investigating biogeochemical, ecological and environmental processes. ISME J. 1, 67–77. He, Z., Deng, Y., Van Nostrand, J. D., Tu, Q., Xu, M., Hemme, C. L., Li, X., Wu, L., Gentry, T. J., Yin, Y., Liebich, J., Hazen, T. C., et al. (2010). GeoCHip 3.0 as a highthroughput tool for analyzing microbial comunity composition, structure and functional activity. ISME J. 4, 1167–1179. Held, G. A., Grinstein, G., and Tu, Y. (2003). Modeling of DNA microarray data by using physical properties of hybridization. PNAS 100, 7575–7580. Koops, H.-P., Purkhold, U., Pommerening-Roser, A., Timmermann, G., and Wagner, M. (2003). The lithoautotrophic ammonia-oxidizing bacteria. In “The Prokaryotes: An Evolving Electronic Resource for the Microbiological Community,” (M. Dworkin, ed.), 3rd edn. Springer-Verlag, New York. Loy, A., Lehner, A., Lee, N., Adamczyk, J., Meier, H., Ernst, J., Schleifer, K. H., and Wagner, M. (2002). Oligonucleotide microarray for 16S rRNA gene-based detection of all recognized lineages of sulfate-reducing prokaryotes in the environment. Appl. Environ. Microbiol. 68, 5064–5081. Marcelino, L. A., Backman, V., Donaldson, A., Steadman, C., Thompson, R. J., Preheim, S. P., Lien, C., Lim, E., Veneziano, D., and Polz, M. F. (2006). Accurately quantifying low-abundant targets amid similar sequences by revealing hidden correlations in oligonucleotide microarray data. PNAS 103, 13629–13634. Martens-Habbena, W., Berube, P. M., Urakawa, H., de la Torre, J. R., and Stahl, D. A. (2009). Ammonia oxidation kinetics determine niche separation of nitrifying Archaea and Bacteria. Nature 461, 976–982.
396
B. B. Ward and N. J. Bouskill
Moisander, P. H., Morrison, A. E., Ward, B. B., Jenkins, B. D., and Zehr, J. P. (2007). Spatial-temporal variability in diazotroph assemblages in Chesapeake Bay using an oligonucleotide nifH microarray. Environ. Microbiol. 9, 1823–1835. Pozhitkov, A., Noble, P. A., Domazet-Loso, T., Nolte, A. W., Sonnenberg, R., Stehler, P., Geier, M., and Tautz, D. (2006). Tests of rRNA hybridization to microarrays suggest that hybridization characteristics of oligonucleotide probes for species discrimination cannot be predicted. Nucleic Acids Res. 34, e66. Prosser, J. I., and Nicol, G. W. (2008). Relative contributions of archaea and bacteria to aerobic ammonia oxidation in the environment. Environ. Microbiol. 10, 2931–2941. Purkhold, U., Pommerening-Roser, A., Juretschko, S., Schmid, M. C., Koops, H.-P., and Wagner, M. (2000). Phylogeny of all recognized species of ammonia oxidizers based on comparative 16S and amoA sequence analysis: Implications for molecular diversity surveys. Appl. Environ. Microbiol. 66, 5368–5382. Rotthauwe, J.-H., Witzel, K.-P., and Liesack, W. (1997). The ammonia monooxygenase structural gene amoA as a functional marker: Molecular fine-scale analysis of natural ammonia-oxidizing populations. Appl. Environ. Microbiol. 63, 4704–4712. Santoro, A. E., Francis, C. A., de Sieyes, N. R., and Boehm, A. B. (2008). Shifts in the relative abundance of ammonia-oxidizing bacteria and archaea across physicochemical gradients in a subterranean estuary. Environ. Microbiol. 10, 1068–1079. Schloss, P. D., and Handlesman, J. (2005). Introducing DOTUR, a computer program for defining operational taxonomic units and estimating species richness. Appl. Environ. Microbiol. 71, 1501–1506. Taroncher-Oldenburg, G., Griner, E., Francis, C. A., and Ward, B. B. (2003). Oligonucleotide microarray for the study of functional gene diversity of the nitrogen cycle in the environment. Appl. Environ. Microbiol. 69, 1159–1171. Treusch, A. H., Leininger, S., Kletzin, A., Schuster, S. C., Klenk, H.-P., and Schleper, C. (2005). Novel genes for nitrite reductase and Amo-related proteins indicate a role of uncultivated mesophilic crenarchaeota in nitrogen cycling. Environ. Microbiol. 7, 1985–1995. Venter, J., Remington, K., Heidelberg, J., Halpern, A., Rusch, D., Eisen, J., Wu, D., Paulsen, I., Nelson, K., Nelson, W., Fouts, D., Levy, S., et al. (2004). Environmental genome shotgun sequencing of the Sargasso Sea. Science 304, 66–74. Ward, B. B., Eveillard, D., Kirshtein, J. D., Nelson, J. D., Voytek, M. A., and Jackson, G. A. (2007). Ammonia-oxidizing bacterial community composition in estuarine and oceanic environments assessed using a functional gene microarray. Environ. Microbiol. 9, 2522–2538. Wu, L. Y., Liu, X., Schadt, C. W., and Zhou, J. Z. (2006). Microarray-based analysis of subnanogram quantities of microbial community DNAs by using whole-community genome amplification. Appl. Environ. Microbiol. 72, 4931–4941. Wuchter, C., Abbas, B., Coolen, M. J. L., Herfort, L., van Bleijswijk, J., Timmers, P., Strous, M., Teira, E., Herndl, G. J., Middelburg, J. J., Schouten, S., and Damste, J. S. S. (2006). Archaeal nitrification in the ocean. PNAS 103, 12317–12322. Zhang, L., Hurek, T., and Reinhold-Hurek, B. (2007). A nifH-based oligonucleotide microarray for functional diagnostics of nitrogen-fixing microorganisms. Microb. Ecol. 53, 456–470.
C H A P T E R
S I X T E E N
Structure and Function of Formate-Dependent Cytochrome c Nitrite Reductase, NrfA Oliver Einsle Contents 400 401 402
1. 2. 3. 4.
Introduction Isolation of NrfA Crystallization of NrfA and the NrfHA Complex Structure Solution by Multiple-Wavelength Anomalous Dispersion 5. Structure of NrfA 6. Heme Group Arrangement 7. Active Site Architecture 8. Substrate Complexes, Activity Assays, and Reactivity 9. Reaction Mechanism 10. Electron Transfer Systems Acknowledgments References
404 405 408 410 411 413 415 418 418
Abstract Cytochrome c nitrite reductase, NrfA, catalyzes the six-electron reduction of nitrite, NO2, to ammonium, NH4þ, as the final enzymatic step in the dissimilatory metabolic pathway of nitrite ammonification within the biogeochemical nitrogen cycle. NrfA is a 55–65 kDa protein that binds five c-type heme groups via thioether bonds to the cysteines of conserved CXXCH heme attachment motifs. Four of these heme groups are considered to be electron transfer centers, with two histidine residues as axial ligands. The remaining heme group features an unusual CXXCK-binding motif, making lysine the proximal axial ligand and leaving the distal position for the substrate binding site located in a secluded binding pocket within the protein. The substrate nitrite is coordinated to the active site heme iron though the free electron pair at the nitrogen atom and is reduced in a consecutive series of electron and proton transfers to Lehrstuhl fu¨r Biochemie, Institut fu¨r organische Chemie und Biochemie, Albert-Ludwigs-Universita¨t Freiburg, Freiburg, Germany Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00016-6
#
2011 Elsevier Inc. All rights reserved.
399
400
Oliver Einsle
the final product, the ammonium ion. While no intermediates of the reaction are released, NrfA is able to reduce various other nitrogen oxides such as nitric oxide (NO), hydroxylamine (H2NOH), and nitrous oxide (N2O), but notably also sulfite, providing the only known direct link between the nitrogen and sulfur cycles. NrfA invariably forms stable homodimers, but there are at least two distinct electron transfer systems to the enzyme. In many enterobacterial species, NrfA is linked to the menaquinol pool in the cytoplasmic membrane through a soluble electron carrier, NrfB, that in turn interacts with a membraneintegral quinol dehydrogenase, NrfCD. In d- and e-proteobacteria, the dimeric NrfA forms a complex with a small quinol dehydrogenase of the NapC/NirT family, NrfH, allowing a more efficient electron transfer.
1. Introduction Within the biogeochemical nitrogen cycle, the most oxidized form of nitrogen, nitrate (NO3), and the most reduced one, ammonium (NH4þ), are linked through the anaerobic respiratory pathway of dissimilatory nitrate ammonification (Berks et al., 1995; Einsle and Kroneck, 2004; Richardson et al., 1998; Simon, 2002). In only two steps, nitrate is first converted to nitrite (NO2) by a molybdenum-containing nitrate reductase and subsequently reduced by six electrons to ammonium by the pentaheme cytochrome c nitrite reductase, NrfA (Cole, 1982; Einsle, 2001; Kaije and Anraku, 1986; Liu and Peck, 1981; Schumacher and Kroneck, 1991b). Electrons for this reaction are commonly obtained through the oxidation of formate (nitrite reduction with formate, nrf) (Motteram et al., 1981), and catalysis proceeds according to NO2 þ 6e þ 8Hþ ⇆NH4 þ þ 2H2 O
ð16:1Þ
Microorganisms utilize this pathway to generate a proton motive force by a Q-loop mechanism involving membrane-bound formate dehydrogenase and a dedicated quinol dehydrogenase that forms part of the Nrf system. Different types of quinol-oxidizing systems have been described in context with NrfA enzymes (Fig. 16.1). When NrfA was first described in gproteobacteria such as Escherichia coli (Cole, 1968; Fujita and Sato, 1966), its gene was found in a genetic context of the type nrfABCDEFG, with nrfA coding for the actual enzyme, nrfB coding for a small, pentaheme electron transfer protein, nrfC and nrfD for the membrane-integral quinol dehydrogenase, and nrfE, nrfF, and nrfG for components of a dedicated assembly machinery required for attachment of the active site heme group (Eaves et al., 1998) (see below). In d- and e-proteobacteria and most other families of eubacteria, the nrf operon contains a gene for a membrane-integral
401
Cytochrome c Nitrite Reductase
E. coli, S. typhi, H. influenzae (g -proteobacteria) nrfA
nrfB
nrfC
nrfE
nrfD
nrfF
nrfG
S. deleyianum, W. succinogenes (e-proteobacteria) nrfH
nrfI
nrfA
nrfJ
P. gingivalis (bacteroides) nrfH
nrfA
nrfK
nrfL
nrfM
C. jejuni (e-proteobacteria) nrfH
nrfA*
Figure 16.1 Organization of the nrf operon in different families of eubacteria. While the nrfA gene encoding the catalytic subunit is conserved in all species, the electron transfer system varies considerably. In g-proteobacteria, nrfB encodes a soluble electron carrier that shuttles electrons from the quinol dehydrogenase NrfCD to NrfA. In most other species, the tetraheme NrfH protein anchors NrfA directly on the periphery of the cytoplasmic membrane. Additionally, the active site heme group cannot be linked to its cognate sequence CXXCK by the regular heme maturation systems, so that a dedicated heme lyase forms part of the operon. This lyase is derived from the main maturation machinery of the organism and is consequently similar to type I in g-proteobacteria and to type II in d- and e-proteobacteria and bacteroides. NrfA from C. jejuni shows a CXXCH motif for heme I and lacks an additional maturation system.
tetraheme cytochrome c of the NapC/NirT family designated nrfH (Simon et al., 2000). In these organisms, NrfA and NrfH form a membrane-associated respiratory complex on the extracellular side of the cytoplasmic membrane that optimizes electron transfer efficiency to the terminal acceptor nitrite (Simon et al., 2001). Besides its function in energy metabolism, NrfA might also play a role in providing reduced nitrogen for the cell (Cole, 1982). It generates ammonium in the periplasm that can subsequently be imported into the cytoplasm via ammonium transporters of the Amt/Rh family to be assimilated into glutamine by cytoplasmic glutamine synthetase (Andrade and Einsle, 2007). Other roles for the enzyme were suggested to be in detoxification of nitrite in sulfate-reducing bacteria (Greene et al., 2003; Pereira et al., 2000) or as actual sulfite reductases, as discussed below.
2. Isolation of NrfA The presence of a respiratory cytochrome c nitrite reductase was reported from a variety of organisms, including E. coli (Cole, 1968; Fujita and Sato, 1966; Kaije and Anraku, 1986), Vibrio fischeri (Prakhash and
402
Oliver Einsle
Sadana, 1972; Rehr and Klemme, 1986), Desulfovibrio desulfuricans ATCC27774 (Liu and Peck, 1981), Desulfovibrio gigas (Barton et al., 1983), Campylobacter sputorum biovar bubulus (de Vries et al., 1982), Wolinella succinogenes (Blackmore et al., 1986; Liu et al., 1983), Sulfurospirillum deleyianum (Schumacher and Kroneck, 1991b), Geobacter metallireducens (Murillo et al., 1999), and Desulfovibrio vulgaris (Pereira et al., 2000). Nitrite reductase activity was found to reside both in the soluble and membrane fractions during purification, but the distribution of both pools of protein varied strongly. While in E. coli virtually all activity was found in the soluble fraction (Cole, 1968), D. vulgaris showed a majority of enzyme bound to the membrane (Pereira et al., 2000). In other organisms, both fractions were enzymatically active. For the S. deleyianum enzyme, a form S1 (then deemed monomeric) was purified from the soluble fraction, while preparations from the membrane fractions yielded monomeric (M1) or tetrameric (M4) protein (Schumacher and Kroneck, 1991a; Schumacher et al., 1994b). With the benefit of hindsight we now understand the S1 and M1 forms to be NrfA dimers, while M4 represents the NrfHA complex (see below). After polyethyleneimine precipitation, S. deleyianum NrfA was purified by DEAE anion exchange chromatography, where it remained in the flow-through, followed by a hydroxyl apatite column. NrfA bound to the material and the column was developed with a potassium phosphate gradient. Size-exclusion chromatography on Superdex S200 was added as a final step, yielding pure protein. Aminoterminal sequencing confirmed that in the mature polypeptide, a signal sequence of 22 residues, typical for periplasmic proteins, was cleaved off. The protein from W. succinogenes was subsequently purified following a very similar protocol, wherein the initial precipitation step could be omitted (Fig. 16.2) (Stach et al., 2000). For the purification of the membrane-bound NrfHA complex, essentially the same steps were utilized, but the protein material was initially obtained by solubilization of the membrane pellet after ultracentrifugation at 100,000g (M100) with 1% (v/v) of Triton X-100.
3. Crystallization of NrfA and the NrfHA Complex Single crystals of sufficient diffraction quality for structure determination were first obtained with the enzyme from S. deleyianum (Einsle et al., 1999). Here, the nucleation of crystals required temperatures around 30 C, but large single crystals were only found after using these nuclei to seed into new solutions at 20 C. Crystals were grown by the sitting drop vapor diffusion method using a reservoir solution containing 10% polyethylene
403
Cytochrome c Nitrite Reductase
DEAE anion exchange
Running buffer: 50 mM potassium phosphate, pH 7.1
NrfA in flow-through
Hydroxyl apatite (1.3 × 11 cm)
Elution in HPO42– gradient
Superdex 200 GE HiLoad 26/60
Elution buffer: 500 mM potassium phosphate, pH 7.1, linear gradient, 50–300 mM
Elution at 140 mM
Running buffer: 50 mM HEPES/NaOH, pH 7.5
Elution as symmetric dimer peak Concentrate by ultrafiltration 50 kDa MWCO
Figure 16.2 Purification flowchart for W. succinogenes NrfA. The soluble fraction is applied to a weak anion exchange column, where NrfA is found in the flow-through, but many acidic proteins are retained. In a second chromatographic step, the protein binds to a hydroxyl apatite column that is developed with a linear gradient from 50 to 300 mM of potassium phosphate buffer, pH 7.1. A final size exclusion chromatography step on Superdex 200 yields the pure protein.
glycol 4000, 0.13 M ammonium sulfate, and 0.1 M HEPES/NaOH buffer at pH 7.5. Two microliters of protein solution (5 mg mL–1) was mixed with an equal amount of reservoir solution and equilibrated against 500 mL of reservoir. Seeding was carried out by streak-seeding crushed microcrystals into a new, preequilibrated drop with the help of a rabbit whisker. S. deleyianum NrfA crystals belonged to space group P21212 with unit cell ˚ , b ¼ 185.3 A ˚ , and c ¼ 92.2 A ˚. dimensions of a ¼ 107.5 A The reproducibility of this crystallization process was problematic, but changing to the enzyme of W. succinogenes improved the situation (Einsle et al., 2000). These crystals were grown by sitting drop vapor diffusion using a reservoir solution containing 12% polyethylene glycol 4000, 0.2 M ammonium sulfate, and 15 mM YCl3 in 100 mM sodium acetate buffer at
404
Oliver Einsle
pH 5.7, and crystal growth was crucially dependent on the presence of yttrium(III) ions as an additive. The crystals appeared without seeding at ˚. room temperature, and diffraction was observed to a resolution of 1.6 A Higher resolution structures were obtained when the additive YCl3 was kept strictly anhydrous in a desiccator before use in the crystallization buffers (Lukat et al., 2008). For the NrfHA complex, the first crystals were reported for W. succinogenes (Einsle et al., 2002b), but this work was discontinued due to poor diffraction quality. The first structure of the complex was presented for D. vulgaris, crystallized in the presence of dodecyl maltoside or Zwittergent 3–12. These crystals grew from 10% (w/v) of polyethylene glycol 4000 and 0.1 M HEPES/NaOH buffer at pH 7.5 (Rodrigues et al., 2006).
4. Structure Solution by Multiple-Wavelength Anomalous Dispersion Phase information for NrfA from S. deleyianum was not available through molecular replacement, as no similar structures were known at the time. Consequently, a multiple-wavelength anomalous dispersion (MAD) experiment at the iron K-edge was carried out at a synchrotron radiation source (DESY, Hamburg, Germany). Data were collected at three wavelengths to maximize the anomalous f 00 contribution of the heme iron ˚ , dmin ¼ 2.3 A˚), their dispersive f 0 contribution atoms (l ¼ 1.736 A ˚ ˚ ), and finally for a remote data set (l ¼ 1.739 A, dmin ¼ 2.3 A ˚ ˚ (l ¼ 1.050 A, dmin ¼ 1.9 A) (Einsle et al., 1999). Automated methods for heavy atom detection were not readily available at the time, such that the real-space positions of the iron atoms had to be derived from anomalous difference Patterson maps. In an iterative process, correlated peaks from all three Harker sections of the P21212 cell were chosen and used for phase calculations. The highest peaks from the resulting Fourier map were then analyzed for consistency with the anomalous difference Patterson map, and correct positions were used for a new cycle of phase calculations. This procedure successively yielded a consistent set of 15 iron positions, divided in three groups of five irons that perfectly matched the Harker peaks (Fig. 16.3) and produced a sensible crystal packing. After electron density averaging, the resulting map was readily interpretable and a structural model could be built and refined. NrfA at this time was considered to be a hexaheme (Costa et al., 1996; Liu and Peck, 1981), a pentaheme (Eaves et al., 1998), or a tetraheme enzyme (Schumacher et al., 1994b), and the structure unequivocally settled this dispute. Further structures of NrfA proteins were obtained by the molecular replacement method.
Cytochrome c Nitrite Reductase
405
V U
V U
Figure 16.3 w ¼ 0 Harker section of an anomalous difference Patterson map of S. deleyianum NrfA. The experimental map (above) shows 15 distinct peaks that consistently appeared in the other Harker sections as well and perfectly match a theoretical difference Patterson map calculated from the actual iron positions of the refined structure (below).
5. Structure of NrfA The first successful structure determination of an NrfA enzyme, from the e-proteobacterium S. deleyianum (Schumacher and Kroneck, 1991b), showed the general architecture of this class of multiheme cytochromes c (Einsle et al., 1999). The protein forms a homodimer with approximate ˚ 50 A ˚ , in which the 10 covalently attached dimensions of 100A˚ 80A heme groups are closely packed (Fig. 16.3). The dimer interface is dominated by three long a-helices in each monomer, and although the area of this interface amounts to only 8–10% of the total surface area of the protein, the arrangement is highly conserved and was retained in all structures of
406
Oliver Einsle
pentaheme nitrite reductases available to date (Table 16.1). The five heme groups in each monomer are sufficiently close to assure rapid intramolecular electron transfer that also bridges the dimer through the adjacent heme group 5 from each monomer. Heme group 1 forms the center of the catalytically active site of the enzyme (Fig. 16.4). While it follows the typical scheme of c-type heme groups by forming thioether bonds to the cysteines of a CXXC motif, its unusual feature is the replacement of the proximal axial ligand—usually a histidine—with lysine. The heme iron atom is coordinated by the Nz atom of this residue, and the distal axial position remains free for interaction with substrates. During maturation of cytochromes c, the presence of the proximal histidine ligand is a crucial prerequisite for the recognition of the binding motif by a specialized heme lyase
Table 16.1 Structures of NrfA proteins available to date
Organism
Sulfurospirillum deleyianum Wolinella succinogenes
Escherichia coli
Desulfovibrio desulfuricans Desulfovibrio vulgaris
Ligand/variant/ state
Reference
1QDB 1.9
SO42
Einsle et al. (1999)
1FS7 1FS8 1FS9 2E80 2E81 3BNF 3BNG 3BNH 3BNJ 1GU6 2RDZ 2RF7 1OAH
H2O SO42 N3 NO2 H2NOH SO32 H2O/Y218F NO2/Y218F SO32/Y218F H2O H2 O H2O/Q263E H2 O
Einsle et al. (2000) Einsle et al. (2000) Einsle et al. (2000) Einsle et al. (2002a) Einsle et al. (2002a) Lukat et al. (2008) Lukat et al. (2008) Lukat et al. (2008) Lukat et al. (2008) Bamford et al. (2002) Clarke et al. (2008) Clarke et al. (2008) Cunha et al. (2003)
H2O/NrfHA H2O, HQNO/ NrfHA H2 O SO32//reduced NO2 SO32 N3 HPO42
Rodrigues et al. (2006) Rodrigues et al. (2008)
PDBID
˚) dmin (A
1.6 1.6 2.0 1.6 2.0 1.7 1.5 1.75 1.3 2.5 1.74 2.04 2.3
2J7A 2.3 2VR0 2.8
Thioalkalovibrio 2OT4 1.5 nitratireducens 3FO3 1.4 3D1I 1.8 3F29 2.0 2ZO5 1.7 3GM6 1.8
Polyakov et al. (2009) Polyakov et al. (2009) Polyakov et al. (2009) Polyakov et al. (2009) Polyakov et al. (2009) Trofimov et al. (2010)
Cytochrome c Nitrite Reductase
407
Figure 16.4 Structure of the NrfA dimer from W. succinogenes (PDB-ID 1FS7). The peptide chain packs into a compact, predominantly a-helical fold that can be subdivided into the central part, where long helices form the dimer interface, and the hemecontaining part, where the peptide chain wraps tightly around the densely packed cofactors. Iron ions are shown in orange with the heme groups in stick representation and Ca2þ ions are depicted in grey.
system (Kranz et al., 1998, 2009; O’Brian and Tho¨ny-Meyer, 2002; Tho¨nyMeyer, 2002). A variety of such systems have been characterized, but in no instance was it possible to attach a heme moiety to a CXXCK motif. Instead, the maturation of NrfA requires a dedicated heme lyase that is derived from the respective maturation system of the organism, the abovementioned NrfEFG in E. coli (Eaves et al., 1998) or the nrfIJ gene products in the e-proteobacterium W. succinogenes (Kern et al., 2010). Subsequently, this was the second organism for which a structure became available (Einsle et al., 2000), and here the binding of a range of substrates such as nitrite (Einsle et al., 2002a) and sulfite (Lukat et al., 2008), intermediates such as hydroxylamine (H2NOH) (Einsle et al., 2002a), and inhibitors such as sulfate and azide (Einsle et al., 2000) was demonstrated. In the following years, structural analyses were presented for NrfA from E. coli (Bamford et al., 2002) and D. desulfuricans ATCC27774 (Cunha et al., 2003), followed by the complete structure of the NrfHA complex from D. vulgaris (Rodrigues et al., 2006) and the structure of E. coli NrfB, the electron donor for NrfA (Clarke et al., 2007). Variations on the theme of pentaheme nitrite reductases were discovered recently, when the octaheme enzyme formerly known as tetrathionate reductase (Mowat et al., 2004) was found to reduce nitrite and H2NOH (Atkinson et al., 2007). A further octaheme enzyme with the same catalytic capabilities was found in the haloalkalophilic g-proteobacterium
408
Oliver Einsle
Active site
1 4
4
3 6
5
7
1 2
2
8 5 3
Figure 16.5 Heme group arrangement in W. succinogenes NrfA (red) in comparison to the octaheme cytochrome c nitrite reductase from T. nitratireducens (black). The heme groups pack into characteristic perpendicular (green) and parallel (blue) interaction motifs that alternate to form efficient electron transfer chains. In both cases, the active site is located at corresponding cofactors, heme 1 in NrfA and heme 4 in the octaheme cytochrome c.
Thioalkalivibrio nitratireducens (Polyakov et al., 2009). This protein showed a hexameric structure and a heme arrangement of the monomer that was highly reminiscent of the octaheme H2NOH oxidoreductase from Nitrosomonas europaea (Igarashi et al., 1997). However, the exact trimer arrangement showed clear differences and the enzyme lacked the covalent linkage of a conserved tyrosine residue to a meso-carbon atom of the active site heme porphyrin ring found there (Fig. 16.5). A careful comparison of available sequences of pentaheme and octaheme cytochromes c led to the hypothesis of a sequential evolutionary process from the original, pentaheme NrfA-type cytochromes c through a fusion with a small cytochrome c to yield the octaheme type of nitrite reductases. From these, the evolution of the covalent linkage to the active site cofactor brought forth the more recent octaheme enzymes, H2NOH oxidoreductase and hydrazine oxidoreductase (Klotz et al., 2008).
6. Heme Group Arrangement Similar to many other c-type cytochromes of known structure, the NrfA peptide chain does not show a distinct domain organization but is wrapped around the tightly packed heme groups that consequently form an
Cytochrome c Nitrite Reductase
409
integral part of the protein’s folding core. Structures of apo-cytochromes c, therefore, can rarely be obtained, and in the stepwise process of protein folding, the interaction of individual heme groups is as crucial as that of individual a-helices for the correct formation of the tertiary structure. Within many multiheme c proteins, heme groups pack into distinct and recurring motifs that were recognized early on in electron transfer proteins such as cytochrome c554 from N. europaea (Iverson et al., 1998) and enzymes such as NrfA (Einsle, 2001; Einsle et al., 2000). They were classified in particular into a parallel and a perpendicular stacking interaction. These two types of interactions are combined in the proteins to form efficient electron transfer chains (Fig. 16.5), but their functional properties and features have yet to be understood. Model systems have been established to study the parallel packing motif in detail (Heitmann and Einsle, 2005), but to date no diheme cytochrome c structure is available that contains the perpendicular motif. Heme-packing motifs allow fast electron transfer, and in NrfA as well as in H2NOH oxidoreductase, the redox chains include all heme groups with the exception of the active site heme (Fig. 16.5). It is located in a close and parallel stacking interaction with a heme group of a parallel packing motif and is thus able to tap into the reservoir of electrons provided by the redox chain. Possibly, the parallel packing motif allows the nearly fully concerted transfer of two electrons at a critical step of the reaction mechanism (see below). However, the fact that the required number of six electrons for the reaction does not coincide with the five hemes in NrfA or the eight in octaheme nitrite reductase speaks against the necessity to fully charge the system with electrons before substrate binding takes place. More likely, the multitude of heme cofactors simply enables conduction and limited storage of electrons to buffer the time-limiting step of binding and oxidation of a menaquinol molecule at the corresponding quinol dehydrogenase of the NrfA system. A relevant factor for the function of heme groups as electron transfer centers is their individual midpoint redox potential. The redox potential range covered by heme proteins spans almost 1 V, and the key determinants for this property are (i) the axial ligands of the central iron atom, (ii) the structural distortions of porphyrin planarity (ruffling) imposed by the protein environment, (iii) hydrophobicity and/or charge of the surrounding protein matrix, and (iv) the orientation and tilt of the axial ligands (Ma et al., 1998). In NrfA, all heme groups with the exception of the active site heme are bis-histidinyl coordinated. This generally results in negative redox potentials, in accordance with potentiometric titrations for the S. deleyianum, W. succinogenes (Schumacher and Kroneck, 1991b), and D. desulfuricans ATCC27774 (Costa et al., 1996) proteins. As the only pentacoordinate heme group in the system, the active site heme 1 is found with its iron atom in a high-spin state that is detectable by UV/visible and electron paramagnetic resonance (EPR) spectroscopies.
410
Oliver Einsle
To date, the role of lysine as a proximal axial ligand is not understood, and although nitrate ammonifiers afford to have separate and specific heme maturation systems for this single heme group, catalytically active NrfA proteins with a regular CXXCH motif at the active site heme do exist, for example, in Campylobacter jejuni (Fig. 16.1). A K134H variant of W. succinogenes NrfA, with the active site lysine replaced with the regular histidine, showed only 30% of the specific activity of the wild type, but this finding might be distorted by the fact that the protein environment has evolved to optimally accommodate the longer lysine side chain (Kern et al., 2010). The actual structure of C. jejuni NrfA would also be interesting for the fact that an unexpected variation on the theme of heme iron ligands was found in the structure of the octaheme enzyme from Shewanella oneidensis MR-1 (Mowat et al., 2004) that reduces not only tetrathionate but also nitrite and H2NOH (Atkinson et al., 2007). In spite of a negligible amino acid sequence homology, the heme groups 2–6 of this protein are arranged in a very similar manner to the five cofactors in NrfA, and the active site is again found at heme group 2 that corresponds to heme 1 in NrfA. However, while in tetrathionate reductase, this heme group is attached via the common CXXCH motif, the proximal histidine ligand, His 78, is detached from the iron atom and replaced by Lys 56 from an adjacent helix in the protein. This results in a proximal lysine ligation (an amine vs. a histidine imine), and it is conceivable that a similar rearrangement occurs in C. jejuni NrfA.
7. Active Site Architecture The active site of NrfA located at the distal side of heme group 1 is accessible through a predominantly positively charged, funnel-like entrance from the protein surface. The electrostatic surface potential of this area has been suggested to facilitate the entry of the negatively charged substrate nitrite, while a matching exit pathway with predominantly hydrophobic or negatively charged character exists at the distal side of the active site (Einsle et al., 1999, 2000). The active site cavity is lined by three conserved residues that in the W. succinogenes structure are Arg 114, Tyr 218, and His 276 (Fig. 16.6). All other heme groups in the enzyme are located behind heme 1 as seen from the substrate binding site, so that their direct interaction with nitrite seems highly unlikely. A further conserved feature in the immediate environment of heme group 1 is a binding site for a calcium ion, the exact role of which remains to be clarified. It may act in orienting the active site residue Tyr 218, as the backbone carbonyl group of this residue is a ligand to the cation. Also, calcium coordination of the conserved Gln 277 assures that the amide nitrogen rather than the (calcium-coordinating) oxygen faces the active site cavity. Replacement of this residue for glutamate in E. coli resulted in a 10-fold increase in KM for nitrite, while vmax was not affected (Clarke et al., 2008).
411
Cytochrome c Nitrite Reductase
Ca2+
H276
Y218
Ca2+
R114
H276
R114
Y218
heme 1
K134
heme 1
K134
Figure 16.6 Stereo representation of the active site environment of W. succinogenes NrfA as seen along the funnel-like substrate entry pathway. The binding site for substrates is the distal axial position of heme group 1. The three amino acid residues in a distance that permits interaction with substrates are Arg 114, Tyr 218, and His 276. The active site is completed by a conserved calcium ion, the exact role of which remains unclear.
8. Substrate Complexes, Activity Assays, and Reactivity Catalytic activity of NrfA was most commonly determined by following the oxidation of an artificial electron donor such as methyl viologen in the presence of enzyme and substrate (Schumacher et al., 1994b). Ammonia was shown to be the only product, and its detection was carried out by HPLC (Schumacher et al., 1994b; Stach et al., 2000). In a typical activity assay, a reaction buffer (e.g., 10 mM potassium phosphate buffer, pH 7.2) was mixed with substrate, oxalate, 5-deazaflavin, and methyl viologen and sealed in a modified Thunberg cuvette under anoxic conditions. The viologen was reduced with the oxalate by irradiating the deazaflavin that acted as a catalyst. After recording of a baseline, the enzymatic reaction was started by addition of enzyme and rapid mixing and the oxidation of the colorless, reduced viologen were monitored as an increase of absorption at a wavelength of 600 nm. The six-electron reaction of nitrite to ammonia catalyzed by NrfA consists of a complex sequence of electron and proton transfer steps (see below). However, while a number of putative reaction intermediates, such as nitric oxide (NO), nitrous oxide (N2O), and H2NOH, react with nitrite reductase, no free intermediate of the reduction of nitrite could be detected (Schumacher and Kroneck, 1991b; Stach et al., 2000). The identity of the product of the reaction has not been established in all cases, and the reaction
412
Oliver Einsle
rate observed for nitrite exceeds that for all other substrates by far and was determined to 414 3 mmol of NO2 min1 mg1 for W. succinogenes (Lukat et al., 2008; Stach et al., 2000), 1050 mmol of NO2 min1 mg1 for S. deleyianum (Schumacher et al., 1994a), 453 mmol of NO2 min1 mg1 for D. desulfuricans ATCC27774 (Pereira et al., 1996), and 872 mmol of NO2 min1 mg1 for E. coli (Bamford et al., 2002). The substrate nitrite binds to the distal axial position of the active site heme group through the free electron pair of the nitrogen atom, and this association was shown in crystal structures of oxidized NrfA from W. succinogenes (Einsle et al., 2002a) (Fig. 16.7A), and also in the oxidized octaheme nitrite reductase from T. nitratireducens (Polyakov et al., 2009). In this, the heme-containing nitrite reductases differ from their copper-containing counterparts that catalyze the one-electron reduction of nitrite to NO in the pathway of denitrification (Murphy et al., 1995). Here, nitrite was found to coordinate the active site copper ion through its oxygen atoms, while the reaction product, NO, bound in an unprecedented, side-on orientation (Tocheva et al., 2004). In NrfA, the reaction product is the fully reduced modification of nitrogen, ammonium. The observed N-coordination seems chemically reasonable and is prerequisite for avoiding the release of reaction intermediates. A soak of crystals of oxidized W. succinogenes NrfA with the putative reaction intermediate H2NOH yielded an adduct whose structure corresponded well with the previously determined nitrite complex. It showed that the oxygen atom that interacts with Tyr 218 and His 276 is the first to be removed (Fig. 16.7B). A second activity reported for NrfA is the six-electron reduction of sulfite to sulfide in an analogous reaction to that of nitrite (2). It was detected in NrfA from D. desulfuricans ATCC27774 at 2.06 mmol of H2 min1 mg1 A
B
C
Figure 16.7 Substrate binding in W. succinogenes NrfA. (A) Nitrite adduct (PDB-ID 2E80) with the substrate anion binding to the heme iron through the electron pair at the nitrogen atom. (B) Hydroxylamine adduct (PDB-ID 2E81). For the two nonhydrogen atoms, the binding of hydroxylamine is virtually identical to the nitrogen and one oxygen of nitrite (A), indicating that the other oxygen is removed first as a water molecule. (C) Sulfite adduct (PDB-ID 3BNF). The binding mode is highly similar to nitrite (A), but the bond distance to iron is slightly longer due to the larger van-derWaals radius of sulfur.
Cytochrome c Nitrite Reductase
413
in a manometric assay (Pereira et al., 1996) and in S. deleyianum at 1.1 mmol of H2 min1 mg1 (Stach et al., 2000). The binding mode of the sulfite anion was recently determined in a crystal structure of the W. succinogenes enzyme (Lukat et al., 2008). SO3 2 þ 6e þ 7Hþ ⇆HS þ 3H2 O
ð16:2Þ
The sulfite reductase activity determined for W. succinogenes NrfA was 0.4 0.1 mmol of H2 min1 mg1. Although these values are far lower than the corresponding values for nitrite stated above, they are notably higher than the reported activity of the dissimilatory, siroheme-dependent sulfite reductase of D. desulfuricans Essex 6 at 0.04–0.1 mmol of H2 min1mg1 (Steuber et al., 1995). Structures of this enzyme from the hyperthermophilic euryarchaeon Archaeoglobus fulgidus (Schiffer et al., 2008) and from D. vulgaris (Oliveira et al., 2008) were recently presented and show a similar binding mode for the substrate sulfite as was seen in NrfA. The comparatively low activity for sulfite reductase, an enzyme involved in energy metabolism, was suggested to be due to an incomplete occupancy of the multiple iron–sulfur clusters in the protein and variations between different preparations. In W. succinogenes, NrfA nitrite reductase activity is drastically reduced when the active site residue Tyr 218 is replaced by a phenylalanine. The Y218F variant only shows an activity of 3 1 mmol of NO2 min1 mg1, less than 0.7% of the wild type (Lukat et al., 2008). At the same time, however, the sulfite reductase activity of this point mutant remains unchanged within measurement errors. In the nitrite adduct of NrfA (Fig. 16.7A), Tyr 218 does not directly interact with the bound nitrite, but the Y218F point mutation does induce a slight change in the exact substrate binding mode. While these observations are not yet fully understood, a possible role of a tyrosyl radical in the mechanism of nitrite reduction has been discussed, awaiting experimental confirmation.
9. Reaction Mechanism All substrate complexes of NrfA or of the octaheme nitrite reductase as described above were obtained by soaking or cocrystallization using oxidized enzyme, as the use of reduced enzyme would have immediately initiated the reduction reaction. It is assumed that in the substrate binding modes, there is no significant difference between oxidized and reduced enzyme, but direct evidence for this is difficult to obtain. In addition, protein crystallography—even at very high resolution—will only be able to distinguish between triatomic (nitrite), diatomic (H2NOH, NO), and
414
Oliver Einsle
monoatomic (ammonium, water) ligands, but the mechanistic processes during the six-electron reduction of nitrite must be complex. For the above reasons, the complex structures described above were used as starting points for theoretical considerations of the mechanism of NrfA by density functional calculations (Einsle et al., 2002a). Individual proton and electron transfer steps were resolved, and a detailed mechanistic proposal was made (Fig. 16.8). The reaction starts with the binding of nitrite to the enzyme in the reduced or oxidized state, displacing a bound water molecule. With the active site heme in the Fe(II) state and the provision of two protons from the enzyme, the first oxygen atom can form a water molecule, leaving the active site as a formal Fe(II)–NOþ adduct, or {Fe–NO}6, following the Enemark and Feltham nomenclature for iron nitrosyls. A single electron transfer at this point would yield the {Fe–NO}7 state, which is notoriously stable and might be problematic for a fast reaction H
H O Fe
e
–
H
III
H
O FeII
NLys
NLys
–
NO2 H2O
+
+
H H2O
NH4
–HisN H O O N –TyrO H
– NO2
H H N H II Fe e
Fe
+
2H
O
II
+
NH+ 4
NLys
H 2O
II
NLys
–
N
Fe 6 {Fe–NO}
H H N H III Fe
–
–
O
+
N II
Fe 7 {Fe–NO}
NLys H2O
e + 2H
e
NLys
NLys O H H N H II Fe
O
+
N
e
–
II
Fe 8 {Fe–NO} NLys
O H N
NLys
Fe 2H
+
–
2e
II
NLys
H
+
Figure 16.8 Proposed reaction mechanism for NrfA. The substrate nitrite replaces a water ligand at the distal axial position of heme group I. A heterolytic cleavage of the first N–O bond initiates the reaction sequence, in which alternating proton and electron transfer events lead to the enzyme-bound intermediates Fe(II)–HNO and Fe(II)– H2NOH and eventually yield the product, ammonium. Figure reproduced with permission from Einsle et al. (2002a).
Cytochrome c Nitrite Reductase
415
flow. Considering the heme group architecture of NrfA, it seems conceivable that the parallel heme-packing motif formed by hemes 3 and 4 (Fig. 16.5) is able to deliver two electrons nearly simultaneously, leading to the less stable {Fe–NO}8 state that exhibits a high proton affinity and will yield a Fe(II)–HNO adduct upon protonation (Fig. 16.8). Subsequently, two electrons and two protons are required to reach the state of Fe(II)– H2NOH, corresponding to the Fe(III)–H2NOH adduct characterized by crystallography. The calculations indicate that here the sequence of transfers is less crucial with no critical energetic barriers. From the state of H2NOH, the second oxygen atom can be released as water with the transfer of two protons and one electron from the enzyme and a second electron from the heme iron. Thus, at the stage of the product complex, the catalytic iron is in the oxidized state for the first time during the reaction cycle. Only one final electron transfer is required to complete the reaction sequence, and the calculations showed that the release of ammonium or its replacement by a water or nitrite molecule may take place before or after this last reduction step. Due to the presence of the conserved residue Tyr 218, the role of a tyrosine radical during the catalytic cycle was considered, but the energy barriers involved seem to exclude this possibility and no spectroscopic evidence for a radical intermediate has been presented to date.
10. Electron Transfer Systems Substantial variability is found in the genetic contexts of the nrfA gene in different organisms (Fig. 16.1). As discussed above, this concerns not only the specialized maturation system for the active site heme group, but also the electron transfer system that connects the enzyme to the pool of menaquinone within the cytoplasmic membrane. The nrfABCDEFG operon found in g-proteobacteria encodes a four-component system for the cytochrome c nitrite reductase complex consisting of the catalytic NrfA dimer, the pentaheme electron transfer protein NrfB, and the membraneintegral quinol dehydrogenase NrfCD (Fig. 16.9A). Structures are available for NrfA (Bamford et al., 2002) and NrfB (Clarke et al., 2007) from E. coli, and based on the finding that both proteins do not copurify, they were proposed to form only transient electron transfer complexes (Clarke et al., 2004). No structure for the NrfCD complex is available to date that consists of the polytopic membrane protein NrfD and the iron–sulfur protein NrfC that contains a set of four [4Fe:4S] clusters. The two subunits of this complex are homologous to the PsrB and PsrC proteins that form part of the polysulfide reductase membrane complex required for sulfur respiration, and the recent structure of this complex from Thermus thermophilus
416
Oliver Einsle
A
B NrfB
NrfA
“NrfCD”
NrfA
NrfH
Figure 16.9 Electron transfer systems in different types of cytochrome c nitrite reductases. (A) The NrfABCD system is predominantly found in g-proteobacteria and consists of a quinol dehydrogenase, NrfCD, located in the cytoplasmic membrane. It transfers electrons from menaquinol to a soluble, pentaheme electron carrier, NrfB, which in turn reduces the enzyme, NrfA. To date no three-dimensional structure is available for NrfCD; the depicted structure is that of the homologous PsrBC complex of the polysulfide reductase from T. thermophilus ( Jormakka et al., 2008). (B) In most other bacterial species, such as in D. vulgaris, cytochrome c nitrite reductase forms a membrane-associated complex with the quinol dehydrogenase NrfH in a NrfH2A4 stoichiometry. The physical coupling to the menaquinone pool in the membrane allows a fast and efficient electron transfer.
constitutes a good working model for NrfCD ( Jormakka et al., 2008) (Fig. 16.9A). Here, the binding site for menaquinol is localized in the interface of both subunits, and all metal clusters are outside of the membrane. Electron transfer to NrfB likely occurs from the terminal cluster of NrfC, and the five heme groups in NrfB form a redox chain with electron input at heme 1 and electron output to NrfA at heme 5 (Clarke et al., 2007). Electrons enter E. coli NrfA presumably at heme group 2 (Bamford et al., 2002) (Fig. 16.5), but the exact mode of interaction of NrfA and NrfB remains to be elucidated. A model proposed by Clarke and coworkers makes an interesting suggestion in that the NrfAB complex might mimic the heme arrangement found, for example, in octaheme nitrite reductase of T. nitratireducens (Clarke et al., 2007; Polyakov et al., 2009), but a structural superposition of both proteins shows that this would result in severe clashes of the peptide chains and also prohibit the formation of a NrfB dimer that was observed during purification (Clarke et al., 2004). Like in many similar cases of periplasmic reductases, an architecture consisting of a soluble terminal redox enzyme, a further soluble electron carrier and a membrane-bound quinol dehydrogenase is not easily explained. Such a system does not seem optimally efficient and even if its main role does indeed lie in nitrite detoxification, one would expect evolution to favor the elimination of the intermittent carrier given that the components are fully mobile. The
417
Cytochrome c Nitrite Reductase
other possibility would then be that the system forms a membrane complex in vivo, but that the complex is too unstable to survive any common cellbreaking procedure. Stability of the reductase complex is not an issue in the second version of the Nrf system, where the NapC/NirT family quinol dehydrogenase NrfH is tightly linked to NrfA and can be coisolated and cocrystallized (Einsle et al., 2002b; Rodrigues et al., 2006). The crystal structure of the D. vulgaris complex not only shows a perfect fit of the proteins but also underlines the striking asymmetry of one NrfH monomer interacting with a NrfA dimer (Fig. 16.9B). The stoichiometry of the entire complex is NrfH2A4 (Rodrigues et al., 2006), as was proposed earlier for S. deleyianum (Schumacher et al., 1994a), and it is unknown whether all active sites in the system are in a working state. In D. vulgaris, NrfHA electrons are transferred from quinol to heme group 1 and further along the chain of hemes to heme 4, from where they are passed on to NrfA (Rodrigues et al., 2008).
4
4
5
3
5
3 2
2 1
1
Figure 16.10 Structural comparison of the electron donors for NrfA. The membrane protein NrfH (black) is a quinol dehydrogenase with the quinol binding site located at heme 1. Heme 4 lacks a distal axial ligand, but a lysine is provided by NrfA upon complex formation. In NrfB (red), all heme groups are bis-histidinyl-coordinated. The heme groups of NrfH align well with hemes 1–4 of NrfB, forming two pairs of parallel packing motifs. Although sequence similarities between both proteins are negligible, the overall topology of the protein chain is conserved.
418
Oliver Einsle
At first glance, NrfH and NrfB seem to be fundamentally distinct systems. The proteins show no discernible homology in amino acid sequence, and the fact that the four heme groups of NrfH align well with hemes 1–4 of NrfB (Clarke et al., 2007) may be attributed to their arrangement in two pairs of parallel heme-packing motifs that are commonly observed in structurally unrelated multiheme cytochromes (Heitmann and Einsle, 2005). However, on closer observation, the homology in the tertiary structure of both proteins becomes obvious (Fig. 16.10) and the chain topology is identical. This speaks for a common, albeit distant, evolutionary origin for NrfH and NrfB. The difference between the two systems is nevertheless fundamental. The presence of heme 5 in NrfB prohibits the formation of a complex such as that observed for D. vulgaris NrfHA (Rodrigues et al., 2006), and NrfB also lacks the quinol binding site of NrfH as this function is taken over by the NrfCD complex. In spite of the highly conserved structure and heme group arrangement of NrfA, the great variations in the interaction with their respective electron donors underline the considerable flexibility of multiheme cytochromes c that we are currently only beginning to unravel.
ACKNOWLEDGMENTS This work was supported by Deutsche Forschungsgemeinschaft (Ei-520/1, Ei-520/2, IRTG 1478). Peter Kroneck is acknowledged for stimulating discussions and critical reading of the chapter.
REFERENCES Andrade, S. L. A., and Einsle, O. (2007). The Amt/Mep/Rh family of ammonium transport proteins. Mol. Membr. Biol. 24, 357–365. Atkinson, S. J., Mowat, C. G., Reid, G. A., and Chapman, S. K. (2007). An octaheme c-type cytochrome from Shewanella oneidensis can reduce nitrite and hydroxylamine. FEBS Lett. 581, 3805–3808. Bamford, V. A., Angove, H. C., Seward, H. E., Thomson, A. J., Cole, J. A., Butt, J. N., Hemmings, A. M., and Richardson, D. J. (2002). Structure and spectroscopy of the periplasmic cytochrome c nitrite reductase from Escherichia coli. Biochemistry 41, 2921–2931. Barton, L. L., LeGall, J., Odom, J. M., and Peck, H. D., Jr. (1983). Energy coupling to nitrite respiration in the sulfate-reducing bacterium Desulfovibrio gigas. J. Bacteriol. 153, 867–871. Berks, B. C., Ferguson, S. J., Moir, J. W. B., and Richardson, D. J. (1995). Enzymes and associated electron transport systems that catalyse the respiratory reduction of nitrogen oxides and oxyanions. Biochim. Biophys. Acta Bioenerg. 1232, 97–173. Blackmore, R., Roberton, A. M., and Brittain, T. (1986). The purification and some equilibrium properties of the nitrite reductase of the bacterium Wolinella succinogenes. Biochem. J. 233, 547–552.
Cytochrome c Nitrite Reductase
419
Clarke, T. A., Dennison, V., Seward, H. E., Burlat, B., Cole, J. A., Hemmings, A. M., and Richardson, D. J. (2004). Purification and spectropotentiometric characterization of Escherichia coli NrfB, a decaheme homodimer that transfers electrons to the decaheme periplasmic nitrite reductase complex. J. Biol. Chem. 279, 41333–41339. Clarke, T. A., Cole, J. A., Richardson, D. J., and Hemmings, A. M. (2007). The crystal structure of the pentahaem c-type cytochrome NrfB and characterization of its solutionstate interaction with the pentahaem nitrite reductase NrfA. Biochem. J. 406, 19–30. Clarke, T. A., Kemp, G. L., Van Wonderen, J. H., Doyle, R. M. A. S., Cole, J. A., Tovell, N., Cheesman, M. R., Butt, J. N., Richardson, D. J., and Hemmings, A. M. (2008). Role of a conserved glutamine residue in tuning the catalytic activity of Escherichia coli cytochrome c nitrite reductase. Biochemistry 47, 3789–3799. Cole, J. A. (1968). Cytochrome c552 and nitrite reduction in Escherichia coli. Biochim. Biophys. Acta 162, 356–368. Cole, J. A. (1982). Independent pathways for the anaerobic reduction of nitrite to ammonia by Escherichia coli. Biochem. Soc. Trans. 10, 476–478. Costa, C., Moura, J. J. G., Moura, I., Wang, Y. N., and Huynh, B. H. (1996). Redox properties of cytochrome c nitrite reductase from Desulfovibrio desulfuricans ATCC 27774. J. Biol. Chem. 271, 23191–23196. Cunha, C. A., Macieira, S., Dias, J. M., Almeida, G., Goncalves, L. L., Costa, C., Lampreia, J., Huber, R., Moura, J. J. G., Moura, I., and Romao, M. J. (2003). Cytochrome c nitrite reductase from Desulfovibrio desulfuricans ATCC 27774—The relevance of the two calcium sites in the structure of the catalytic subunit (NrfA). J. Biol. Chem. 278, 17455–17465. de Vries, W., Niekus, H. G., van Berchum, H., and Stouthamer, A. H. (1982). Electron transport-linked proton translocation at nitrite reduction in Campylobacter sputorum subspecies bubulus. Arch. Microbiol. 131, 132–139. Eaves, D. J., Grove, J., Staudenmann, W., James, P., Poole, R. K., White, S. A., Griffiths, I., and Cole, J. A. (1998). Involvement of products of the nrfEFG genes in the covalent attachment of haem c to a novel cysteine-lysine motif in the cytochrome c552 nitrite reductase from Escherichia coli. Mol. Microbiol. 28, 205–216. Einsle, O. (2001). Cytochrome c nitrite reductase. In “Handbook of Metalloproteins,” (A. Messerschmidt, R. Huber, T. Poulos, and K. Wieghardt, eds.).Wiley & Sons, NewYork. Einsle, O., and Kroneck, P. M. H. (2004). Structural basis of denitrification. Biol. Chem. 385, 875–883. Einsle, O., Messerschmidt, A., Stach, P., Bourenkov, G. P., Bartunik, H. D., Huber, R., and Kroneck, P. M. H. (1999). Structure of cytochrome c nitrite reductase. Nature 400, 476–480. Einsle, O., Stach, P., Messerschmidt, A., Simon, J., Kro¨ger, A., Huber, R., and Kroneck, P. M. H. (2000). Cytochrome c nitrite reductase from Wolinella succinogenes: Structure at 1.6 A˚ resolution, inhibitor binding and heme-packing motifs. J. Biol. Chem. 275, 39608–39616. Einsle, O., Messerschmidt, A., Huber, R., Kroneck, P. M. H., and Neese, F. (2002a). Mechanism of the six-electron reduction of nitrite to ammonia by cytochrome c nitrite reductase. J. Am. Chem. Soc. 124, 11737–11745. Einsle, O., Stach, P., Messerschmidt, A., Klimmek, O., Simon, J., Kro¨ger, A., and Kroneck, P. M. H. (2002b). Crystallization and preliminary X-ray analysis of the membrane-bound cytochrome c nitrite reductase complex (NrfHA) from Wolinella succinogenes. Acta Crystallogr. D 58, 341–342. Fujita, T., and Sato, R. (1966). Studies on soluble cytochromes in enterobacteriaceae. III. Localization of cytochrome c552 in the surface layer of cells. J. Biochem. 60, 568–577.
420
Oliver Einsle
Greene, E. A., Hubert, C., Nemati, M., Jenneman, G. E., and Voordouw, G. (2003). Nitrite reductase activity of sulphate-reducing bacteria prevents their inhibition by nitratereducing, sulphide-oxidizing bacteria. Environ. Microbiol. 5, 607–617. Heitmann, D., and Einsle, O. (2005). Structural and biochemical characterization of DHC2, a novel diheme cytochrome c from Geobacter sulfurreducens. Biochemistry 44, 12411–12419. Igarashi, N., Moriyama, H., Fujiwara, T., Fukumori, Y., and Tanaka, N. (1997). The 2.8 A˚ structure of hydroxylamine oxidoreductase from a nitrifying chemoautotrophic bacterium, Nitrosomonas europaea. Nat. Struct. Biol. 4, 276–284. Iverson, T. M., Arciero, D. M., Hsu, B. T., Logan, M. S. P., Hooper, A. B., and Rees, D. C. (1998). Heme packing motifs revealed by the crystal structure of the tetra-heme cytochrome c554 from Nitrosomonas europaea. Nat. Struct. Biol. 5, 1005–1012. Jormakka, M., Yokoyama, K., Yano, T., Tamakoshi, M., Akimoto, S., Shimamura, T., Curmi, P., and Iwata, S. (2008). Molecular mechanism of energy conservation in polysulfide respiration. Nat. Struct. Mol. Biol. 15, 730–737. Kaije, S., and Anraku, Y. (1986). Purification of a hexaheme cytochrome c552 from Escherichia coli K12 and its properties as a nitrite reductase. Eur. J. Biochem. 154, 457–463. Kern, M., Eisel, F., Scheithauer, J., Kranz, R. G., and Simon, J. (2010). Substrate specificity of three cytochrome c haem lyase isoenzymes from Wolinella succinogenes: unconventional haem c binding motifs are not sufficient for haem c attachment by Nrfl and CcsA1. Mol. Microbiol. 75, 122–137. Klotz, M. G., Schmid, M. C., Strous, M., den Camp, H. J. M. O., Jetten, M. S. M., and Hooper, A. B. (2008). Evolution of an octahaem cytochrome c protein family that is key to aerobic and anaerobic ammonia oxidation by bacteria. Environ. Microbiol. 10, 3150–3163. Kranz, R., Lill, R., Goldman, B., Bonnard, G., and Merchant, S. (1998). Molecular mechanisms of cytochrome c biogenesis—Three distinct systems. Mol. Microbiol. 29, 383–396. Kranz, R. G., Richard-Fogal, C., Taylor, J. S., and Frawley, E. R. (2009). Cytochrome c biogenesis: Mechanisms for covalent modifications and trafficking of heme and for hemeiron redox control. Microbiol. Mol. Biol. Rev. 73, 510–528. Liu, M. C., and Peck, H. D. J. (1981). The isolation of a hexaheme cytochrome from Desulfovibrio desulfuricans and its identification as a new type of nitrite reductase. J. Biol. Chem. 256, 13159–13164. Liu, M.-C., Liu, M.-Y., Payne, W. J., Peck, H. D., Jr., and LeGall, J. (1983). Wolinella succinogenes nitrite reductase: Purification and properties. FEMS Microbiol. Lett. 19, 201–206. Lukat, P., Rudolf, M., Stach, P., Messerschmidt, A., Kroneck, P. M. H., Simon, J., and Einsle, O. (2008). Binding and reduction of sulfite by cytochrome c nitrite reductase. Biochemistry 47, 2080–2086. Ma, J. G., Zhang, J., Franco, R., Jia, S. L., Moura, I., Moura, J. J. G., Kroneck, P. M. H., and Shelnutt, J. A. (1998). The structural origin of nonplanar heme distortions in tetraheme ferricytochromes c3. Biochemistry 37, 12431–12442. Motteram, P. A. S., Mccarthy, J. E. G., Ferguson, S. J., Jackson, J. B., and Cole, J. A. (1981). Energy-conservation during the formate-dependent reduction of nitrite by Escherichia coli. FEMS Microbiol. Lett. 12, 317–320. Mowat, C. G., Rothery, E., Miles, C. S., McIver, L., Doherty, M. K., Drewette, K., Taylor, P., Walkinshaw, M. D., Chapman, S. K., and Reid, G. A. (2004). Octaheme tetrathionate reductase is a respiratory enzyme with novel heme ligation. Nat. Struct. Mol. Biol. 11, 1023–1024. Murillo, F. M., Gugliuzza, T., Senko, J., Basu, P., and Stolz, J. F. (1999). A heme-ccontaining enzyme complex that exhibits nitrate and nitrite reductase activity from the
Cytochrome c Nitrite Reductase
421
dissimilatory iron-reducing bacterium Geobacter metallireducens. Arch. Microbiol. 172, 313–320. Murphy, M. E. P., Turley, S., Kukimoto, M., Nishiyama, M., Horinouchi, S., Sasaki, H., Tanokura, M., and Adman, E. T. (1995). Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc. Biochemistry 34, 12107–12117. O’Brian, M. R., and Tho¨ny-Meyer, L. (2002). Biochemistry, regulation and genomics of haem biosynthesis in prokaryotes. Adv. Microb. Physiol. 46(46), 257–318. Oliveira, T. F., Vonrhein, C., Matias, P. M., Venceslau, S. S., Pereira, I. A. C., and Archer, M. (2008). The crystal structure of Desulfovibrio vulgaris dissimilatory sulfite reductase bound to DsrC provides novel insights into the mechanism of sulfate respiration. J. Biol. Chem. 283, 34141–34149. Pereira, I. C., Abreu, I. A., Xavier, A. V., LeGall, J., and Teixeira, M. (1996). Nitrite reductase from Desulfovibrio desulfuricans ATCC 27774 - A heterooligomer heme protein with sulfite reductase activity. Biochem. Biophys. Res. Commun. 224, 611–618. Pereira, I. A. C., LeGall, J., Xavier, A. V., and Teixeira, M. (2000). Characterization of a heme c nitrite reductase from a non-ammonifying microorganism, Desulfovibrio vulgaris Hildenborough. Biochim. Biophys. Acta Protein Struct. Mol. Enzymol. 1481, 119–130. Polyakov, K. M., Boyko, K. M., Tikhonova, T. V., Slutsky, A., Antipov, A. N., Zvyagilskaya, R. A., Popov, A. N., Bourenkov, G. P., Lamzin, V. S., and Popov, V. O. (2009). High-resolution structural analysis of a novel octaheme cytochrome c nitrite reductase from the haloalkaliphilic bacterium Thioalkalivibrio nitratireducens. J. Mol. Biol. 389, 846–862. Prakhash, O., and Sadana, J. C. (1972). Purification, characterization and properties of nitrite reductase of Achromobacter fischeri. Arch. Biochem. Biophys. 148, 614–632. Rehr, B., and Klemme, J. H. (1986). Metabolic role and properties of nitrite reductase of nitrate-ammonifying marine Vibrio species. FEMS Microbiol. Lett. 35, 325–328. Richardson, D. J., Wehrfritz, J. M., Keech, A., Crossman, L. C., Roldan, M. D., Sears, H. J., Butler, C. S., Reilly, A., Moir, J. W., Berks, B. C., Ferguson, S. J., Thomson, A. J., et al. (1998). The diversity of redox proteins involved in bacterial heterotrophic nitrification and aerobic denitrification. Biochem. Soc. Trans. 26, 401–408. Rodrigues, M. L., Oliveira, T. F., Pereira, I. A. C., and Archer, M. (2006). X-ray structure of the membrane-bound cytochrome c quinol dehydrogenase NrfH reveals novel haem coordination. EMBO J. 25, 5951–5960. Rodrigues, M. L., Scott, K. A., Sansom, M. S. P., Pereira, I. A. C., and Archer, M. (2008). Quinol oxidation by c-type cytochromes: Structural characterization of the menaquinol binding site of NrfHA. J. Mol. Biol. 381, 341–350. Schiffer, A., Parey, K., Warkentin, E., Diederichs, K., Huber, H., Stetter, K. O., Kroneck, P. M. H., and Ermler, U. (2008). Structure of the dissimilatory sulfite reductase from the hyperthermophilic archaeon Archaeoglobus fulgidus. J. Mol. Biol. 379, 1063–1074. Schumacher, W., and Kroneck, P. M. H. (1991). Dissimilatory hexaheme c nitrite reductase of “Spirillum” strain 5175: purification and properties. Arch. Microbiol. 156, 70–74. Schumacher, W., Hole, U., and Kroneck, M. H. (1994). Ammonia-forming cytochrome c nitrite reductase from Sulfurospirillum deleyianum is a tetraheme protein—New aspects of the molecular composition and spectroscopic properties. Biochem. Biophys. Res. Commun. 205, 911–916. Simon, J. (2002). Enzymology and bioenergetics of respiratory nitrite ammonification. FEMS Microbiol. Rev. 26, 285–309. Simon, J., Gross, R., Einsle, O., Kroneck, P. M. H., Kro¨ger, A., and Klimmek, O. (2000). A NapC/NirT-type cytochrome c (NrfH) is the mediator between the quinone pool and the cytochrome c nitrite reductase of Wolinella succinogenes. Mol. Microbiol. 35, 686–696.
422
Oliver Einsle
Simon, J., Pisa, R., Stein, T., Eichler, R., Klimmek, O., and Gross, R. (2001). The tetraheme cytochrome c NrfH is required to anchor the cytochrome c nitrite reductase (NrfA) in the membrane of Wolinella succinogenes. Eur. J. Biochem. 268, 5776–5782. Stach, P., Einsle, O., Schumacher, W., Kurun, E., and Kroneck, P. M. H. (2000). Bacterial cytochrome c nitrite reductase: New structural and functional aspects. J. Inorg. Biochem. 79, 381–385. Steuber, J., Arendsen, A. F., Hagen, W. R., and Kroneck, P. M. H. (1995). Molecular properties of the dissimilatory sulfite reductase from Desulfovibrio desulfuricans (Essex) and comparison with the enzyme from Desulfovibrio vulgaris (Hildenborough). Eur. J. Biochem. 233, 873–879. Tho¨ny-Meyer, L. (2002). Cytochrome c maturation: A complex pathway for a simple task? Biochem. Soc. Trans. 30, 633–638. Tocheva, E. I., Rosell, F. I., Mauk, A. G., and Murphy, M. E. P. (2004). Side-on coppernitrosyl coordination by nitrite reductase. Science 304, 867–870. Trofimov, A. A., Polyakov, K. M., Boiko, K. M., Filimonenkov, A. A., Dorovatovskii, P. V., Tikhonova, T. V., Popov, V. O., and Koval‘chuk, M. V. (2010). Structure of octaheme cytochrome c nitrite reductase from Thioalkalivibrio nitratireducens in a complex with phosphate. Crystallogr. Rep. 55, 58–64.
C H A P T E R
S E V E N T E E N
Detection and Characterization of a Multicopper Oxidase from Nitrosomonas europaea Thomas J. Lawton and Amy C. Rosenzweig Contents 423 426 426 427 429 430 430 430 430 431 431
1. Introduction 2. Identification, Detection, and Isolation 2.1. Identification and classification of MCOs 2.2. Detection of BCO in cell lysates 2.3. Isolation 3. Characterization and Crystallization 3.1. Metal content 3.2. Activity 3.3. Crystallization and structure solution Acknowledgments References
Abstract Blue copper oxidase (BCO) is a multicopper oxidase (MCO) found in Nitrosomonas europaea as well as in other ammonia-oxidizing organisms. In this chapter, we detail methods used to detect, isolate, and characterize BCO from N. europaea. A method for identifying and classifying MCOs commonly found in nitrifiers based on primary sequence is also described.
1. Introduction Multicopper oxidases (MCOs) are a diverse group of enzymes that couple the oxidation of a variety of substrates to the reduction of dioxygen and include notable members such as ascorbate oxidase, Fet3p, CueO, ceruloplasmin, and laccases (Kosman, 2010; Messerschmidt, 1997; Solomon et al., 1996). They are widely distributed in nature and are Departments of Molecular Biosciences and of Chemistry, Northwestern University, Evanston, Illinois, USA Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00017-8
#
2011 Elsevier Inc. All rights reserved.
423
424
Thomas J. Lawton and Amy C. Rosenzweig
involved in many different processes, including metal homeostasis, ascorbate metabolism, and phenolic substrate oxidation. Of relevance to this volume, MCOs also appear to play a supporting role in nitrite reduction (Beaumont et al., 2005; Giardina et al., 2010; Roberts et al., 2002; Taylor et al., 2005). Despite being well characterized, it is difficult to assign a MCO to a given pathway based solely on sequence. In some cases, putative function can be assigned on the basis of genes nearby those encoding MCOs and on the presence of unique unconserved loop regions. This strategy is particularly useful in the case of MCOs involved in metal homeostasis. Although MCO function is not obvious from sequence, it is relatively straightforward to identify a MCO based on highly conserved metal binding motifs (see below). These motifs ligate four copper ions in two distinct metal centers: a mononuclear blue type 1 copper center (T1) and a trinuclear copper center (TNC) consisting of a type 2 copper center and a dinuclear type 3 copper center. Substrate oxidation occurs at the T1 copper center. Electrons are then transferred to the TNC for dioxygen reduction via a cysteine- and histidine-mediated pathway, provided by a HCH metal binding motif (Kosman, 2010; Quintanar et al., 2007). For a complete review of the MCO mechanism, see Augustine et al. (2010) and Solomon et al. (2008). In contrast to the highly conserved metal sites, MCOs come in many different sizes due to varying numbers of cupredoxin domains. The number of cupredoxin domains can be used as a convenient way to categorize MCOs (Nakamura et al., 2003). These categories can then be subdivided based on the locations of the metal centers and unique loops (Fig. 17.1 and below). To date, MCOs with two (2dMCO), three (3dMCO), and six (6dMCO) domains have been characterized (Nakamura and Go, 2005). The best characterized MCO from a nitrifying organism is a 2dMCO from Nitrosomonas europaea that has been referred to in the literature as blue copper oxidase (BCO) and is encoded by the ncgA gene (Dispirito et al., 1985; Lawton et al., 2009; Nakamura et al., 2003). In N. europaea, ncgA shares an operon with a nitrite reductase and two proteins containing c-type cytochrome binding motifs and is regulated by a nitrite sensor (nsrR) (Beaumont et al., 2004; Chain et al., 2003). Disruption of the ncgA gene results in increased sensitivity to nitrite toxicity, and biochemical studies show that BCO can reduce dioxygen using cytochromes or organic dyes as electron donors (Beaumont et al., 2005; Dispirito et al., 1985). The crystal structure of BCO has also been determined and reveals an overall structure that strongly resembles copper nitrite reductases (Lawton et al., 2009). In particular, BCO contains a structural feature known as a tower loop. The analogous loop in copper nitrite reductases, along with an adjacent hydrophobic patch, forms a docking site for proteinaceous electron donors (Nojiri et al., 2009; Vlasie et al., 2008). The presence of a tower loop in BCO
425
Detection and Characterization of a Multicopper Oxidase from Nitrosomonas europaea
2dMCO Type A
Type B
Type C D1
D1 D1 D2
D2
D2
D2
D2
D2 D1
D1 D1
D1
D2
6dMCO
3dMCO
D1
D2
D1
Fox1-like
Ceruloplasmin-like D1
D1
D1 D2
D2 D2
D2
D3
D6
D3
D6
D5 D4
D3
D5 D4
Figure 17.1 Schematic diagram for classification of MCOs based on number of domains and metal site location. T1 copper centers are shown as filled black circles. TNC centers are shown as white circles outlined with black. T2 sites in 6dMCOs are not shown.
suggests that it may receive electrons from a proteinaceous electron donor. The exact function of BCO is not yet known, but it has been proposed to either (1) play a role in mitigating oxygen toxicity during aerobic nitrifier denitrification (Lawton et al., 2009) or (2) be involved in electron transfer to the nitrite reductase (Stein, personal communication). In the genomic context, 2dMCOs appear to be the predominant MCOs in ammonia-oxidizing bacteria (AOB) and ammonia-oxidizing archaea (AOA) (Chain et al., 2003; Stein et al., 2007; Walker et al., 2010). In addition to BCO, the N. europaea genome encodes a second 2dMCO (annotated as a ferroxidase in Nitrosospira multiformis and Nitrosococcus oceani) (Klotz et al., 2006; Norton et al., 2008) and a 6dMCO similar in domain arrangement to the ferroxidase Fox1 (Terzulli and Kosman, 2009). Notably, the genome of Nitrosopumilus maritimus, an AOA, contains three 2dMCOs and one 3dMCO. In addition to fulfilling similar functions to the MCOs in N. europaea, it has been proposed that the N. maritimus MCOs might have novel functions (Walker et al., 2010). Despite the wealth of information about MCOs, the genome of N. maritimus demonstrates there is still much to learn, especially in the context of ammonia oxidizers. Using BCO as an example, this chapter
426
Thomas J. Lawton and Amy C. Rosenzweig
details methods for identification and classification of MCOs, with specific relevance to nitrifiers and detection of MCOs in cell lysates. In addition, an updated purification protocol for BCO and methods used to characterize BCO are described.
2. Identification, Detection, and Isolation 2.1. Identification and classification of MCOs There are three basic steps to identifying and classifying MCOs: (1) identify the essential ligand set, (2) identify the number of domains and location of T1 copper centers, and (3) identify unique features such as ligand-rich binding loops, tower loops, or terminal extensions. For additional information regarding classification and identification of MCOs, see Kosman (2010) and Nakamura and Go (2005). 1. The essential ligand set of MCOs consists of two HXH motifs, one HXXHXH motif, and one HCHX3–6H motif. Underlined residues are ligands to the T1 center and all other histidines coordinate the TNC. 2. The number of cupredoxin domains can generally be estimated from the size of the protein: 2dMCOs are approximately 350 amino acids (AA) long, 3dMCOs are approximately 550 AA, and 6dMCOs are generally larger than 1000 AA. The sizes of most characterized MCOs fall within these estimates, but there are some MCO sequences that appear to be exceptions to these rules. These exceptions generally result from C- and N-terminal extensions past the core cupredoxin domains. In these cases, the Conserved Domain Database (CDD) hosted by the National Center for Biotechnology can be used to identify cupredoxin domains. Alternatively, a multiple sequence alignment can be performed with representative 2d, 3d, and 6dMCOs (Marchler-Bauer et al., 2009). In 3dMCOs, the T1 site is always in domain 3. In 2dMCOs and 6dMCOs, the location of T1 site is variable, and thus these MCOs can be further classified on the basis of T1 site location (Fig. 17.1). The T1 center will be located in the domain with the HCHX3-6H and the HXXHXH motifs. 3. Once classified by the number of domains, it is frequently useful for hypothesizing function to further classify MCOs based on unique sequence features. These features may include ligand-rich binding loops (e.g., many type B MCO sequences contain methionine-rich loops), terminal extensions, tower loops, and extensive insertion sequences. Such features are generally discernable by sequence alignment with a structurally characterized MCO containing a similar number of domains.
Detection and Characterization of a Multicopper Oxidase from Nitrosomonas europaea
427
2.2. Detection of BCO in cell lysates Using an in-gel activity assay, BCO can be readily detected from a relatively small number of cells (Fig. 17.2, Scheme 17.1A). Similar methods have been used to detect MCOs from other organisms, including metallooxidases (Goncalves and Steiner, 1996; Kwok et al., 2006). 1. Thaw frozen N. europaea cells and centrifuge for 15 min at 20,000g and 4 C in a preweighed 1.5-ml centrifuge tube. Remove excess liquid and measure the mass of wet cells. Resuspend the cells to 50 mg ml 1 wet weight in a solution containing 20 mM Pipes, pH 6.8, 20 mM NaCl, 1 mM MgCl2, and 10% glycerol.
A
B
TMBD stain
TMBD stain
200 kDa 120 kDa 85 kDa 70 kDa 60 kDa 50 kDa 40 kDa 30 kDa 25 kDa 20 kDa Purified
15 kDa Purified
Lysate 10 kDa Coomassie stain
Lysate
Coomassie stain
Figure 17.2 In-gel activity assays for BCO. (A) Native gel. (B) Partially denaturing gel.
A 4TMBD + O2
4TMBD+(green)/2TMBD2+(yellow) + 2H2O
B 4ABTS + O2 + 4H+
4ABTS•+(blue) + 2H2O
Scheme 17.1 (A) Reaction scheme for in-gel activity assays. (B) Reaction scheme for solution activity assays.
428
Thomas J. Lawton and Amy C. Rosenzweig
2. Using a sonicator equipped with a microtip, lyse the cells using pulses of 1 s on and 3 s off for a total of 3 min on. Cells should be kept in an ice bath during sonication. 3. Centrifuge cells at 20,000g for 1 h at 4 C. For N. europaea, this is sufficient to separate out the majority of insoluble material; for other organisms, 120,000g may be needed. 4. Pipet off the supernatant for later use and discard the insoluble pellet. 5. Electrophoresis can be performed under native conditions or partially denaturing conditions. a. For native gels, two layers of polyacrylamide are poured using a 37.5:1 ratio of acrylamide to bis-acrlyamide at pH 8.8. The top layer contains 4% polyacrylamide and the bottom layer 10% polyacrylamide. Twenty microliters of sample are loaded and run at 150 V in a buffer consisting of 5 mM Tris base and 38 mM glycine, pH 8.3, at 4 C. A solution of 0.2% bromophenol blue in 20% glycerol can also be loaded on the gel to monitor its progress. b. For partially denaturing conditions, two layers of polyacrylamide are poured using a 37.5:1 ratio of acrylamide to bis-acrylamide. The top layer contains 5% polyacrylamide at pH 6.8 and the bottom layer 15% polyacrylamide at pH 8.8. Both layers should contain 0.1% sodium dodecyl sulfate (SDS). The supernatant from step 3 should be combined with an equal amount of solution containing 100 mM Tris, pH 6.8, 4% SDS, 0.2% bromophenol blue, and 20% glycerol. Twenty microliters of this mixture is loaded onto the gel and run at 120 V at room temperature in buffer containing 12.5 mM Tris base, 25 mM glycine, and 0.1% SDS at pH 8.3. Note: do not boil sample or add b-mercaptoethanol. 6. After the gels have finished running, rinse with distilled water and place in 100 ml of 250 mM sodium acetate, pH 5.0. Add 10 ml of a saturated solution of 3,30 ,5,50 -tetramethylbenzidine (TMBD). 7. Allow the gel to develop with gentle agitation until a blue band appears. For highly active or abundant MCOs, the TMBD will be further oxidized to a yellow color. 8. Once the gel is sufficiently developed, it can be stained for heme simply by adding peroxide or stained using Coomassie. For the latter, TMBD should be removed prior to staining by microwaving the gel for 1 min in a solution containing 30% methanol and 10% acetic acid. The gel is then gently agitated until the TMBD is no longer visible. Under partially denaturing conditions, 2dMCOs can be present as a mixture of oligomerization states, with the trimer and dimer displaying activity. The advantage of using native conditions is that 2dMCOs will likely migrate as one band, and activity will be much higher. This technique frequently requires optimization of polyacrylamide concentrations and pH, however.
Detection and Characterization of a Multicopper Oxidase from Nitrosomonas europaea
429
2.3. Isolation BCO is purified from N. europaea. The purification can be followed using the in-gel assay (see above), a solution assay (see below), or simply by monitoring the fractions at 605 nm (T1 absorption maximum). 1. Thaw and resuspend cells of N. europaea in 20–30 ml of a solution containing 20 mM Pipes, pH 6.8, 20 mM NaCl, 1 mM MgCl2, and 10% glycerol. Cells should be roughly 200 mg ml 1 wet weight. 2. Cells are placed in a stainless steel beaker on ice and lysed using sonication pulses lasting 1 s with 3 s off in between pulses. The total time on is 8 min. 3. The lysate is ultracentrifuged at 160,000g for 30 min to remove insoluble material. 4. Crushed (NH4)2SO4 is added to the supernatant with stirring at 4 C to a final concentration of 0.5 g ml 1. 5. The ammonium sulfate solution is ultracentrifuged at 160,000g for 30 min to remove precipitated proteins. 6. A 20 ml Phenyl Sepharose column (GE Healthcare) is attached to an FPLC system capable of monitoring fractions at 605 and 280 nm simultaneously and equilibrated with a solution containing 20 mM Tris, pH 8.0, 10% glycerol, 50 mM CuSO4, 1 mM MgSO4, and 1.7 M ammonium sulfate. The supernatant from step 5 is loaded onto the column, after which the protein is eluted with a solution containing 20 mM Tris, pH 8.0, 10% glycerol, 1 mM MgSO4, and 50 mM CuSO4, over the course of a 280 ml gradient. BCO is typically one of the first proteins to elute. 7. Fractions containing BCO are pooled and dialyzed overnight against 2 l of a solution containing 20 mM Tris, pH 8.0, 10% glycerol, 1 mM MgSO4, and 50 mM CuSO4. 8. The dialyzed protein is loaded onto a 5 ml column containing Q15 ion exchange resin (GE Healthcare) equilibrated with a solution containing 20 mM Tris, pH 8.0, 10% glycerol, 1 mM MgSO4, and 50 mM CuSO4. BCO is eluted from the column with 20 mM Tris, pH 8.0, 10% glycerol, 50 mM CuSO4, 1 mM MgSO4, and 1.7 M (NH4)2 SO4 over the course of a 200 ml gradient. BCO is typically one of the last proteins to elute from this column. 9. Fractions containing BCO are combined and concentrated using a 30 kDa molecular cutoff Amicon UltraTM centrifugal filter. 10. Concentrated BCO is further purified using a Sephacryl S200 gel filtration column (GE Healthcare) equilibrated with a solution containing 20 mM Pipes, pH 6.8, 20 mM NaCl, 10% glycerol, and 1 mM MgCl2.
430
Thomas J. Lawton and Amy C. Rosenzweig
3. Characterization and Crystallization 3.1. Metal content BCO is digested in 5% trace-metal grade nitric acid and filtered to remove precipitate. Copper content is then measured by inductively coupled plasma optical emission spectroscopy, using a calibration curve generated from standards of known concentration for comparison.
3.2. Activity BCO activity is determined by measuring the rate of oxidation of 2,20 azinobis(3-ethylbenzthiazoline-6-sulfonate) (ABTS) (Scheme 17.1B). Activity assays are initiated by adding 35 mg of BCO from a concentrated stock solution of known concentration to 1 ml of solution containing 1 mM ABTS, 20 mM Pipes, and 20 mM NaCl at pH 6.8. The reaction mixture is monitored at 420 nm and the amount of ABTS oxidized is calculated using an extinction coefficient of 36,000 M 1 cm 1. Preparations from our laboratory routinely have an activity of 105.1 mmol min 1 mg 1 protein.
3.3. Crystallization and structure solution BCO rapidly crystallizes using 2-methyl-2,4-pentanediol (MPD) as a precipitant with crystal growth observed in as little as 15 min. Optimal conditions will produce crystals diffracting to 1.9 A˚ resolution belonging to space group P1. These crystals typically take 1 day to form. BCO was crystallized and the structure was solved as follows (Lawton et al., 2009). 1. One microliter of 2.75 mg ml–1 BCO in 20 mM Pipes, pH 6.8, 20 mM NaCl, and 10% glycerol is mixed with 1 ml of 40% MPD, 4% glycerol, and 100 mM Tris, pH 7.5, in a 24-well sitting drop tray (Hampton Research). The reservoir solution contains 500 ml of 40% MPD, 4% glycerol, and 100 mM Tris, pH 7.5. 2. Trays are placed at 4 C and crystals are typically harvested within 24 h of setting up the tray using fresh reservoir solution as a cryoprotectant. Crystals grown at room temperature are highly mosaic and not useful for data collection. Crystals allowed to grow for extended periods of time have a tendency to dehydrate and crack resulting in poor data quality. 3. After indexing, integrating, and scaling using HKL2000 (Otwinowski and Minor, 1997), phases are determined using autoSHARP (Vonrhein et al., 2007) with multiwavelength anomalous dispersion data sets collected at 1.3811, 1.3189, and 1.3476 A˚. Highly redundant data sets are required due to the low symmetry.
Detection and Characterization of a Multicopper Oxidase from Nitrosomonas europaea
431
T1 center T1 center
TNC center
TNC center
Figure 17.3 Crystal structure of BCO (PDB accession code 3G5W). Monomers are shown in different shades of gray. Copper ions are shown as black spheres.
4. The structure is then modeled using COOT and refined with REFMAC (Fig. 17.3) (Emsley and Cowtan, 2004; Murshudov et al., 1997).
ACKNOWLEDGMENTS We thank Daniel Arp and Luis Sayavedra-Soto for support throughout this project. This work was supported by the Agriculture and Food Research Initiative competitive Grant No. 2010-65115-20380 from the USDA National Institute of Food and Agriculture.
REFERENCES Augustine, A. J., Kjaergaard, C., Qayyum, M., Ziegler, L., Kosman, D. J., Hodgson, K. O., Hedman, B., and Solomon, E. I. (2010). Systematic perturbation of the trinuclear copper cluster in the multicopper oxidases: The role of active site asymmetry in its reduction of O2 to H2O. J. Am. Chem. Soc. 132, 6057–6067. Beaumont, H. J. E., Lens, S. I., Reijnders, W. N. M., Westerhoff, H. V., and van Spanning, R. J. M. (2004). Expression of nitrite reductase in Nitrosomonas europaea involves NsrR, a novel nitrite-sensitive transcription repressor. Mol. Microbiol. 54, 148–158. Beaumont, H. J., Lens, S. I., Westerhoff, H. V., and van Spanning, R. J. (2005). Novel nirK cluster genes in Nitrosomonas europaea are required for NirK-dependent tolerance to nitrite. J. Bacteriol. 187, 6849–6851. Chain, P., Lamerdin, J., Larimer, F., Regala, W., Lao, V., Land, M., Hauser, L., Hooper, A., Klotz, M., Norton, J., Sayavedra-Soto, L., Arciero, D., et al. (2003). Complete genome sequence of the ammonia-oxidizing bacterium and obligate chemolithoautotroph Nitrosomonas europaea. J. Bacteriol. 185, 2759–2773. Dispirito, A. A., Taaffe, L. R., Lipscomb, J. D., and Hooper, A. B. (1985). A blue copper oxidase from Nitrosomonas europaea. Biochim. Biophys. Acta 827, 320–326.
432
Thomas J. Lawton and Amy C. Rosenzweig
Emsley, P., and Cowtan, K. (2004). Coot: Model-building tools for molecular graphics. Acta Crystallogr. D60, 2126–2132. Giardina, P., Faraco, V., Pezzella, C., Piscitelli, A., Vanhulle, S., and Sannia, G. (2010). Laccases: A never-ending story. Cell. Mol. Life Sci. 67, 369–385. Goncalves, M. L. F. C., and Steiner, W. (1996). Detection of laccase activity in polyacrylamide gels after electrophoresis under denaturing conditions. Biotechnol. Tech. 10, 667–668. Klotz, M. G., Arp, D. J., Chain, P. S. G., El-Sheikh, A. F., Hauser, L. J., Hommes, N. G., Larimer, F. W., Malfatti, S. A., Norton, J. M., Poret-Peterson, A. T., Vergez, L. M., and Ward, B. B. (2006). Complete genome sequence of the marine, chemolithoautotrophic, ammonia-oxidizing bacterium Nitrosococcus oceani ATCC 19707. Appl. Environ. Microbiol. 72, 6299–6315. Kosman, D. J. (2010). Multicopper oxidases: A workshop on copper coordination chemistry, electron transfer, and metallophysiology. J. Biol. Inorg. Chem. 15, 15–28. Kwok, E. Y., Severance, S., and Kosman, D. J. (2006). Evidence for iron channeling in the Fet3p-Ftr1p high-affinity iron uptake complex in the yeast plasma membrane. Biochemistry 45, 6317–6327. Lawton, T. J., Sayavedra-Soto, L. A., Arp, D. J., and Rosenzweig, A. C. (2009). Crystal structure of a two-domain multicopper oxidase: Implications for the evolution of multicopper blue proteins. J. Biol. Chem. 284, 10174–10180. Marchler-Bauer, A., Anderson, J. B., Chitsaz, F., Derbyshire, M. K., DeWeese-Scott, C., Fong, J. H., Geer, L. Y., Geer, R. C., Gonzales, N. R., Gwadz, M., He, S., Hurwitz, D. I., et al. (2009). CDD: Specific functional annotation with the Conserved Domain Database. Nucleic Acids Res. 37, D205–D210. Messerschmidt, A. (1997). Multi-Copper Oxidases. World Scientific Publishing Company, Inc., Singapore. Murshudov, G. N., Vagin, A. A., and Dodson, E. J. (1997). Refinement of macromolecular structures by the maximum-likelihood method. Acta Crystallogr. D53, 240–255. Nakamura, K., and Go, N. (2005). Function and molecular evolution of multicopper blue proteins. Cell. Mol. Life Sci. 62, 2050–2066. Nakamura, K., Kawabata, T., Yura, K., and Go, N. (2003). Novel types of two-domain multi-copper oxidases: Possible missing links in the evolution. FEBS Lett. 553, 239–244. Nojiri, M., Koteishi, H., Nakagami, T., Kobayashi, K., Inoue, T., Yamaguchi, K., and Suzuki, S. (2009). Structural basis of inter-protein electron transfer for nitrite reduction in denitrification. Nature 462, 117–120. Norton, J. M., Klotz, M. G., Stein, L. Y., Arp, D. J., Bottomley, P. J., Chain, P. S. G., Hauser, L. J., Land, M. L., Larimer, F. W., Shin, M. W., and Starkenburg, S. R. (2008). Complete genome sequence of Nitrosospira multiformis, an ammonia-oxidizing bacterium from the soil environment. Appl. Environ. Microbiol. 74, 3559–3572. Otwinowski, Z., and Minor, W. (1997). Processing of X-ray diffraction data collected in oscillation mode. Macromol. Crystallogr. Pt A 276, 307–326. Quintanar, L., Stoj, C., Taylor, A. B., Hart, P. J., Kosman, D. J., and Solomon, E. I. (2007). Shall we dance? How a multicopper oxidase chooses its electron transfer partner. Acc. Chem. Res. 40, 445–452. Roberts, S. A., Weichsel, A., Grass, G., Thakali, K., Hazzard, J. T., Tollin, G., Rensing, C., and Montfort, W. R. (2002). Crystal structure and electron transfer kinetics of CueO, a multicopper oxidase required for copper homeostasis in Escherichia coli. Proc. Natl. Acad. Sci. USA 99, 2766–2771. Solomon, E. I., Sundaram, U. M., and Machonkin, T. E. (1996). Multicopper oxidases and oxygenases. Chem. Rev. 96, 2563–2606. Solomon, E. I., Augustine, A. J., and Yoon, J. (2008). O2 reduction to H2O by the multicopper oxidases. Dalton Trans. 30, 3921–3932.
Detection and Characterization of a Multicopper Oxidase from Nitrosomonas europaea
433
Stein, L. Y. (personal communication). Stein, L. Y., Arp, D. J., Berube, P. M., Chain, P. S. G., Hauser, L., Jetten, M. S. M., Klotz, M. G., Larimer, F. W., Norton, J. M., den Camp, H. J. M. O., Shin, M., and Wei, X. M. (2007). Whole-genome analysis of the ammonia-oxidizing bacterium, Nitrosomonas eutropha C91: Implications for niche adaptation. Environ. Microbiol. 9, 2993–3007. Taylor, A. B., Stoj, C. S., Ziegler, L., Kosman, D. J., and Hart, P. J. (2005). The copper-iron connection in biology: Structure of the metallo-oxidase Fet3p. Proc. Natl. Acad. Sci. USA 102, 15459–15464. Terzulli, A. J., and Kosman, D. J. (2009). The Fox1 ferroxidase of Chlamydomonas reinhardtii: A new multicopper oxidase structural paradigm. J. Biol. Inorg. Chpem. 14, 315–325. Vlasie, M. D., Fernandez-Busnadiego, R., Prudencio, M., and Ubbink, M. (2008). Conformation of pseudoazurin in the 152 kDa electron transfer complex with nitrite reductase determined by paramagnetic NMR. J. Mol. Biol. 375, 1405–1415. Vonrhein, C., Blanc, E., Roversi, P., and Bricogne, G. (2007). Automated structure solution with autoSHARP. In “Methods in Molecular Biology,” (S. Doublie´, ed.)Vol. 364, pp. 215–230. Humana Press, Inc., Totowa, NJ. Walker, C. B., de la Torre, J. R., Klotz, M. G., Urakawa, H., Pinel, N., Arp, D. J., BrochierArmanet, C., Chain, P. S. G., Chan, P. P., Gollabgir, A., Hemp, J., Hugler, M., et al. (2010). Nitrosopumilus maritimus genome reveals unique mechanisms for nitrification and autotrophy in globally distributed marine crenarchaea. Proc. Natl. Acad. Sci. USA 107, 8818–8823.
C H A P T E R
E I G H T E E N
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea Emily O. Burton* and William J. Hickey*,† Contents 436 436 439 440 440 442 442 442 443 444 445 445 446 448 453
1. Introduction 1.1. Proteomics technologies 1.2. Biological and technical variability 2. Materials and Methods 2.1. Bacterial strain and culture conditions 2.2. Cell harvest and lysis 2.3. Sample preparation and isoelectric focusing 2.4. Second dimension separation: SDS-PAGE of IPG strips 2.5. Image analysis 2.6. Protein identification 3. Results and Discussion 3.1. Chemostat stability and growth data 3.2. Within-sample variability 3.3. Between-sample variability 3.4. Protein identification 3.5. Recommendations for dealing with variability in proteomic studies Acknowledgments References
454 460 460
Abstract Proteomics offers a unique look at the way protein expression changes in response to stimuli, and “gel-based” methods that utilize two-dimensional gel electrophoresis (2-DE) are key technologies in such studies. However, the many steps involved can be technically complex, and the resulting data are subject to variability from both technical and biological sources. Designing 2-DE * Department of Soil Science, University of Wisconsin-Madison, Madison, Wisconsin, USA Molecular and Environmental Toxicology Program, University of Wisconsin-Madison, Madison, Wisconsin, USA
{
Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00018-X
#
2011 Elsevier Inc. All rights reserved.
435
436
Emily O. Burton and William J. Hickey
proteomic studies can be challenging, as a set of standard methods or experimental designs has not been established. This being the case, it is especially important to identify and control sources of variability. Statistically significant results can be obtained if the experimental design includes a sufficient number of replicate 2-DE gels, and if the replicate gels are similar enough to be analyzed in the same experiment. While three or four replicates are often sufficient for compensation of variability, the pilot study illustrated in this chapter showed that statistically significant expression differences could be detected for 90% of the spots matched if six replicate experiments were done.
1. Introduction 1.1. Proteomics technologies As the functional machinery of the cell, proteins offer direct information about the physiological adjustments triggered by a stimulus. By targeting proteins as the analytes rather than DNA or mRNA, proteomics offers unique insights into cellular biology. Protein abundance is controlled by many layers of regulation whose effects can only be discerned at the protein level itself; levels of cellular mRNA do not correlate well with protein abundance data, probably owing to the influence of posttranscriptional regulation, differences in protein stability, and regulated protein degradation (Gygi et al., 1999). Proteomics, or the study of the protein complement of the genome, is particularly useful to the study global control networks like stress response. Cellular protein expression patterns can be compared across different culture conditions, providing a global picture of cellular adjustments. This type of broad coverage is especially valuable for organisms like Nitrosomonas europaea that are difficult to experimentally manipulate at the molecular level. For N. europaea, proteomic information provides a scaffolding of experimental data to help link genetic information to cellular function, to inform genetic exploration, and to guide comparisons with other model organisms. There are two general approaches for proteome analysis: gel-based and gel-free. In the former, which utilize two-dimensional gel electrophoresis (2-DE), proteins are separated prior to quantification and identification. Gel-free methods forgo an initial protein separation step. Instead, protein mixtures are digested, and the resulting peptides are separated by LC and introduced directly to the MS/MS (“peptide-centric” or “bottom-up” approaches). Each method has benefits and limitations, and the focus of this review will be on gel-based approaches. The reader is referred to other sources for reviews of gel-free methods (Choi et al., 2008; Emadali and Gallagher-Gambarelli, 2009; Gouw et al., 2010; Kang et al., 2010; Kito and Ito, 2008; Kocher et al., 2009; Koehler et al., 2009; Lundgren et al., 2010;
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
437
Ow et al., 2009; Phanstiel et al., 2009; Quaglia et al., 2008; Schulze and Usadel, 2010) as well as more in-depth reviews of gel-based proteomics (Baudouin-Cornu et al., 2009; Berth et al., 2007; Chevalier, 2010; Garfin, 2003; Penque, 2009; Righetti et al., 2004; Schroder et al., 2008; Van den Bergh and Arckens, 2009; Vercauteren et al., 2007). Also, an example of a gel-free proteomic analysis of an ammonia-oxidizing bacterium is provided by Wessels et al. (2010) in Part A of this series. By using 2-DE, it is possible to separate complex protein mixtures, compare protein expression quantitatively, and identify individual proteins; protein isoforms can also be identified (Berven et al., 2003; Gygi et al., 1999). For 2-DE, proteins are extracted, dissolved in an appropriate solubilization solution, and then separated via isoelectric focusing (IEF) by their isoelectric points (pI) along an immobilized pH gradient (IPG). The pI range covered by an IPG can be broad (e.g., pH 4–10) or narrow (e.g., a span of 0.1, 1, or 3 pH units). Use of the latter excludes a segment of the proteome but allows increased sensitivity of protein detection over the targeted range. Following IEF, IPG strips are placed atop polyacrylamide gels, and then the proteins eluted by electrophoresis, and separated in the second dimension by molecular weight. The range of physical characteristics displayed by proteins (molecular weight, pI, hydrophobicity, stability of their secondary structures) makes it impossible to solubilize and resolve all of these molecules under a single set of conditions. Different solubilization buffers and electrophoretic separation have been used to target hydrophobic proteins at the expense of the more hydrophilic fraction. Hydrophobic proteins, particularly integral membrane proteins with multiple helical structures, are particularly difficult, and while some progress has been made (Chick et al., 2008; Devraj et al., 2009; Helbig et al., 2010), analysis of these proteins remains a challenge. Sequential solubilization of whole-cell extracts can capture a larger fraction of the proteome than any single solubilization technique (Molloy et al., 1998). A common approach, however, is to solubilize the single most numerous protein fraction, which consists of primarily cytoplasmic proteins. Proteins that are hydrophobic and/or have an alkaline pI are undoubtedly omitted from this analysis. But, when the goal is differential analysis of metabolic states rather than qualitative proteome mapping, the time and expense of doing multiple solubilizations often argue in favor of a single solubilization approach. Visualization of protein spots can be done either by differential labeling prior to IEF and SDS-PAGE or by poststaining gels following 2-DE. The former is referred to as fluorescence difference gel electrophoresis (DIGE, Karp et al., 2008; Minden et al., 2009) and allows multiplex analysis of up to three protein samples (e.g., two metabolic states of interest and internal control) on the same gel. To do so, each protein mixture is labeled with one of three spectrally resolvable cyanine-derived fluorophores (CyDyes).
438
Emily O. Burton and William J. Hickey
The samples are mixed, processed through 2-DE, and then imaged under different wavelengths. Appropriate software (e.g., DeCyder) is then applied to merge the images and analyze differences in fluorescence signals in comigrating spots. Poststaining is most commonly done with a fluorescent dye (e.g., SYPRO Ruby, Flamingo, Deep Purple) or visible stains such as silver nitrate or colloidal Coomassie blue (Karp et al., 2008; Minden et al., 2009). One of the several software packages (e.g., Image Master, Progenesis, PDQuest, Samespots; Maurer, 2006) is then applied for analysis of gel images and subsequent determination of protein abundance (spot volume). Spots of interest can then be excised from gels and identified by mass spectrometry. Each visualization process has its own strengths and weaknesses. The key advantage of DIGE is that differential abundance of a protein is quantified by a within-gel measurement rather than one made between gels, as is the case with all poststaining procedures. This is an important consideration, as intergel variation associated with the latter is a significant source of technical variability. Drawbacks of DIGE are potentially nonuniform protein labeling (e.g., those lacking a free cysteine), the relatively high cost of CyDyes, and the need for a multilaser scanner (e.g., Typhoon 9400). Fluorescent dyes used in poststaining are relatively low cost (compared to CyDyes), and both have good sensitivity (ca. 1 ng) and dynamic range (three to four orders of magnitude). However, these also require a laser scanner for analysis. For silver nitrate or colloidal Coomassie blue, reagent costs are negligible, and gels stained by either technique can be imaged with a standard desktop scanner. However, neither has the dynamic range of fluorescent dyes. Silver staining can provide sensitivity as good or better than fluorescent dyes but is also often accompanied by issues with limited dynamic range (ca. one order of magnitude), high background, and incompatibility with mass spectrometry. Nevertheless, silver staining remains as a widely used technique in 2-DE, and modifications have been developed that can potentially address these limitations (Chevallet et al., 2006a,b, 2008; Nebrich et al., 2007). Ultimately, the type of protein visualization method used would likely be driven by the financial resources available to investigators and their access to laser scanners. Mass spectrometry is typically done by matrix-assisted laser ionization– desorption time of flight mass spectrometry (MALDI-TOF MS or MALDITOF MS/MS) analysis of spots excised from 2-DE gels. The technique generates peptide mass fingerprints (PMF) that can be matched to a protein by using data base search engines such as MASCOT (www.matrixscience. com), ProFound (www.prowl.com), or Protein Prospector (www.prospector.ucsf.edu). There are several excellent reviews on mass spectrometry for proteomics, and the reader is referred to these for further details (Bantscheff et al., 2007; Feng et al., 2008; Nesvizhskii et al., 2007). For the present discussion, the key consideration is the interfacing of the gel visualization/
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
439
imaging process with that of spot picking. Hundreds or thousands of spots may be resolved by 2-DE, and the challenge is often the identification of as many spots of interest as possible. Spot picking can be done manually, or automated and done by robots. Either approach can be used with visible stains, but DIGE or fluorescently stained gels require robotic systems for spot picking. Another consideration is the need for additional staining to either enable spot picking or enhance effectiveness of MS. For example, DIGE gels would typically be poststained with a fluorescent dye to accommodate the imaging system of spot-picking robots and to ensure that robots target the center of the spot mass. The latter is because CyDyes can effect migration of labeled proteins such that centers of these spots are shifted from the mass-center of the protein (Hrebicek et al., 2007). For silver staining, MS-compatible protocols have been developed and, in principle, spots can be picked directly from these gels and processed for MS. However, in practice, inefficiencies in spot picking and recovery of peptides from gel digests may result in poor MS. Thus, as a companion to analytical silverstained gels, Coomassie-stained preparative gels (e.g., 10-fold greater protein load than analytical gel) may also need to be run to provide spots suitable for MS.
1.2. Biological and technical variability Proteomic experiments are subject to both technical and biological variability. Generating statistically significant results requires a sufficient number of biological and technical replicates to compensate for this combined variability. A key element in any proteomic experiment is, at the onset of the study, understanding the type and level of variance in the data and, consequently, creating an experimental design to minimize it to the greatest extent possible. Use of three to four technical replicates is a common starting point and can be adequate with an average level of variability. However, the level of replication needed for any given study is best determined empirically in a pilot study with particular attention to sources of technical variability. As mentioned above, for experimental protocols involving poststaining, one of the greatest sources of variability is intergel variation and its effects on spot matching. Patterns of spot separation produced via 2-DE are never identical between two gels, and a major function of image analysis software is to compensate via “warping” and other procedures to maximize spotmatching between gels. But, inevitably, some fraction of the spots remains unmatched. This component of the data is typically the largest source of technical variability in 2-DE experiments with poststaining, and assessing this variability should be one of the initial goals in a proteomics study utilizing poststaining of 2-DE gels. For example, Molloy et al. (2003) studied variation in 2-DE gels from five different sample types (bacterial, cell culture,
440
Emily O. Burton and William J. Hickey
and mammalian primary culture). When prepared from a single sample, gel pairs had correlation coefficients (R2) ranging from 0.83 to 0.91, and average coefficients of variation (CV) between 18.7 and 26.4. Between-sample variability was greatest for the primary culture samples, with R2 values of 0.55 or less and average CV of 40–50%. Because they are clonal, bacterial and cell culture samples had lower between-sample variation, with average R2 values of 0.74 and 0.78, respectively, and average CVs of 31.2% and 26.0%. Several additional sources of variability that can affect the reproducibility of results were not examined by Molloy et al. (2003). For example, gels in the Molloy study (Molloy et al., 2003) were visualized by using autoradiography or SYPRO Ruby, techniques with good linear dynamic range and relatively simple staining procedures. For reasons noted above, fluorescent stains may not be an option, and silver staining employed as an alternative. But, silver staining involves multiple steps, the timing of which affects the intensity of spot staining (and background development), and can thereby contribute to between-gel variability (Giometti et al., 1991). Another source of variability is differing electrophoresis between SDS-PAGE runs and is a consideration when all replicate IPG strips for a given treatment cannot be accommodated by a single SDS-PAGE apparatus. For example, the SDS-PAGE apparatus used by Molloy et al. (2003) could have accommodated all replicate IPG strips of a given sample in a single run, thus variability between SDS-PAGE runs was excluded from their data. In this chapter, we illustrate an example pilot study for analysis of variability in a 2-DE study of heat shock response in N. europaea. The experiment was done such that it could be accomplished by using materials and equipment likely to be available to any microbiology laboratory; the single specialty instrument being an IEF unit. Based on assessments of within- and between-sample variability, recommendations are developed for the experimental design of in-depth 2-DE studies that would follow. Further information on experimental design and statistical analysis in 2-DE studies is provided in several other excellent reviews (Chich et al., 2007; Diz et al., 2009; Grove et al., 2008; Gustafsson et al., 2004; Horgan, 2007; Hunt et al., 2005; Jacobsen et al., 2007; Jensen et al., 2008; Schroder et al., 2008, 2009; Valcu and Valcu, 2007; Wheelock and Goto, 2006; Wu et al., 2009).
2. Materials and Methods 2.1. Bacterial strain and culture conditions N. europaea ATCC 19781 was obtained from the American Type Culture Collection (ATCC, Manassas, VA) and grown in ATCC Medium 221 in continuous culture. Continuous culture runs were inoculated from frozen stocks of N. europaea that were grown in 100 mL of Medium 221 until they
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
441
had acidified their media twice (as indicated by cresol red included in the medium). After each acidification, the culture was adjusted to pH 7.1 with 30% (w/v) K2CO3. The culture was then centrifuged, and the concentrated cell suspension was injected into a 2-L capacity BioFlo 110 Modular Benchtop Fermentor (New Brunswick Scientific Co., Edison, NJ). The culture was then grown in batch mode until it became turbid, at which point medium and effluent pump rates were increased stepwise to 50 mL/h (a dilution rate of 0.025/h). The continuous culture vessel was covered with black plastic and maintained at 25 C. Automatic addition of 30% (w/v) K2CO3 maintained the medium pH between 7.0 and 7.1. Sterile air was sparged into the vessel at a rate of 1 L/m, and an impeller provided agitation through constant stirring at 100 rpm. Dissolved oxygen (dO2) was monitored and automatically adjusted to ca. 5 mg/L (60% of the air saturation level at 25 C). The culture was sampled aseptically into sterile serum vials, and culture purity was monitored by plating samples of chemostat effluent onto 1/10 nutrient broth plates. Absence of colonies after 1 week was evidence of a lack of heterotrophic contamination. Culture growth and activity were monitored daily by measuring optical density at 600 nm (OD600) and by recording dO2 levels in the culture vessel. Samples of culture supernatant were taken daily for analysis of nitrite by using a modified Griess–Ilovsay nitrite assay (Mulvaney, 1996). Stability of the culture in steady state growth was determined statistically by calculating a coefficient of sequential variation as described by Keen and Prosser (1987). In the study by Keen and Prosser (1987), ammonium concentrations over at least five generations were measured to calculate a coefficient of sequential variation (w), calculated from the equation: sffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffi ffi Pn1 ð x = x Þ x = x i ðiþ1Þ i¼1 w¼ n1 where n is the total number of measurements and x and x are nitrite concentrations and their mean. Values of 0.2 for w were indicative of a steady state in their system when nonautomated ammonium assays were used. In the present study, the nitrite assay was more reliable than the ammonia assay, so the coefficient of sequential variation was calculated using effluent nitrite concentrations. Nitrite data over 11–14 days was used for analysis, and represented more than nine generations, as calculated using the equation: g¼
0:693 k
where g is generation (doubling) time and k is the specific growth rate (h 1). In a continuous culture system at steady state, k is equal to the dilution rate
442
Emily O. Burton and William J. Hickey
(Neidhardt et al., 1990). A coefficient of sequential variation of 0.2 for data collected over 11–14 days was evidence that a steady state had been reached.
2.2. Cell harvest and lysis To prepare protein samples, harvested cultures were spiked with chloramphenicol (20 mM) and then centrifuged (5000g, 20 min, 4 C). The cell pellet was washed twice in a solution of 40 mM Tris base, 20 mM chloramphenicol, and freshly added protease inhibitor cocktail (Complete, RocheDiagnostics, Mannheim, Germany). The washed cells were resuspended in 750 mL lysis solution (8 M urea, 40 mM Tris base, 4% CHAPS) (Berkelman and Stenstedt, 1998). The suspension was incubated with endonuclease (Omninase, Epicentre Technologies, Madison, WI) for 15 min at room temperature, then disrupted by sonication (Labsonic 2000, B. Braun Biotech, Allentown, PA) on ice, 5 20 s at 40 mW. After centrifugation (18,000 rpm, 15 min), the supernatant was reserved and stored at 20 C until use. Protein concentrations were determined using the RCDC assay (Bio-Rad, Hercules, CA).
2.3. Sample preparation and isoelectric focusing Protein samples were diluted to 0.44 mg/mL in rehydration solution (8 M urea, 2% CHAPS, trace bromophenol blue, 0.5%, pH 4–7, carrier ampholytes (GE Healthcare Life Sciences, Piscataway, NJ)) with 18 mM freshly added dithiothreitol (DTT) (Berkelman and Stenstedt, 1998). After incubation at room temperature for 1 h, samples (150 mg protein in 340 mL total volume) were applied to IPG strip holders (GE Healthcare Life Sciences), and IPG strips (ReadyStrip 17 cm, pH 4–7, Bio-Rad) were placed on top. Strips were overlaid with 1 mL mineral oil and then covered. Strip reswelling occurred through in-gel rehydration at 20 V for 10–12 h at 20 C. IEF (IPGphor, GE Healthcare Life Sciences) was done in step-n-hold mode at 500 V for 1 h, 1000 V for 1 h, and 8000 V for 9 h, for an average total of 72,000–74,000 V h. Focused IPG strips were stored at 20 C until use for SDS-PAGE separation.
2.4. Second dimension separation: SDS-PAGE of IPG strips A Protean II XL cell with a two-gel capacity was used for 2-DE (Biorad). Gels (4% stacking gel, 12% resolving gel, total dimensions 18.5 20 cm) were hand-cast. Prior to SDS-PAGE, IPG strips were incubated in equilibration buffer (1.5 M Tris–Cl, pH 8.8, 6 M urea, 30% glycerol, 2% SDS, and trace bromophenol blue Berkelman and Stenstedt, 1998) with 1% freshly
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
443
added DTT for 15 min, and then in equilibration buffer with 2.5% freshly added iodoacetamide for 15 min. Next, the equilibrated strips were rinsed in electrophoresis buffer (25 mM Tris base, 192 mM glycine, 0.1% SDS), then placed onto the polyacrylamide gels, and overlaid with molten agarose sealing solution (0.5% low melting point agarose and trace bromophenol blue in electrophoresis buffer). Gels were run in a continuous buffer system at a constant current of 11 mA per gel for the first hour, then at 15–16 mA per gel for 5 h, or until the dye line was 1 cm from the bottom of the gel. Gels were stained with silver nitrate using an adaptation of the method of Blum et al. (1987). Glassware was acid washed and rinsed in distilled, deionized water; all reagents were freshly prepared in distilled, deionized water. Staining was done with gentle, constant shaking. Gels were fixed overnight in a solution of 40% ethanol and 10% acetic acid and then sensitized for 20 min (30% ethanol, 0.125%, w/v, glutaraldehyde, 0.2%, w/v, sodium thiosulfate, and 6.8%, w/v, sodium acetate). After three 5 min washes in water, gels were incubated in silver reaction solution (0.25% [w/ v] silver nitrate, 0.015% [w/v] formaldehyde) for 20 min. Gels were washed in water twice for 1 min and then developed (2.5% [w/v] sodium carbonate, 0.0075% formaldehyde). Development was stopped (1.5% [w/v] EDTANa2-2H2O) once stain intensity was sufficient. This usually occurred after between 2.5 and 3 min development. Gel images were captured the same day using a PowerLook III scanner (UMAX, Dallas, TX) in transmission mode at 300 dpi.
2.5. Image analysis Gel images were analyzed using ImageMaster 2D software (version 4.01; GE Healthcare Life Sciences). Spots were detected automatically with manual spot editing. Background subtraction was done using the mode of nonspot option with a margin of 90. Gels in an experiment were all matched to a reference gel (a duplicate of one of the gels in the experiment). Spots not present on the reference gel were added if necessary. Spots were matched by manually selecting match seeds, which were used as reference points for further automatic matching. Match seeds help correct for shifts in spot patterns due to separation differences in the first- or second dimension. To optimize automatic matching, more than 50% of the matched spots in gels were matched manually. After spot matching, spot volumes were normalized according to the total spot volume option in the ImageMaster 2D software. Individual spot volumes were divided by the total spot volume in the gel and then multiplied by the total spot area; this step helps compensate for differences in the
444
Emily O. Burton and William J. Hickey
number of spots and in spot intensity between gels. Averaged gels were created to pool gels for comparison; averaged gels use the image of a single, representative gel but report the mean values for spot volume for all of the gels in the set. Only those spots present in all gels in the averaged set were included in the average gel. The CV of averaged spots were reported by the ImageMaster 2D software. Further statistical analyses were made using Excel (Microsoft, Redmond, WA) or JMP (version 5; SAS Institute, Cary, NC).
2.6. Protein identification Preparative 2-DE was done for protein identification. Procedures were as described above, except that IPG strips were loaded with up to 1 mg of protein, and SDS-PAGE gels were stained using Coomassie R-250. Spots of interest were excised from duplicate preparative gels, diced, and then the gel pieces placed in the well a MultiScreenTM Solvinert Filtration System (Millipore, Bedford, MA) connected to a MultiScreenÒ Resist Vacuum Manifold (Millipore); this system allowed solutions to be changed by filtration rather than centrifugation. The gel pieces were first destained by three washes with 200 mL of 25 mM ammonia bicarbonate (ABC)/50% (v/v) methanol and dehydrated with 200 mL 50% (v/v) 25 mM ABC/50% (v/v) acetonitrile (ACN), and 100 mL of 100% ACN. Proteins were reduced with 100 mL of 10 mM dithiothreitol in 25 mM ABC for 1 h at 56 C, washed with 150 mL ABC, and alkylated (carboxymethylated) at room temperature in the dark with 100 mL of 25 mM indole acetic acid (Sigma, St. Louis, MO) in 25 mM ABC. Proteins were then dehydrated as described above and digested (37 C, overnight) with sequencing-grade Trypsin (Promega, Madison, WI) in Trypsin buffer (Promega) with 2% (v/ v) ACN (1/50, wt/wt, enzyme/protein extract). Digests were quenched with 50 mL of 0.1% (v/v) trifluoroacetic acid (TFA; Fisher Scientific, Pittsburgh, PA). The tryptic peptides were then extracted in 50 mL of 70% (v/v) ACN, 25% (v/v) ddH2O, and 5% (v/v) TFA, and the extracts were dried under vacuum and then dissolved in 10 mL of the latter buffer. To generate a PMF, a sample aliquot (0.5 mL) was spotted on a support plate and then mixed with 0.5 mL of matrix solution (20 mg/mL 2,5dihydroxybenzoic acid in 50% ethanol/50% water). Samples were then ionized and mass spectra collected by using an Applied Biosystems/MDS SCIEX 4800 MALDI-TOF/TOF (Applied Biosystems, Foster City, CA). Identifications based on PMF were made by using Mascot software (Matrix Science, London, UK; Perkins et al., 1999) to search a database of the translated genome of N. europaea, as well as the National Center for Biotechnology Information database. In accordance with Mascot guidelines, identifications were considered significant (p < 0.05) if their Mascot score was greater than 67.
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
445
3. Results and Discussion 3.1. Chemostat stability and growth data Bacteria growing in batch culture are exposed to a continuously variable environment, with fluctuations in nutrient availability, pH, cell density, and growth rate. To reduce this variability in this study, N. europaea was grown in continuous culture. Preliminary experiments were done to determine an appropriate dilution rate for cultures used for proteomic analysis. Growth was stable (based on measurements of optical density) at a dilution rate of 0.00868 h 1. When the dilution rate was increased to the maximum reported in the literature (Keen and Prosser, 1987), 0.035 h 1, the OD600 of the culture decreased less than 20% over 6 days and five volume replacements. A dilution rate of 0.025 h 1 was selected to provide a growth rate below the maximum growth rate of the continuous culture, yet assumed to be fast enough to prevent induction of physiological changes associated with slow growth. The continuous culture was brought to steady state three times (Table 18.1). Between 49 and 66 days were required between inoculation and development of the steady state. Nitrite levels, averaged over an 11- to 14-day period, ranged from 23.7 3.5 to 25.8 2.9 mM NO3–N. This was approximately 50% of the initial NH4þ–N concentration in the medium (45.4 mM NH4þ–N). While nitrite levels were not significantly different between cultures, steady state optical density varied by as much as 50%. This indicates that, despite the controlled growth environment of the chemostat, there may have been differences in cell activity. At least part of these differences may be attributed to the thin biofilms that formed inside the vessel after prolonged culturing. These biofilm cells may have contributed to the overall activity of the cultures. In addition, detached biofilm cells may have been Table 18.1 Continuous culture stability data
a
Coefficient of variation (w)
Optical density (600 nm)
Average NO2–N (mM)a
Protein sample concentration (mg/mL)
1
0.15
0.09
23.7 3.5
2
0.15
0.07
25.8 2.9
3
0.06
0.06
25.1 3.4
Base state: 7.4 Heat shock: 6.7 Base state: 5.2 Heat shock: 4.0 Base state: 7.9 Heat shock: 6.6
Averaged over 14 d (2 and 3) or 11 d (1).
446
Emily O. Burton and William J. Hickey
included in the planktonic cells harvested for protein sample preparation. The influence of these sessile cells on resulting protein patterns and the extent to which this effect differed between cultures are unknown.
3.2. Within-sample variability Variability can be introduced to 2-DE images from the same sample during IEF, SDS-PAGE, and silver staining. To determine the extent of this technical variability, six gels were run of the same sample (Fig. 18.1). Of these, four were sufficiently alike to be compared by using ImageMaster software. Three of the gels analyzed were separated in the same IEF run, and another was separated in a second run. The remaining two gels, from a third SDS-PAGE run, were omitted because gel differences did not allow for good spot matching. Although the operational parameters of this SDSPAGE run were the same as the others, the spot patterns had migrated farther down the gel, making matching difficult. As a general observation, these types of differences in SDS-PAGE runs were a major source of within-sample variability. The four gels were analyzed using ImageMaster 2D and the statistical analysis program JMP. Spots were automatically detected and manually edited when necessary. Spot matching was done automatically with extensive manual seeding as a guide. The total number of spots detected in the gels ranged from 486 to 593 (Table 18.2). SDS-PAGE batch 1
sonicated cells
sample preparations
IEF
1.1
1.2
SDS-PAGE batch 2
1.3
2.3
SDS-PAGE batch 3
2.1
2.2
Figure 18.1 Design of replicate variability experiment. A single sample of sonicated cells was separated in the first dimension in two IEF runs of three IPG strips each. Strips were then separated in three SDS-PAGE batches. Shaded gels were used in the variability analysis.
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
447
Table 18.2 Comparison of spot number and staining intensity for replicate gels Gel
Total spots
Total area (pixels)
Total volume (arbitrary units)
1.1 1.2 1.3 2.3
486 506 593 517
79719 85446 141771 118635
12396000 7235000 1005400 9195000
An averaged gel, containing only spots matched among all four gels, had 333 spots. The average CV of the background for each spot was 76%, the most highly variable factor in the gels. This suggested that background from silver staining was an important source of variation. Automated background detection may also contribute to background variation. Background detection done by using ImageMaster 2D software has been shown to increase quantitative errors in spot volume data for gels stained with colloidal Coomassie (Mahon and Dupree, 2001), which produces very low background. In the present study, silver staining produced background that was relatively high, and which varied between regions of the gel, making background subtraction necessary. The average CV of spot volumes, corrected for background, was 45%. Spot volumes were also normalized to compensate for differing stain intensity between gels. In this process, spot volumes were normalized for each constituent gel by multiplying by the ratio of the total spot volume to the total spot area of the gel. The average CV for normalized spot volumes was 38%. Evidence for unequal stain intensity was found in measurements of the total spot volume and spot area for each gel. Although gels were loaded with the same mass of protein, the amount visualized and the overall spot intensity differs (Table 18.2). Total spot area increases with spot number, as would be expected, but total spot volume tends to decrease with increasing spot number. It may be that spot finding was slightly less effective in more intensely stained gels, resulting in the trends observed. Linear correlations of normalized spot volumes for matched spots were used to assess the similarity of replicate gels (Table 18.3). Identical gels would have an R2 and slope of one; deviation indicates variability between gels. Molloy et al. (2003) report an average R2 of 0.83 for replicate gels of Escherichia coli visualized by autoradiography, which is within the range of 0.80–0.94 observed in this study. Differences in spot intensity were expressed as CV. The average CV for spots matched between gel pairs in the Molloy study was 24 20%. A broader survey of published variability data found that technical variation is generally in the range of 20–30% CV (Molloy et al., 2003). In the present study, the average CV was 37.7 20.6%. The slopes of the correlation lines for gel pairs averaged
448
Emily O. Burton and William J. Hickey
Table 18.3 Pairwise comparisons of the normalized spot volumes of replicate gels Gel
Slope
R2
1.1 by 1.2 1.1 by 1.3 1.1 by 2.3 1.2 by 1.3 1.2 by 2.3 1.3 by 2.3 Average
0.90 0.76 0.79 0.97 0.93 0.95 0.88 0.09
0.86 0.80 0.83 0.89 0.85 0.94 0.86 0.05
0.88 0.09. Differences in silver stain intensity may have accounted for differences in the slopes of the fit lines observed (Smales et al., 2003).
3.3. Between-sample variability Variability between replicate samples comprises the baseline technical variability discussed above, as well as additional levels of technical variability stemming from sample preparation steps, and from biological differences between cultures and treatments. To identify the biological variation in spot number and expression that was induced by experimental treatments, the effect must be distinguished over the technical variation for an experiment with a given number of replicates. In the present study, two base state (unstressed) and two heat-shocked samples were prepared from two independent steady state continuous cultures, providing four gels for comparison (Fig. 18.2). A third set of samples was not included because spot patterns did not correspond well with the other samples, an effect that was attributed to the batch of lysis solution used. All the samples tested were separated in independent IEF. Two were electrophoresed in the same SDS-PAGE batch, and the other samples were run in separate experiments. Averaged gels were created for each treatment (Table 18.4). The averaged gel from the base state treatment had 165 spots, and the averaged heat shock gel had 164 spots. Of these spots, 116 were matched between the two averaged gels and analyzed for protein expression differences between treatments. The 49 spots that were not matched between the averaged gels were visually inspected to confirm valid presence/absence differences. There were no spots unique to the heat-shocked sample that had both low within-treatment variability (CV 30%) and a high enough spot volume for reliable detection and eventual identification by mass spectrometry ( 300 volume units). In the base state treatment, seven spots satisfied these criteria. But, after a visual check, all these were judged to be spots that were extremely small, faint, or of dubious match quality.
449
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
SDS-PAGE
IEF
base state
Base 1
Heat 1
heat shocked
chemostat run 1
Base 2 base state
heat shocked
Heat 2
chemostat run 3 Figure 18.2 Design of experiment to compare protein expression between samples and between treatments. Steady state chemostat cultures (see Table 18.1) were harvested, and base state (unstressed) or heat-shocked cells (shaded) were separated in independent IEF runs. Gels from the first experiment were run in the same SDS-PAGE batch. Gels from the second experiment were electrophoresed separately. Table 18.4 Matched and total spots for base state and heat-shocked gel comparison Gel
Total spots
Spots matched to reference gel
Base state 1 Base state 2 Averaged base Heat 1 Heat 2 Averaged heat
327 291 165 303 419 164
228 231 165 301 239 164
For the base state treatment, the average CV of normalized spot volumes was 45 38%. The heat shock treatment had an average CV of 49 36%. For gels paired by treatment, R2 values were 0.69 for base state and 0.59 for heat shock. Correlations between gels originating from the same culture but different treatments were 0.44 for harvests of chemostat runs 1 and 3, respectively. For clonal samples (bacteria and mammalian cell lines, visualized with autoradiography and fluorescent stains, respectively), Molloy et al. (2003) found an average CVs ranging from 24 18.3% to 31 20% and an average R2 from 0.74 to 0.78 between experiments.
450
Emily O. Burton and William J. Hickey
For proteomic studies using 2-DE, twofold protein expression difference cutoffs are often used to identify proteins of interest (Molloy et al., 2003). The error involved in using a two- or threefold cutoff in the present study can be estimated by comparing protein expression between gels from the same treatments but different cultures. More than 16% of the protein spots matched between the base state gels had a threefold expression difference, and 35% had a twofold difference. For the heat-shocked gels, 27% of the matched spots had a threefold expression difference and 45% had a twofold expression difference. These values give an estimate of the Type II (false positive) error to be expected at these expression thresholds due to between-sample variability. In Zhan and Desiderio’s (2003) study using silver-stained gels, the average changed-fold difference in normalized spot volume for paired gels ranged from 1.94 2.01 to 2.85 7.09. Values like these highlight the need for statistical validation of protein spots expression differences. In the present study, the base state and heat-shocked averaged gels were compared, and 10 spots had threefold expression differences between treatments. The spots were visually inspected; two were found to be legitimate spots, and eight could not be verified due to poor spot quality (e.g., very small or poorly visualized spots) or high variability within treatments. Of the two legitimate spots, one had increased expression in the heat shock treatment and was later identified as a heat shock protein by MALDI-TOF MS. The other, which was not identified, had decreased expression after heat shock. According to Molloy et al. (2003), in experiments with clonal samples and average technical variability, three to four replicates are sufficient to make a twofold cutoff statistically significant with a confidence of 80% power and 0.05 p-value. For more highly variable samples like primary cultures, eight replicates or more may be needed to reach the same level of statistical significance. Molloy et al. (2003) computed sample size using variation values that had been averaged over the entire spot set, and in doing so assumed equal variance among all protein spots. No data were given regarding the distribution of CVs in their experiments, so this assumption cannot be evaluated. Other researchers have reported a normal distribution of CVs for spots in their proteomic experiments. Asirvatham et al. (2002) examined 10 Coomassie-stained gels from a single sample of leaf tissue and 10 from independent samples. From these, they selected for analysis the 50 spots that could be matched automatically across all 10 gels in a set (the total automatic matching success between gels was about 90%, and between all 10, it was about 10%). Because these 50 spots spanned a range of pI and MW values and their CVs had a normal distribution based on a w2 test (p-value 0.05), they were considered representative of all the protein spots visualized. Assessments of variability using average CV values can be quite useful in identifying sources of variability and in comparing variability between studies. However, analyses based on average CV values can also be problematic if the assumption of equal variance is not supported by the data.
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
451
In the present study, the CVs observed in the averaged gels did not follow a normal distribution for either the heat-shocked or base state treatments (KSL test p-value > 0.05, Fig. 18.3). The range in variability of spot volumes could increase the probability that proteins with real expression differences between treatments would be excluded from analysis due to poor match quality. Highly variable proteins could also provide false-positive presence/absence differences if spots are not matched between treatments. Error for highly variable, matched spots could also occur if these spots have large random expression differences. Finally, spots with low variability could escape detection if their genuine expression differences
1.4
A
B
C .01 .05.10 .25 .50 .75 .90.95 .99
1.2
Base state
1 0.8 0.6 0.4 0.2 0 1.4
A
B
-3 -2 C
-1
0
1
2
3
.01 .05.10 .25 .50 .75 .90.95 .99
Heat shock
1.2 1 0.8 0.6 0.4 0.2 0
-3
-2
-1
0
1
2
3
Figure 18.3 Distribution of CVs for spots matched between base state and heatshocked gels. (A) Distribution histogram: CV values are along the y-axis; the x-axis corresponds to the number of observations. (B) Box plot. The ends of the box are the 25th and 75th quantiles, and the line across the box is the median. The diamond is centered on the mean and extends to the 95% confidence interval. Tick marks at left identify the most dense 50% of the observations. Whiskers extend from the quartile edge to 1.5 the interquartile range. (C) Normal quantile plot. CV values are along the y-axis; the x-axis shows expected normal scores for each value. Normally distributed data would align along the straight line and within the confidence bounds. At top is a probability scale.
452
Emily O. Burton and William J. Hickey
were below the significance cutoff selected based on pooled CV values. A nonnormal distribution of variability among protein spots may not be unusual. Although normality was not tested in studies by Zhan and Desiderio (2003) or Mahon et al. (Mahon and Dupree, 2001), in both cases, the CV distribution appears to be skewed; Zhan and Desiderio’s (2003) changed-fold expression data have a distribution similar to the one found in the present study, and in the Mahon et al. (Mahon and Dupree, 2001) study using colloidal Coomassie-stained gels, the mean CV in gel-togel experiments was 32%, but the a median of the data was 18%. Due to the unequal variance observed for spots in the present study, the sample size necessary for significance with 80% power and p-value 0.05 was calculated for each spot. If a threefold expression cutoff is selected, 75% of the protein spots could be analyzed with three replicates; however, more than six replicates would be needed to reduce the error rate of the entire analysis to below 10%. Running large numbers of gels to achieve significance for every spot analyzed is not practical. Instead, it may be more useful to run experiments with three to four replicates and then attempt to exclude highly variable proteins from analysis. For example, in an experiment with two replicates, spots with a CV of 0.24 would be significantly different (power 80%, p-value < 0.05) if expression differed by twofold between treatments. To look for significant differences in spots with low variability, 30 spots were selected that had CVs < 0.3 in both treatments. Of these, eight were eliminated after a visual check. One had already been flagged as significantly different using a threefold expression cutoff, and none of the rest had significant expression differences. The 50-spot data set used by Asirvatham et al. (2002) was not selected randomly but by automated spot matching. Matching software can only be expected to match spots that were present and well detected in all 10 gels, which would tend to eliminate more variable spots from the analysis. Therefore, although the investigators observed that this sampling had a normal distribution and included spots from a range of pI and MW, the dataset may not be representative of the larger population. In the present study, the CVs for all matched protein spots (using automatic and manual matching) are reported. More than 50% of the visualized spots from each gel could be included in the analysis. The skewed distribution of spot volume CVs observed in the present study may therefore reflect the use of a broader, more unbiased spot sample than Asirvatham et al. (2002). Finally, while Asirvatham et al. (2002) used Coomassie to stain their gels, silver staining was used in the present study. Silver staining has a linear response to most proteins, but 39–46% of proteins have a significantly nonlinear staining profile (p < 0.01; Mahon and Dupree, 2001). Silver staining can also introduce different levels of variability to spots depending on their composition and volume. Smales et al. (2003) found that the CV of silver-stained spots decreased slightly with increasing spot volume, but
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
453
protein-specific staining differences led to considerable deviations from this relationship. At least part of the volume dependence of variability is likely due to spot finding and image analysis rather than staining; Mahon et al. (Mahon and Dupree, 2001) observed the same volume–CV relationship in a study using Coomassie-stained gels. To compensate for unequal spot variance, Smales et al. (2003) recommend that individual spot CVs be used to evaluate expression differences rather than an average value. Silver staining may also introduce more generalized variability. In contrast with Coomassie or fluorescent stains like SYPRO Ruby, which can run to completion without overstaining the gel, silver staining must be terminated before high-volume spots become oversaturated, obscuring faint spots. Silver staining relies on freshly made reagents and has many timesensitive steps, each of which can affect the final result. In the present study, even when gels were stained simultaneously in the same vessel, differences in background and spot intensity were observed (data not shown). Finally, in this chapter, terminating the development step at the same time for every gel did not result in equal stain intensity (data not shown); optimal development was instead gauged visually, as has been reported elsewhere (Dutt and Lee, 2001). Differences in the physical properties and cellular location of proteins are important to help explain the variance distribution observed. For example, while certain proteins may be solubilized readily (and therefore exhibit little variation), the solubilization of hydrophobic or membrane-associated proteins may be quite dependent on the success of the sonication step. Small variations during sonication could therefore affect just a subset of the proteins analyzed. Similarly, hydrophobic proteins are uniquely susceptible to solubilization problems during IEF due to interactions with IPG strip materials (Molloy et al., 2001). Independent of hydrophobicity, some proteins may be more reliably reduced and/or alkylated than others. Other problematic proteins may exist in complexes that can be separated and solubilized with different levels of effectiveness. Finally, different proteins have different staining profiles with silver staining (Giometti et al., 1991), and certain protein types, such as glycoproteins, are not sensitively stained by silver (Westbrook et al., 2001). Given the range of physical properties of proteins and the many steps involved in preparing samples for 2-DE, it would be surprising if the CVs of all proteins analyzed were distributed normally around their mean.
3.4. Protein identification Protein spots to be identified by mass spectrometry were chosen based on expression differences observed between treatments but within a single experiment. Of 16 spots analyzed, 10 had significant identifications (Mascot scores > 67, p-value < 0.05) and another had nonsignificant but possible
454
Emily O. Burton and William J. Hickey
matches to two different N. europaea proteins (Table 18.5). Six clustered spots were identified as a single protein, the general diffusion Gram-negative porin encoded by NE2563 (Fig. 18.4). Under conditions used in 2-DE, single proteins, particularly those with stable secondary structures, can exist in an equilibria between several conformational isoforms and produce multiple spots (Berven et al., 2003). The porin cluster was a major feature of some 2-DE gels, but intensity of its component spots varied independently of treatment. Besides the porin, two other identified proteins were also predicted to be localized in the outer membrane, Pal and a member of the OmpA family. A heat shock protein and a hypothetical protein were predicted to be cytoplasmic. Of the identified proteins, only the heat shock protein had a significant increase in expression in the heat shock treatment. A second, unidentified protein had a significant decrease in expression following heat shock (spot “A,” Fig. 18.4). One of the two spots with significantly different expression between treatments is Hsp20, a heat shock protein in the alpha-crystallin protein family. Related proteins have been detected in other proteomic studies of stress response (Betts et al., 2002). Identification of this spot as a heat shock protein helps verify that the methods used in this study are capable of detecting biological differences between treatments.
3.5. Recommendations for dealing with variability in proteomic studies Choe et al. (Choe and Lee, 2003) developed a method by which to quantify between-gel variability (Fig. 18.5). They suggested that this experimental design be used for preliminary studies of between-gel variability. Preliminary work of the type they suggest could be invaluable; however, based on findings from the present study, it may not be sufficient to quantify all the variability that may be encountered. For example, the Choe et al.’s (Choe and Lee, 2003) experimental design does not provide information about gel reproducibility between SDS-PAGE batches or the effects of staining or image analysis on variability. They also did not take into account betweensample variation that is not due to treatment. In the present study, greater variability was observed between gels from samples from the same treatment but different cultures than gels from the same sample. This variability could have been introduced during sample preparation or attributed to biological differences between cultures, factors that are not tested by Choe et al. (Choe and Lee, 2003). In addition, in the Choe et al. (Choe and Lee, 2003) study, variability due to differences in sample load (as tested by their “Var Load” experiment) was quite similar to variability observed between gels separated in the same IEF run; therefore, it seems likely that the experiment could be streamlined by omitting the “Var Load” test.
Table 18.5 Proteins identified by mass spectrometry Mass (kDa)a
pIa
Average normalized volume (arbitrary units), CV
Mascot score, sequence coverage
420, 54% base 654, 54% heat
73, 61%
19.0 16.60
19.1
4.87 4.760
4.47
16, 118% base 113, 129% heat
73, 17%
24.9 21.80
17.8
5.23 4.830
4.3
227, 133% base 396, 91% heat; 360, 66% base 522, 60% heat; 575, 59% base 822, 81% heat; 473, 76% base 632, 52% heat; 36, 82% base 120, 62% heat; 67, 119% base 138, 63% heat; 83, 51% base NE2074, hsp20b Heat shock hsp20 (alpha-crystallin) 1758, 1% heat proteins family Cytosolic
69 31% 91 29% 70 31% 68 25% 71 23% 72 17%
42.9 40.60
31.134.5
5.29 5.180
4.5-4.7
68, 43%
15.9
14.7
5.5
5.8
Locus, gene name, description
NE0219, pal Bacterial outer membrane protein OmpA family NE2548 Bacterial outer membrane protein OmpA family NE2563 General diffusion Gram-negative porins General bacterial porin family (GBP): OmpF, OmpC, PhoP
Nominal Observed Nominal Observed
(continued)
Table 18.5 (continued)
Locus, gene name, description
NE0122 hypothetical protein CRISPR/Cas-associated protein Predicted cytosolic NE0642, hisI Phosphoribosyl-AMP cyclohydrolase Cytosolic or extracellular; likely cytosolic or NE0028, groEL Tailless complex polypeptide-1/ cpn60 chaperonin family Cytoplasmic a b
Mass (kDa)a
pIa
Average normalized volume (arbitrary units), CV
Mascot score, sequence coverage
Nominal Observed Nominal Observed
36, 121% base 142, 65% heat
68, 39%
14.8
16.5
9.1
4.7
343, 68% base 373, 30% heat
40, 48% or 36, 10%
14.7 or 57.4
16.7
7.74 or 5.15
4.9
Values are predicted from the genome. When a predicted cleaved signal sequence was present, the pI and mass for the signalless peptide were predicted and indicated with a prime symbol. Increase in expression in heat-shocked gels was significant (p < 0.05).
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
457
NE2563 A*
NE0219 NE2548
NE0642 or NE0028 NE0122 NE2563*
Figure 18.4 Locations of proteins identified by MALDI-TOF MS. Starred proteins had significant (p < 0.05) expression differences between base state and heat-shocked treatments. Spot A had a significant decrease in expression in heat-shocked gels but was not identified. Gene descriptions are provided in Table 18.5.
While studies of within-sample variation like that proposed by Choe et al. (Choe and Lee, 2003) can be used to find sources of error, they can underestimate the variation observed in experiments comparing a number of treatments. An alternative experimental design to samples that are processed independently at every level of the 2-DE method (Fig. 18.6) can be used to simulate the maximum between-sample variability likely to be encountered in an experiment where samples are processed completely independently. For the present study, statistically significant expression differences could be detected for 90% of the spots matched if six replicate experiments were done. This information was critical as it highlighted a potential problem with the experimental system; namely, that the relatively long period required for culture growth and inherent limitations of image analysis may have been impractical to attain the targeted level of replication. For experiments where all samples to be compared can be processed in a single IEF or SDS-PAGE batch, a corresponding adjustment in the design of this preliminary experiment would be appropriate. The objective is to simulate the maximum between-sample variability likely to be encountered in the final experiment. This is important because distinguishing
458
Emily O. Burton and William J. Hickey
lysate aliquots
sample preparation
IEF
4 Prep
cells
1 Prep
130% normal sample load 70% normal sample load
Var Load
Figure 18.5 Experimental design to test for gel-to-gel variability proposed by Choe and Lee (2003). A single sample is divided into aliquots and then to IPG strips, which are run in parallel within each of the three experiments (4 Prep, 1 Prep, and Var Load). Batch information for SDS-PAGE is not available. Figure adapted from Choe and Lee (2003).
scientifically interesting differences in protein expression between treatments depends on the levels of between-sample variability, not gel–gel variability. The proposed experimental design (Fig. 18.6) points out a potential issue regarding the cultivation method. In this regard, a preliminary study following that design and relied on a single chemostat to generate steady state cultures for analysis could take more than 6 months to complete. A potential solution would be to run multiple chemostats; such replication could potentially compensate for increases in biological variability encountered by compressing the time scale of culture preparation. The overall variability of a proteomic experiment depends not only on the biological samples used and the skill of the operator but also on the methods chosen as well. Methods with low inherent variability can contribute to the success of a proteomic experiment, but they include tradeoffs in cost, labor, sensitivity, and the amount of sample needed. For example, although silver staining is more variable than Coomassie staining, it is also
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
Independent sample preparations
IEF
459
SDS-PAGE
Figure 18.6 Experimental design to determine between-sample variability in preparation for a proteomic study. Independent samples are separated in different IEF and SDSPAGE runs. Each sample could easily be duplicated; however, depending on gel-to-gel reproducibility, image analysis constraints could limit the number of replicate gels included in the analysis.
much more sensitive. It uses relatively inexpensive reagents, and the stained images can be captured by flatbed scanners. Fluorescent dyes like SYPRO Ruby (Molecular Bioprobes, Eugene, OR) can be as sensitive as silver nitrate, with a greater linear range and better reproducibility. As a progressive dye (which, like colloidal Coomassie, does not require a destaining step), stain intensity is easier to control and reproduce. However, fluorescent dyes and the specialized image capture equipment required are expensive. In some cases, the reduction in variability may be worth the price; in others, compensating for high variability by increasing sample size may be the most economical approach. The limitations of image analysis may constrain the number of replicates that can be effectively matched and analyzed. As the Asirvatham et al. (2002) study illustrated, automated spot matching alone is ineffective over large numbers of gels. Even user-guided matching becomes problematic when
460
Emily O. Burton and William J. Hickey
the slight differences between gels accumulate over many replicates. In the present study, matching was much better between gels run in the same SDS-PAGE batch than gels run independently (data not shown). An averaged gel composed of gels from four independent SDS-PAGE batches or from two independent treatments (six to eight gels, total) is probably the practical limit of matching under the conditions used. If more replicates are needed, both variability and matching efficiency could be increased through the use of a multiplex gel box capable of running up to 10 gels simultaneously. Gels run in parallel can be matched more effectively, thereby allowing more replicates to be averaged and analyzed in a single experiment.
ACKNOWLEDGMENTS These studies were funded by grants to W. J. H. (USDA-NRI; 2001-35107-11046) and E. O. B. (University of Wisconsin, NIH Biotechnology Training Program and Wisconsin Alumni Research Foundation University Fellowship).
REFERENCES Asirvatham, V. S., Watson, B. S., and Sumner, L. W. (2002). Analytical and biological variances associated with proteomic studies of Medicago truncatula by two-dimensional polyacrylamide gel electrophoresis. Proteomics 2, 960–968. Bantscheff, M., Schirle, M., Sweetman, G., Rick, J., and Kuster, B. (2007). Quantitative mass spectrometry in proteomics: A critical review. Anal. Bioanal. Chem. 389, 1017–1031. Baudouin-Cornu, P., Lagniel, G., Chedin, S., and Labarre, J. (2009). Development of a new method for absolute protein quantification on 2-D gels. Proteomics 9, 4606–4615. Berkelman, T., and Stenstedt, T. (1998). 2-D Electrophoresis: Using Immobilized pH Gradients, Principles & Methods. Amersham Pharmacia Biotech Inc., Piscataway, NJ. Berth, M., Moser, F. M., Kolbe, M., and Bernhardt, J. (2007). The state of the art in the analysis of two-dimensional gel electrophoresis images. Appl. Microbiol. Biotechnol. 76, 1223–1243. Berven, F. S., Karlsen, O. A., Murrell, J. C., and Jensen, H. B. (2003). Multiple polypeptide forms observed in two-dimensional gels of Methylococcus capsulatus (Bath) polypeptides are generated during the separation procedure. Electrophoresis 24, 757–761. Betts, J. C., Lukey, P. T., Robb, L. C., McAdam, R. A., and Duncan, K. (2002). Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 43, 717–731. Blum, H., Beier, H., and Gross, H. J. (1987). Improved silver staining of plant proteins, RNA and DNA in polyacrylamide gels. Electrophoresis 8, 93–99. Chevalier, F. (2010). Highlights on the capacities of “gel-based” proteomics. Proteome Sci. 8, 23. Chevallet, M., Diemer, H., Luche, S., Van Dorsselaer, A., Rabilloud, T., and Leize-Wagner, E. (2006a). Improved mass spectrometry compatibility is afforded by ammoniacal silver staining. Proteomics 6, 2350–2354. Chevallet, M., Luche, S., and Rabilloud, T. (2006b). Silver staining of proteins in polyacrylamide gels. Nat. Protoc. 1, 1852–1858.
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
461
Chevallet, M., Luche, S., Diemer, H., Strub, J. M., Van Dorsselaer, A., and Rabilloud, T. (2008). Sweet silver: A formaldehyde-free silver staining using aldoses as developing agents, with enhanced compatibility with mass spectrometry. Proteomics 8, 4853–4861. Chich, J. F., David, O., Villers, F., Schaeffer, B., Lutomski, D., and Huet, S. (2007). Statistics for proteomics: Experimental design and 2-DE differential analysis. J. Chromatogr. B Analyt. Technol. Biomed. Life Sci. 849, 261–272. Chick, J. M., Haynes, P. A., Bjellqvist, B., and Baker, M. S. (2008). A combination of immobilised pH gradients improves membrane proteomics. J. Proteome Res. 7, 4974–4981. Choe, L. H., and Lee, K. H. (2003). Quantitative and qualitative measure of intralaboratory two-dimensional protein gel reproducibility and the effects of sample preparation, sample load, and image analysis. Electrophoresis 24, 3500–3507. Choi, H., Fermin, D., and Nesvizhskii, A. I. (2008). Significance analysis of spectral count data in label-free shotgun proteomics. Mol. Cell. Proteomics 7, 2373–2385. Devraj, K., Geguchadze, R., Klinger, M. E., Freeman, W. M., Mokashi, A., Hawkins, R. A., and Simpson, I. A. (2009). Improved membrane protein solubilization and clean-up for optimum two-dimensional electrophoresis utilizing GLUT-1 as a classic integral membrane protein. J. Neurosci. Methods 184, 119–123. Diz, A. P., Truebano, M., and Skibinski, D. O. F. (2009). The consequences of sample pooling in proteomics: An empirical study. Electrophoresis 30, 2967–2975. Dutt, M. J., and Lee, K. H. (2001). The scaled volume as an image analysis variable for detecting changes in protein expression levels by silver stain. Electrophoresis 22, 1627–1632. Emadali, A., and Gallagher-Gambarelli, M. (2009). Quantitative proteomics by SILAC: Practicalities and perspectives for an evolving approach. Med. Sci. (Paris) 25, 835–842. Feng, X. J., Liu, X., Luo, Q. M., and Liu, B. F. (2008). Mass spectrometry in systems biology: An overview. Mass Spectrom. Rev. 27, 635–660. Garfin, D. E. (2003). Two-dimensional gel electrophoresis: An overview. Trends Anal. Chem. 22, 263–272. Giometti, C. S., Gemmell, M. A., Tollaksen, S. L., and Taylor, J. (1991). Quantitation of human-leukocyte proteins after silver staining: A study with 2-dimensional electrophoresis. Electrophoresis 12, 536–543. Gouw, J. W., Krijgsveld, J., and Heck, A. J. R. (2010). Quantitative proteomics by metabolic labeling of model organisms. Mol. Cell. Proteomics 9, 11–24. Grove, H., Jorgensen, B. M., Jessen, F., Sondergaard, I., Jacobsen, S., Hollung, K., Indahl, U., and Faergestad, E. M. (2008). Combination of statistical approaches for analysis of 2-DE data gives complementary results. J. Proteome Res. 7, 5119–5124. Gustafsson, J. S., Ceasar, R., Glasbey, C. A., Blomberg, A., and Rudemo, M. (2004). Statistical exploration of variation in quantitative two-dimensional gel electrophoresis. Proteomics 4, 3791–3799. Gygi, S. P., Rochon, Y., Franza, B. R., and Aebersold, R. (1999). Correlation between protein and mRNA abundance in yeast. Mol. Cell. Biol. 19, 1720–1730. Helbig, A. O., Heck, A. J. R., and Slijper, M. (2010). Exploring the membrane proteome: Challenges and analytical strategies. J. Proteomics 73, 868–878. Horgan, G. W. (2007). Sample size and replication in 2D gel electrophoresis studies. J. Proteome Res. 6, 2884–2887. Hrebicek, T., Duerrschmid, K., Auer, N., Bayer, K., and Rizzi, A. (2007). Effect of CyDye minimum labeling in differential gel electrophoresis on the reliability of protein identification. Electrophoresis 28, 1161–1169. Hunt, S. M. N., Thomas, M. R., Sebastian, L. T., Pedersen, S. K., Harcourt, R. L., Sloane, A. J., and Wilkins, M. R. (2005). Optimal replication and the importance of experimental design for gel-based quantitative proteomics. J. Proteome Res. 4, 809–819.
462
Emily O. Burton and William J. Hickey
Jacobsen, S., Grove, H., Jensen, K. N., Sorensen, H. A., Jessen, F., Hollung, K., Uhlen, A. K., Jorgensen, B. M., Faergestad, E. M., and Sondergaard, I. (2007). Multivariate analysis of 2-DE protein patterns: Practical approaches. Electrophoresis 28, 1289–1299. Jensen, K. N., Jessen, F., and Jorgensen, B. M. (2008). Multivariate data analysis of twodimensional gel electrophoresis protein patterns from few samples. J. Proteome Res. 7, 1288–1296. Kang, U. B., Yeom, J., Kim, H., and Lee, C. (2010). Quantitative analysis of mTRAQlabeled proteome using full MS scans. J. Proteome Res. 9, 3750–3758. Karp, N. A., Feret, R., Rubtsov, D. V., and Lilley, K. S. (2008). Comparison of DIGE and post-stained gel electrophoresis with both traditional and SameSpots analysis for quantitative proteomics. Proteomics 8, 948–960. Keen, G. A., and Prosser, J. I. (1987). Steady state transient growth of autotrophic nitrifying bacteria. Arch. Microbiol. 159, 73–79. Kito, K., and Ito, T. (2008). Mass spectrometry-based approaches toward absolute quantitative proteomics. Curr. Genomics 9, 263–274. Kocher, T., Pichler, P., Schutzbier, M., Stingl, C., Kaul, A., Teucher, N., Hasenfuss, G., Penninger, J. M., and Mechtler, K. (2009). High precision quantitative proteomics using iTRAQ on an LTQ orbitrap: A new mass spectrometric method combining the benefits of all. J. Proteome Res. 8, 4743–4752. Koehler, C. J., Strozynski, M., Kozielski, F., Treumann, A., and Thiede, B. (2009). Isobaric peptide termini labeling for MS/MS-based quantitative proteomics. J. Proteome Res. 8, 4333–4341. Lundgren, D. H., Hwang, S. I., Wu, L. F., and Han, D. K. (2010). Role of spectral counting in quantitative proteomics. Expert Rev. Proteomics 7, 39–53. Mahon, P., and Dupree, P. (2001). Quantitative and reproducible two-dimensional gel analysis using Phoretix 2D Full. Electrophoresis 22, 2075–2085. Maurer, M. H. (2006). Software analysis of two-dimensional electrophoretic gels in proteomic experiments. Curr. Bioinform. 1, 255–262. Minden, J. S., Dowd, S. R., Meyer, H. E., and Stuhler, K. (2009). Difference gel electrophoresis. Electrophoresis 30, S156–S161. Molloy, M. P., Herbert, B. R., Walsh, B. J., Tyler, M. I., Traini, M., Sanchez, J. C., Hochstrasser, D. F., Williams, K. L., and Gooley, A. A. (1998). Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis. Electrophoresis 19, 837–844. Molloy, M. P., Phadke, N. D., Maddock, J. R., and Andrews, P. C. (2001). Twodimensional electrophoresis and peptide mass fingerprinting of bacterial outer membrane proteins. Electrophoresis 22, 1686–1696. Molloy, M. P., Brzezinski, E. E., Hang, J. Q., McDowell, M. T., and VanBogelen, R. A. (2003). Overcoming technical variation and biological variation in quantitative proteomics. Proteomics 3, 1912–1919. Mulvaney, R. L. (1996). Nitrogen—Inorganic forms. In “Methods of Soil Analysis: Chemical Methods,” (D. L. Sparks, ed.), Vol. 5, p. 1390. Soil Science Society of America, Inc., Madison, WI. Nebrich, G., Herrmann, M., Sagi, D., Klose, J., and Giavalisco, P. (2007). High MScompatibility of silver nitrate-stained protein spots from 2-DE gels using ZipPlates and AnchorChips for successful protein identification. Electrophoresis 28, 1607–1614. Neidhardt, F. C., Ingraham, J. L., and Scheachter, M. (1990). Physiology of the Bacterial Cell. Sinauer Associates, Sunderland, MA. Nesvizhskii, A. I., Vitek, O., and Aebersold, R. (2007). Analysis and validation of proteomic data generated by tandem mass spectrometry. Nat. Methods 4, 787–797.
Assessing Variability in Gel-Based Proteomic Analysis of Nitrosomonas europaea
463
Ow, S. Y., Salim, M., Noirel, J., Evans, C., Rehman, I., and Wright, P. C. (2009). iTRAQ Underestimation in simple and complex mixtures: “The Good, the Bad and the Ugly” J. Proteome Res. 8, 5347–5355. Penque, D. (2009). Two-dimensional gel electrophoresis and mass spectrometry for biomarker discovery. Proteomics Clin. Applic. 3, 155–172. Perkins, D. N., Pappin, D. J. C., Creasy, D. M., and Cottrell, J. S. (1999). Probability-based protein identification by searching sequence databases using mass spectrometry data. Electrophoresis 20, 3551–3567. Phanstiel, D., Unwin, R., McAlister, G. C., and Coon, J. J. (2009). Peptide quantification using 8-plex isobaric tags and electron transfer dissociation tandem mass spectrometry. Anal. Chem. 81, 1693–1698. Quaglia, M., Pritchard, C., Hall, Z., and O’Connor, G. (2008). Amine-reactive isobaric tagging reagents: Requirements for absolute quantification of proteins and peptides. Anal. Biochem. 379, 164–169. Righetti, P. G., Castagna, A., Antonucci, F., Piubelli, C., Cecconi, D., Campostrini, N., Antonioli, P., Astner, H., and Hamdan, M. (2004). Critical survey of quantitative proteomics in two-dimensional electrophoretic approaches. J. Chromatogr. A 1051, 3–17. Schroder, S., Zhang, H., Yeung, E. S., Jansch, L., Zabel, C., and Watzig, H. (2008). Quantitative gel electrophoresis: Sources of variation. J. Proteome Res. 7, 1226–1234. Schroder, S., Brandmuller, A., Deng, X., Ahmed, A., and Watzig, H. (2009). Improving precision in gel electrophoresis by stepwisely decreasing variance components. J. Pharm. Biomed. Anal. 50, 320–327. Schulze, W. X., and Usadel, B. (2010). Quantitation in mass-spectrometry-based proteomics. Annu. Rev. Plant Biol. 61, 491–516. Smales, C. M., Birch, J. R., Racher, A. J., Marshall, C. T., and James, D. C. (2003). Evaluation of individual protein errors in silver-stained two-dimensional gels. Biochem. Biophys. Res. Commun. 306, 1050–1055. Valcu, C. M., and Valcu, M. (2007). Reproducibility of two-dimensional gel electrophoresis at different replication levels. J. Proteome Res. 6, 4677–4683. Van den Bergh, G., and Arckens, L. (2009). High resolution protein display by twodimensional electrophoresis. Curr. Anal. Chem. 5, 106–115. Vercauteren, F. G. G., Arckens, L., and Quirion, R. (2007). Applications and current challenges of proteomic approaches, focusing on two-dimensional electrophoresis. Amino Acids 33, 405–414. Wessels, H. J. C. T., Gloerich, J., van der Biezen, E., Jetten, M. S. M., and Kartal, B. (2010). Liquid chromatography-mass spectrometry-based proteomics of Nitrosomonas. In “Methods Enzymol,” ( J. N. Abelson and M. I. Simon, eds.). Academic Press, Amsterdam. Westbrook, J. A., Yan, J. X., Wait, R., and Dunn, M. J. (2001). A combined radiolabelling and silver staining technique for improved visualisation, localisation, and identification of proteins separated by two-dimensional gel electrophoresis. Proteomics 1, 370–376. Wheelock, A. M., and Goto, S. (2006). Effects of post-electrophoretic analysis on variance in gel-based proteomics. Expert Rev. Proteomics 3, 129–142. Wu, S. H., Black, M. A., North, R. A., Atkinson, K. R., and Rodrigo, A. G. (2009). A Statistical model to identify differentially expressed proteins in 2D PAGE gels. PloS Comp. Biol. 5(9), e1000509. doi:10.1371/journal.pcbi.1000509. Zhan, X. Q., and Desiderio, D. M. (2003). Differences in the spatial and quantitative reproducibility between two second-dimensional gel electrophoresis systems. Electrophoresis 24, 1834–1846.
C H A P T E R
N I N E T E E N
Nitrogen Metabolism and Kinetics of Ammonia-Oxidizing Archaea Willm Martens-Habbena and David A. Stahl Contents 466 468 468
1. Introduction 2. Strain Cultivation and Analytical Methods 2.1. Culture media and growth conditions 2.2. Nutrient measurements, cell counts, and protein quantification 2.3. Calculations and conversion factors 3. Microrespirometry Setup 4. Stoichiometry and Kinetics of Ammonia Oxidation of N. maritimus and AOB 5. Variability of Kinetic Constants in AOB and AOA 6. Summary and Conclusions Acknowledgments References
469 470 470 474 480 482 483 483
Abstract The discovery of ammonia-oxidizing mesophilic and thermophilic Group I archaea changed the century-old paradigm that aerobic ammonia oxidation is solely mediated by two small clades of Beta- and Gammaproteobacteria. Group I archaea are extremely diverse and ubiquitous in marine and terrestrial environments, accounting for 20–30% of the microbial plankton in the global oceans. Recent studies indicated that many of these organisms carry putative ammonia monooxygenase genes and are more abundant than ammonia-oxidizing bacteria in most natural environments suggesting a potentially significant role in the nitrogen cycle. The isolation of Nitrosopumilus maritimus strain SCM1 provided the first direct evidence that Group I archaea indeed gain energy from ammonia oxidation. To characterize the physiology of this archaeal nitrifier, we developed a respirometry setup particularly suited for activity measurements in dilute microbial cultures with extremely low oxygen uptake rates. Here, we describe the setup and review the kinetic experiments conducted with N. maritimus and other nitrifying microorganisms. These experiments Department of Civil and Environmental Engineering, University of Washington, Seattle, Washington, USA Methods in Enzymology, Volume 496 ISSN 0076-6879, DOI: 10.1016/B978-0-12-386489-5.00019-1
#
2011 Elsevier Inc. All rights reserved.
465
466
Willm Martens-Habbena and David A. Stahl
demonstrated that N. maritimus is adapted to grow on ammonia concentrations found in oligotrophic open ocean environments, far below the survival threshold of ammonia-oxidizing bacteria. The described setup and experimental procedures should facilitate physiological studies on other nitrifying archaea and oligotrophic microorganisms in general.
1. Introduction The nitrogen cycle has changed significantly within the past two decades. New processes and microorganisms have been discovered that contribute to this still insufficiently resolved nutrient cycle (Francis et al., 2007; Prosser and Nicol, 2008). Among the most important findings was the discovery of aerobic ammonia oxidation within the domain Archaea. Ammonia oxidation, the first step of nitrification, has been known for over a century and it was thought to be restricted to three genera of Beta- and Gammaproteobacteria (Koops et al., 2000; Kowalchuk and Stephen, 2001). Putative ammonia monooxygenase (AMO) genes linked to archaeal ribosomal RNA genes were then found on fosmid clones from soil, suggesting a possible role of mesophilic archaea in the nitrogen cycle (Schleper et al., 2005; Treusch et al., 2005). This hypothesis was confirmed by the isolation of the ammoniaoxidizing archaea ammonia-oxidizing archaeon (AOA) Nitrosopumilus maritimus strain SCM1 (Ko¨nneke et al., 2005), and the description of additional mesophilic and thermophilic archaeal enrichment cultures that stoichiometrically oxidize ammonia to nitrite (de la Torre et al., 2008; Hatzenpichler et al., 2008; Schleper and Nicol, 2010; Wuchter et al., 2006). Detailed molecular surveys demonstrated that AOA are ubiquitous in marine and terrestrial environments and frequently outnumber AOB, especially in nutrient-poor environments (Beman et al., 2010; Herrmann et al., 2009; Leininger et al., 2006; Mincer et al., 2007; Prosser and Nicol, 2008; Zhang et al., 2010). AOA account for up to 30% of the microbial plankton in the oligotrophic ocean gyres (Agogue´ et al., 2008; Karner et al., 2001) and between 1% and 3% of the total microbial count in soils and sediments, together indicating that these poorly understood microorganisms belong to the most abundant microbial clades on Earth (Karner et al., 2001; Prosser and Nicol, 2008). Metagenomic studies on marine and soil fosmid clones, the uncultured sponge-associated archaeon, Cand. Cenarchaeum symbiosum, and the genome sequence of N. maritimus have offered new insights into the metabolism and phylogeny of these organisms (Brochier-Armanet et al., 2008; Hallam et al., 2006a,b; Spang et al., 2010; Treusch et al., 2005; Walker et al., 2010). Phylogenetic studies on ribosomal proteins and core genes indicated that AOA represent a novel phylum, Thaumarchaeota, within the Archaea
Nitrogen Metabolism and Kinetics of AOA
467
(Brochier-Armanet et al., 2008; Spang et al., 2010). Thus far, ammonia oxidation is the only plausible pathway of generation of metabolic energy by these organisms, although the investigated (meta-) genomes do not share the ammonia oxidation pathway found in AOB. AOB possess an AMO, which derives electrons from the ubiquinone pool to oxidize ammonia to hydroxylamine. Hydroxylamine is subsequently oxidized to nitrite by a hydroxylamine oxidoreductase (HAO), which delivers electrons back into the ubiquinone pool for respiration and further activation of AMO (Arp et al., 2007; Hooper, 1989; Walker et al., 2010). Whereas a canonical AMO is consistently found in AOA (meta-) genomes, a putative HAO has not been identified (Hallam et al., 2006a,b; Treusch et al., 2005; Walker et al., 2010). Thus, energy generation in these archaea likely follows a novel pathway. Following the most parsimonious hypothesis, the archaeal AMO oxidizes ammonia to hydroxylamine similar to the bacterial pathway. Hydroxylamine would subsequently be oxidized to nitrite by one or multiple novel enzymes, for example, putative multicopper oxidases, which could function analogously to the bacterial HAO. Alternatively, the archaeal AMO could yield a more oxidized product than hydroxylamine (e.g., H2N2O2 or HNO), that may subsequently be oxidized to nitrite via one of the putative multicopper oxidases, and channel electrons via plastoand sulfocyanins into the mostly Cu-based respiratory chain typically found in AOA (meta-)genomes (Schleper and Nicol, 2010; Walker et al., 2010). Along with a different ammonia oxidation pathway and greater involvement of Cu-dependent enzymes, AOA possess strikingly different cellular characteristics than the AOB. The size of N. maritimus cells and their genome is close to the estimated lower limits of free-living organisms (Button, 2000) and comparable to those of Pelagibacter ubique (Rappe´ et al., 2002). Similar to P. ubique, SCM1 cells are only between 0.5–0.9 mm long and 0.25 mm wide and contain approximately 10 fg protein (16–20 fg dry weight cell per cell) (Martens-Habbena et al., 2009). Thus, even a single copy of the 1.645 Mbp Nitrosopumilus genome accounts for almost 10% of cellular dry weight. In contrast, cells of AOB strains in culture have at least 10-fold higher biomass per cell, equivalent to between 120 and up to 1000 fg protein per cell (Keen and Prosser, 1987; Martens-Habbena et al., 2009), and their genome size ranges from 2.8 to 3.5 Mbp (Arp et al., 2007). Small cell size, and associated increase in surface-to-volume ratio, as well as small genome size have previously been considered important evolutionary adaptations by oligotrophic microorganisms to life under resource limitation in nutrient-depleted environments (Button, 2000; Giovannoni et al., 2005; Harder and Dijkhuizen, 1983; Roszak and Colwell, 1987). In conjunction with the abundance patterns revealed by molecular surveys, these distinct characteristics suggested that AOA and AOB could occupy different ecological niches and that AOA could be particularly adapted to live in oligotrophic environments (Martens-Habbena et al., 2009).
468
Willm Martens-Habbena and David A. Stahl
Under nutrient-limited conditions, growth and survival of microorganisms depend critically on their ability to scavenge nutrients from the surrounding environment, reflected by kinetics of nutrient uptake and energy source oxidation (Button, 1985; Button et al., 2004). We therefore sought to determine and compare the kinetic characteristics of ammonia uptake and oxidation of N. maritimus and known AOB strains. Slow growth rates and low biomass yields obtained in laboratory cultures of AOB and especially of N. maritimus make such kinetic studies and physiological experiments in general difficult. Further, growth of N. maritimus is strongly impaired by agitation, rendering nutrient-limited chemostat experiments challenging. We therefore elected to use microrespirometry to determine the stoichiometry and kinetics of ammonia oxidation via its associated oxygen consumption. In this chapter, we describe this microrespirometry setup and review kinetic experiments conducted with N. maritimus, as well as ammonia- and nitrite-oxidizing bacteria. The setup was particularly tuned to monitor activity of microorganisms in very dilute cultures. The high resolution and low detection limit of approximately 0.2 mM O2 uptake per hour permitted us to continuously monitor ammonia oxidation activity in undisturbed N. maritimus cultures without harvesting to concentrate cell material. Using this technique, we were able to accurately determine the stoichiometry and kinetics of ammonia oxidation by N. maritimus, demonstrating that this organism has one of the highest substrate affinities found among microorganisms. This physiology strongly supports the hypothesis that N. maritimus is among the most oligotrophic organisms known to date. Altogether, the available data indicate that oligophilic AOA may have significant impact on the nitrogen and carbon cycles of the global oceans (Martens-Habbena et al., 2009).
2. Strain Cultivation and Analytical Methods 2.1. Culture media and growth conditions N. maritimus strain SCM1 was grown and maintained in marine synthetic Crenarchaeota medium (SCM). All glassware used for media preparation or cultivation was acid washed (1% HCl) and rinsed with MilliQ water. The basal artificial seawater contained (in g l 1) NaCl, 26.0, MgSO47H2O, 5.0 g, MgCl26H2O, 5.0 g, CaCl22H2O, 1.5 g, KBr, 0.1 g. The basal salt solution was prepared freshly, autoclaved, cooled to room temperature, and supplemented with sterile stock solutions as follows (per liter): 10 ml HEPES buffer (1 M HEPES, 0.6 M NaOH, pH 7.8), 2 ml sodium bicarbonate (1 M), 5 ml KH2PO4 (0.4 g l 1), 1 ml FeNaEDTA (7.5 mM), 1 ml Nitrosopumilus trace element solution. The trace element solution
Nitrogen Metabolism and Kinetics of AOA
469
contained (per liter) 8 ml conc. HCl ( 12.5 M), 30 mg H3BO3, 100 mg MnCl24H2O, 190 mg CoCl26H2O, 24 mg NiCl26H2O, 2 mg CuCl22H2O, 144 mg ZnSO47H2O, 36 mg Na2MoO42H2O. The medium was finally supplemented with the desired volume of NH4Cl (1 M). The pH of this medium at 30 C was 7.5. SCM1 grew in HEPES-buffered medium after acclimatization with incrementally increasing HEPES concentrations. Cultures were maintained in HEPES-buffered SCM medium at 25 or 30 C in the dark without agitation and transferred (0.1–1% inoculum size) to fresh medium when most of the ammonium was oxidized. Nitrosococcus oceani strain ATCC 19707 was grown in HEPES-buffered SCM medium as described above containing 10 mM NH4Cl. N. oceani was cultured at 30 C on a rotary shaker (150 rpm). Nitrosomonas europaea strain ATCC 19718 and Nitrobacter winogradsky strain Nb-255 (ATCC 25391) were grown in liquid freshwater medium containing 20 mM (NH4)2SO4, 50 mM HEPES, 150 mM CaCl2, 150 mM MgSO4, and 0.5 ml Phenol Red (0.4%). The pH of the medium was adjusted to 7.8 and autoclaved. After cooling 1 ml FeNaEDTA (5 mM), 0.25 ml KH2PO4 (1 M), 1.5 ml NaHCO3 (1 M), and 1 ml N. europaea trace metal solution (10 mg NaMoO42H2O, 20 mg MnCl22H2O, 0.2 mg CoCl26H2O, 10 mg ZnSO47H2O, 2 mg CuSO4 5 H2O per liter) were added from sterile stock solutions. For N. winogradsky, the medium was supplemented with up to 10 ml of sodium nitrite (1 M). N. europaea and N. winogradsky were cultured on a rotary shaker (150 rpm) at 30 C and 25 C, respectively.
2.2. Nutrient measurements, cell counts, and protein quantification Nitrite was determined spectrophotometrically using the Griess assay (Stickland and Parsons, 1972). Ammonium was determined by fluorescence measurement after o-phthaldialdehyde derivatization in a Trilogy Laboratory flourometer (Turner Designs, Sunnyvale, CA) or fluorescence microplate reader (Tecan Inc., Durham, NC) (Holmes et al., 1999). The detection limits were 5–10 and 100 nM, respectively. Cell counts were performed by fluorescence microscopy in a Zeiss Axioplan microscope after Sybr Green I staining as described (Lunau et al., 2005). Protein content of bacterial and archaeal cultures was determined using the Nano Orange kit (Invitrogen, Carlsbad, CA) according to manufacturer’s instructions. Cells of N. europaea and N. winogradsky were harvested by 15 min centrifugation at 10,000g in a bench top microcentrifuge. N. maritimus and N. oceani cells were collected by filtration using Centricon YM-100 units (Amicon Inc.) according to manufacturer’s instructions, rinsed with MilliQ, and resuspended in assay buffer. Nano Orange fluorescence was quantified in black 96-well plates (Corning, 9691) using a fluorescence microplate reader.
470
Willm Martens-Habbena and David A. Stahl
2.3. Calculations and conversion factors It remains unknown whether ammonia or ammonium is the actual substrate encountered by N. maritimus cells. Therefore, all calculations presented are based on total reduced inorganic nitrogen (NH3 þ NH4þ). If necessary, the equilibrium concentrations of NH3 and NH4þ were calculated based on salinity, temperature, and pH and the respective stoichiometric dissociation constants of NH3 and NH4þ given in the literature (Clegg and Whitfield, 1995). Kinetic data of AOB, diatoms, organotrophic microorganisms, soil, and ocean water used for the calculations were compiled from the following references: Bollmann et al. (2005), Button (1985, 1998), Button et al. (1998), Eppley and Renger (1974), Glover (1985), Hashimoto et al. (1983), Jiang and Bakken (1999), Keen and Prosser (1987), Loureiro et al. (2009), Prosser (1989), Reay et al. (1999), Senn et al. (1994), Stark and Firestone (1996), Stehr et al. (1995), Suwa et al. (1994), Suzuki et al. (1974), Ward (1987, 1990), and Watson (1965). For the estimation of specific affinities (a0) growth rates, m (h–1), metabolic coefficients, q (g substrate g wet cells–1 h–1), and cell yields, Y (g wet cells g substrate–1) were calculated as previously described (Button, 1985, 1998; Button et al., 1998). The following conversion factors were used: 3 g cell wet weight per g cell dry weight, 5.7 g cell wet weight per g cell protein (Button, 1998), and 0.55 g cell carbon per g cell dry weight (Simon and Azam, 1989).
3. Microrespirometry Setup Continuous monitoring of metabolic activity provides an important method for laboratory studies of microorganisms. Specific and nondestructive detection systems are available only for a limited number of microbial substrates or products. One of the most widely used and broadly applicable techniques is therefore to monitor oxygen consumption associated with metabolic activity using Clark-type oxygen electrodes (Clark et al., 1953). A variety of such electrode systems are commercially available and the working principle has previously been reviewed in detail (Ku¨hl and Revsbech, 2001; Pouvreau et al., 2008; Renger and Hanssum, 2009; Revsbech and Jrgensen, 1986). The resolution of these systems is usually too low to monitor activity in dilute cultures and therefore most experimental protocols call for significant preconcentration of cells by harvesting and resuspension in smaller volumes of buffer. The sensitivity of the oxygen electrodes is limited mainly by several sources of noise and internal oxygen consumption by the electrode. In principle, both limitations can be overcome by use of microscale oxygen sensors (Revsbech, 1989; Revsbech and
Nitrogen Metabolism and Kinetics of AOA
471
Jrgensen, 1986). The construction of microscale electrochemical sensors (i.e., combination electrodes of sensing cathodes or anodes, and reference electrodes) has several advantages over macroscopic electrodes, namely faster response times, better signal stability, and lower stirring sensitivity (Ku¨hl and Revsbech, 2001; Revsbech, 1989; Revsbech and Jrgensen, 1986). Further, the small electrode size significantly reduces internal oxygen consumption. We therefore used a commercially available microsensorbased respiration system, which after customization to reduce background noise and sensor drift ultimately permitted highly sensitive oxygen measurements in dilute cultures without prior harvesting or manipulation. The basic commercially available respiration system (Unisense AS, Aarhus, Denmark) consists of glass chambers (2 or 35 ml volume) that hold the cell suspensions. The chambers are covered with ground glass lids and are stirred with glass-coated stir bars (see below). The oxygen microsensors (OX-MR type, 500 mm membrane tip diameter) are connected to a picoammeter (PA 2000) and continuously polarized at 0.6 to 0.8 V. After sufficient initial polarization (>7 days), the sensors are placed in a rack and the sensor tip is inserted into the cell suspension through a capillary inlet in the center of the glass lid. The amperometric signal of the microsensor is amplified and converted to mV by a picoammeter (PA 2000), fed through a 16bit A/D converter, and is recorded by a data acquisition software (e.g., SensorTrace Basic, MicOx 2.6; Unisense AS). In general, four major sources of noise can be distinguished that influence the signal of electrochemical microsensors: vibrations, temperature fluctuations, electronic and electromagnetic noise, as well as turbulence at the sensor tip caused by stirring. Those should be minimized to achieve high sensitivity and signal stability. A schematic overview of the final optimized setup is depicted in Fig. 19.1. The entire system should be placed on a solid stone bench-top surface with minimal exposure to mechanical vibrations by general laboratory operation such as opening and closing of doors, operation of elevators, or shakers, centrifuges, etc. This is particularly important when measurements are conducted over long periods of time, that is, several hours to days. Temperature oscillations at the microsensor tip can effectively be limited by placing the sensor rack including glass chambers and microsensor in a Styrofoam-insulated water bath, which is connected to a circulating thermostatic water bath (Fig. 19.1). While in the thermostatic water bath the temperature will oscillate up to 0.2 C depending on the specifications of the thermostat, this oscillation is reduced to less than 0.02 C through the Styrofoam isolation and water recirculation in the insulated water bath. In addition, the recirculation eliminates transmission of mechanical vibrations from the circulation pump to the microsensor. Several sources of electronic and electromagnetic noise exist—mainly caused by potential differences between water bath, picoammeter, and
472
Willm Martens-Habbena and David A. Stahl
To power grid
Stabilized power source Resistor 1000 µF
Computer
USB
USB optical isolator
A/D converter
Picoammeter
Oxygen microsensor in guard
Thermostated water bath (± 0.2 °C)
Insulated water bath (± 0.02 °C)
Stir plate
Figure 19.1 Schematic overview of the optimized microrespirometry setup used for the described experiments.
power grid. Although it is impossible to eliminate potential differences completely, these are strongly reduced by a “floating” operation of the necessary electrical components with a star-shaped ground connection. To avoid potential differences within the setup, the entire setup can only have one ground connection. This is by default the ground of the thermostatic water bath. The picoammeter is subsequently grounded to the water bath. The only remaining electrical and ground connection to other electronic components is eliminated using an USB optical isolator between the A/D converter and the USB port of the PC computer. Thus, the picoammeter, microsensor, and A/D converter should not experience potential differences. In addition, a stabilized power source may be used to power the picoammeter and the USB port of the optical isolator (Fig. 19.1). The remaining source of signal noise is owed to the turbulence at the sensor tip caused by stirring of the cell suspension. Only slight fluctuations
473
Nitrogen Metabolism and Kinetics of AOA
of flow velocity at the sensor tip change the diffusive boundary layer at the sensor tip and thus influence the rate of oxygen diffusion through the membrane and, hence, the sensor signal. Stirring is required to maintain homogeneity of the cell suspension. Therefore, the best reproducibility of the sensor signal is obtained by using an external stir plate with very steady stirring motion in combination with well-balanced glass micro-stir bars and low stirring speeds of 100–150 rpm. Nonetheless, stirring noise remains the dominant source of noise and cannot be eliminated completely (Fig. 19.2). Due to their small tip and electrode size, microsensors consume very little oxygen. When monitored continuously for 24 h with a OxMR-type microsensor, the oxygen concentration in a 2-ml glass chamber filled with sterile artificial seawater changes less than 1 mM, even though the 90% response time is <10 s (Fig. 19.2; Gundersen et al., 1998). Owing to the manual fabrication of the sensors, the signal intensity, oxygen consumption, and stirring sensitivity varies to some degree between individual sensors. For most reproducible measurements, new sensors are initially polarized for a period of 1 week prior to use and kept continuously polarized thereafter. This procedure reduces internal sensor noise, but more importantly it reduces the signal drift to less than 1% per week. During the initial polarization time, the signal intensity settles and thereafter remains stable over long periods of time facilitating reproducible measurements as well as minimizing calibrations. Using this optimized setup allows monitoring of oxygen levels with submicromolar accuracy over several hours to days. As shown in Fig. 19.2, a change of oxygen concentration as small as 0.3 mM can easily be recorded without data filtering. Depending on the desired response time, further 187.0
Oxygen ( µM )
186.8 186.6 186.4 186.2 186.0
0.0
0.1
0.2 0.3 0.4 Time (h)
0.5
0.6
Figure 19.2 Oxygen trace recorded using the optimized respirometry setup depicted in Fig. 19.1. A 38-ml custom-made glass chamber filled with artificial seawater was used. Data were recorded without software noise reduction to visualize the remaining stirring noise. The arrow indicates addition of 61 ml nitrogen-purged artificial seawater equivalent to 0.3 mM oxygen.
474
Willm Martens-Habbena and David A. Stahl
noise reduction can be obtained by calculation of running averages of the data via software settings or subsequent manual data analysis. An important remaining challenge of the classical Clark-type oxygen sensor has been accurate determination of submicromolar oxygen concentrations. The response time of electrochemical sensors increases markedly at very low analyte partial pressures, for example, <1 mM oxygen, which makes accurate zero calibrations difficult. Recently, a new type of oxygen microsensor was developed which overcomes this limitation. The STOX sensor (Switchable Trace OXygen sensor) allows accurate measurements of oxygen at extremely low partial pressures with a detection limit of 1–10 nM oxygen (Revsbech et al., 2009). In the past, electrochemical sensors have been developed and used to conduct fast kinetic measurements (seconds to few minutes) at low analyte concentrations (Pouvreau et al., 2008). The combination of the STOX sensor with the respirometry setup described here would offer to decrease the detection limit of oxygen also in slow oxygen uptake measurements over hours to days. Oxygen uptake measurements in microbial cultures at low oxygen tensions pose some additional challenges. At low analyte concentrations otherwise insignificant interferences of other chemical species may become important. For example, the classical Clark-type oxygen sensor shows some sensitivity to N2O, and NO. Both species are of particular significance in natural environments and microbial cultures growing at low oxygen partial pressures or transitions from oxic to anoxic conditions. In natural environments, such as marine oxygen minimum zones, the concentrations of these interfering species can easily be determined in separate measurements. When conducting measurements at low oxygen tensions on laboratory cultures, for example, of nitrifiers and denitrifiers, researchers should pay particular attention to those interferences. At low oxygen tensions, the microbial metabolism could change dramatically leading to potentially substantial accumulation of N2O or NO, and thus, significantly affecting oxygen sensor signals.
4. Stoichiometry and Kinetics of Ammonia Oxidation of N. maritimus and AOB Using the described microrespirometry setup, the stoichiometry and kinetics of ammonia oxidation by N. maritimus could be determined from individual oxygen traces (Martens-Habbena et al., 2009). Cells from late exponential or early stationary phase batch cultures were transferred to 2- or 35-ml respiration chambers. The filled chambers were immediately placed into the water bath and temperature was equilibrated for at least 10 min. The nitrite concentration in the batch cultures was between 0.9 and
475
Nitrogen Metabolism and Kinetics of AOA
1.1 mM, and the cell density was between 5.0 and 5.5 107 cells ml 1 culture volume, equivalent to 0.5 mg protein ml 1. After temperature equilibration, the endogenous oxygen uptake of the cells was consistently below 0.5 mM per hour (<1 mmol O2 mg protein–1 h–1, Fig. 19.3A). After addition of ammonium to the cells oxygen uptake increased within a few minutes up to 30 mM h–1 (40 mmol O2 mg protein–1 h–1) and remained high until the added ammonium was drawn down to below 1 mM. After it was completely consumed, the oxygen uptake rate returned to the low endogenous rate observed before ammonium addition. Increased oxygen consumption could be triggered by addition of as little as 200 nM NH4Cl.
A
B Addition of 10 µM NH4Cl
155.8
165
155.6 155.4 0.85
0.90
0.95
160 155 150 0.0 0.2 0.4 0.6 0.8 1.0 1.2 1.4 1.6
NH3 + NH+4 (µM)
1.4 1.2 1.0 0.8 0.6 0.4 0.2 0.0
0
1
2 Time (h)
3
4
Km = 0.139 µM Vmax= 25.72 µM O2 h-1
5
5
= 23.77 µmol N mg protein-1 h-1
0
Ammonium uptake (µM h-1)
1.6
10
10
0
D
1.8
15
15
Time (h)
C
20
20
Ammonia oxidation (µmol mg protein-1 h-1)
156.0
25
2
6 4 NH3 + NH+4 (µM)
8
0 10
1.0 30 0.8 25 0.6
20 15
0.4 Km = 0.134 µM 0.2
Vmax= 0.857 µM N h-1 = 29.82 µmol N mg protein-1 h-1
10
Ammonia oxidation (µmol mg protein-1 h-1)
156.2
170 Oxygen (µM )
30 25
156.4
Oxygen uptake (µM h-1)
175
5
0 0.0 0.0 0.2 0.4 0.6 0.8 1.0 1.2 1.4 1.6 NH3 + NH+4 (µM)
Figure 19.3 Stoichiometry and kinetics of ammonium uptake and oxidation by N. maritimus. (A) Oxygen uptake trace recorded by microrespirometry. (B) Ammonia oxidation kinetics calculated from the trace in panel (A). (C) Ammonium uptake determined by discrete ammonium measurements. (D) Ammonium uptake kinetic calculated from panel (C). All values are based on total reduced inorganic nitrogen (NH3 þ NH4þ), see Martens-Habbena et al. (2009) for further details. (adapted from Martens-Habbena et al., 2009, with permission).
476
Willm Martens-Habbena and David A. Stahl
The oxidation of ammonia by N. maritimus proceeded with a 1:1.5 molar ratio of ammonia and oxygen. As shown in Fig. 19.3A, the addition of 10 mM ammonium led to consumption of 15 mM oxygen, indicating a similar ammonia oxidation stoichiometry of N. maritimus and AOB strains (Prosser, 1986). Using this 1:1.5 stoichiometry, we could convert the change in oxygen concentrations to remaining total ammonium nitrogen concentrations, which permitted an estimation of the half saturation constant (Km) for ammonia oxidation by N. maritimus from the same oxygen trace. First, high-frequency noise was removed from the raw oxygen data by calculating a running average of the sensor signal. This was accomplished using the “Smooth 2D data” function implemented in Sigma Plot 8.0 (SPSS Inc., Il) or manual calculation of running averages using Microsoft Excel (Microsoft Inc., WA). The apparent half saturation constant for ammonia oxidation activity (Km) was then determined by fitting a Michaelis–Menten equation (Eq. (19.1)) to the data. V ¼
ðVmax ½S Þ ðKm þ ½S Þ
ð19:1Þ
Vmax, maximum velocity (mM h–1); Km, half-saturation constant of ammonia oxidation activity (mM); [S], total ammonium nitrogen (NH3 þ NH4þ, mM). Using this procedure, Km values for N. maritimus were determined to be between 90 and 150 nM NH4Cl (mean 132 nM, SD ¼ 38 nM). Notably, the Km values were similar for either ammonium-depleted early-stationary phase cultures or late-exponential cultures, even if those had been propagated for more than 100 generations in the presence of excess ammonium. In independent experiments, we determined the ammonium uptake kinetics of N. maritimus. Cells from late exponential growth phase were transferred into 5 l media batches containing 1.7 mM total ammonium nitrogen. Uptake of ammonium by N. maritimus was subsequently determined by measuring ammonium concentrations in 80 ml subsamples. Ammonium concentrations decreased at a constant rate until reaching the detection limit of the fluorimetric phthaldialdehyde assay (10 nM). Ammonium and oxygen uptake proceeded at similar rates, and the Km values of ammonium uptake and ammonia oxidation were indistinguishable (Martens-Habbena et al., 2009). The kinetic properties of N. maritimus differ remarkably from any known AOB. For comparison, we determined the ammonia oxidation kinetics of N. europaea and N. oceani from late-exponential batch cultures using the same respirometry setup. In contrast to N. maritimus, no measurable ammonia oxidation activity was observed below 10 mM NH4Cl, corroborating previous reports indicating that more than 1 mM ammonium nitrogen is necessary for any measurable activities of AOB strains (Bollmann et al., 2002). Consequently, Km values for N. europaea and N. oceani could
477
Nitrogen Metabolism and Kinetics of AOA
not be determined from single oxygen traces. Cultures were therefore harvested from exponential growth phase and resuspended in equal amounts of ammonia-free media. Multiple oxygen traces were recorded in the presence of varying ammonia concentrations. The Km value determined for N. europaea was 553 mM total ammonia, within the range previously reported for N. europaea cells from batch culture (Prosser, 1989). Interestingly, the ammonia oxidation kinetic of N. oceani did not obey a classical Michaelis–Menten model. Instead, the data were best fitted with a two-site saturation model suggesting that N. oceani concurrently uses two independent processes for ammonia uptake. Similar results have previously been reported by Ward (1987). The genome sequence analysis of N. oceani indicates the presence of only one ammonia permease (Klotz et al., 2006). Our observation of two comparatively high apparent Km values could suggest that passive diffusion and permease-facilitated diffusion could account for the apparent ammonia oxidation kinetic of N. oceani. We found similar kinetic data best fitted with a two-site saturation model also in cultures of the nitrite oxidizing bacterium, N. winogradsky (Fig. 19.4). N. winogradsky cells from late exponential growth phase as well as cells
Activity (% of maximum)
100 80 60 40 20 48 h after nitrite depletion Late exponential
0 0
5000
10,000
15,000
20,000
Nitrite (µM)
Figure 19.4 Variable nitrite oxidation kinetics of N. winogradsky is correlated with phase of growth in batch culture. Half saturation constants were determined by microrespirometry with exponentially growing cells (full circles), and cells from the same culture 48 h after nitrite depletion (open circles). Nitrite oxidation in N. winogradsky followed two-site saturation kinetics with Km values of 641.5 mM and 15.3 mM (late exponential cells), and 67.1 mM, and 4.7 mM nitrite (48 h after nitrite deletion), respectively. See text for details.
478
Willm Martens-Habbena and David A. Stahl
from early stationary phase exhibited nitrite oxidation kinetics with two apparent Km values of 641.5 mM, and 15.3 mM (late exponential cells), and 67.1 mM, and 4.7 mM nitrite (48 h after nitrite deletion), respectively. Based on its genome sequence, N. winogradsky possesses nitrite/nitrate transporters of the major facilitator super family (Starkenburg et al., 2006), suggesting that similar to N. oceani, it accesses its substrate simultaneously by expression of transporters, as well as passive diffusion of nitrous acid. In contrast, N. europaea cells harvested from batch cultures likely rely only on ammonia diffusion to supply sufficient substrate for maximum growth rates. Alternatively, also cytoarchitectural features such as the arrangement of intracellular membrane stacks could significantly affect the kinetic properties. Accordingly, the biphasic kinetic curves with two apparent Km values could represent different ammonium uptake and oxidation characteristics within different cellular compartments. More detailed studies on the kinetic properties of AOB and NOB strains and relevant mutants are necessary to further substantiate these hypotheses. The half saturation constant of N. maritimus is more than 200-fold smaller than of any AOB strain in culture and even lower than determined for heterotrophic bacteria. The lowest apparent Km values for ammonia oxidation in AOB are between 30 and 80 mM ammonium observed for Nitrosomonas oligotropha strains (Stehr et al., 1995; Suwa et al., 1994). Strains from other Nitrosomonas and Nitrosospira lineages exhibit apparent Km values between 51 mM ammonium (substrate-limited chemostat cultures of N. europaea) and more than 3900 mM (batch cultures of N. eutropha strain FH11) (Keen and Prosser, 1987; Suwa et al., 1994). There are only a few reports of in situ ammonia oxidation kinetics in natural environments. Olson et al. reported that in water samples from coastal Pacific Ocean water off the California coast nitrification was essentially saturated at 0.1 mM ammonium and could not be stimulated by additional ammonium, indicating apparent Km. values significantly below 0.1 mM (Olson, 1981). In the upper water column of the Cariaco Basin, Hashimoto et al. (1983) estimated an apparent Km of ammonia oxidation of 0.15 mM (Hashimoto et al., 1983). The in situ ammonia oxidation kinetics determined for each of these sites resembles closely the values observed in N. maritimus cultures. In contrast, in water samples from Saanich Inlet, a eutrophic and intermittently anoxic fjord in Vancouver Island, British Columbia, the in situ ammonia oxidation rate remained nearly first order with up to several mM of added ammonium, indicating apparent Km values above 10 mM (Ward and Kilpatrick, 1990). Similarly, the kinetic characteristics of in situ nitrification in soil varied with different ammonium levels (Stark and Firestone, 1996). The apparent Km values for nitrification in uncultivated and unfertilized soil areas were significantly lower than the Km of characterized AOB, whereas at higher nutrient levels the kinetics resembled those of known AOB strains (Stark and Firestone, 1996). More recent
Nitrogen Metabolism and Kinetics of AOA
479
studies substantiated this trend and found that in low nutrient soils AOA vastly outnumber AOB, whereas in fertilized soils receiving high amounts of nitrogen input, AOB represent the dominant ammonia oxidizer population (Di et al., 2009, 2010; Jia and Conrad, 2009; Leininger et al., 2006; Zhang et al., 2010). Taken together, these results suggest that substrate concentration may determine the dominance of either archaeal or bacterial ammonia oxidizer populations (Martens-Habbena et al., 2009; Schleper, 2010). The outcome of such a substrate concentration-dependent competition can be evaluated based on the specific affinity to ammonium of N. maritimus and different strains of AOB. Assuming Michaelis–Menten kinetic model, the metabolic activity of a microorganism under substrate limitation (0 < [S] Km) can be estimated according to Eq. (19.2): n ¼ Vmax Km 1 X ½S
ð19:2Þ
n, activity (g substrate l–1 h–1); Vmax, maximum activity (g substrate g wet cells–1 h–1); Km, half-saturation constant (g l–1); X, biomass (g wet cells l–1); [S], substrate concentration (g l–1). At a limiting substrate concentration ([S] ! 0), the activity of a given biomass X of a microorganism is proportional to the specific affinity (a0, Eq. (19.3)): a0 ¼ Vmax Km1
ð19:3Þ
Due to its extremely low Km value and comparable maximum activities and growth rates, the specific affinity of N. maritimus (68,700 l g wet weight–1 h–1) is more than 200-times higher than of any AOB and among the highest substrate affinities reported for any microorganism (Button, 1998; MartensHabbena et al., 2009). The specific affinities for N. europaea and N. oceani in our experiments were 38.7 and 66.5 l g cells–1 h–1, respectively, and similar to values derived from the literature. The affinity of N. maritimus for ammonium N is also higher than of most oligotrophic ammonium-assimilating organisms. Based on the reported substrate affinities, N. maritimus-like AOA will metabolize at least 30-fold more ammonium per unit biomass than any other organism under limiting ammonia concentrations, that is, less than 0.1 mM total ammonium, and thus outcompete AOB as well as other trophic guilds for ammonium (Fig. 19.5). Consistent with the in situ observations of nitrification kinetics and patterns of relative abundances of AOA and AOB, N. maritimus-like oligophilic AOA could significantly influence the nitrogen cycle especially in nutrient depleted marine and terrestrial environments, whereas known types of AOB with lower substrate affinities would be expected to play a dominant role in eutrophic environments, such as coastal environments
480
Willm Martens-Habbena and David A. Stahl
Substrate affinity (L g cells-1 h-1 )
100,000
10,000
1000
100
N .m N ar . o iti lig mu N otro s .e p ur ha o N pae .o a ce T. V ani . C ps lo E. . o eud gei co ligo ona li n (C trop a E. he hus co mo s li (B t.) at ch )
10
Figure 19.5 Substrate affinities of ammonia-oxidizing and ammonia-assimilating microorganisms in comparison to affinities of carbon-metabolizing bacteria. Substrate affinity of N. maritimus strain SCM1 and the highest substrate affinity of ammoniaoxidizing bacteria (black bars), ammonium-assimilating bacteria and diatoms (light gray bars), as well as affinities of carbon-dissimilating bacteria (dark gray bars) reported in the literature are shown. All values are based on total reduced inorganic nitrogen (NH3 þ NH4þ), see Martens-Habbena et al. (2009) for further details.
with high inputs of reactive nitrogen, eutrophic lakes and sediments, as well as agricultural soils. It should be emphasized that many AOB and possibly also some AOA possess ureases (Koops et al., 2000). Besides many other ecological factors, urea metabolism could provide an important mechanism to evade competition for ammonium, affecting growth rates, abundance, and distribution of AOA and AOB.
5. Variability of Kinetic Constants in AOB and AOA The substrate affinity of N. maritimus is surprisingly similar to the affinity of oligophilic organotrophic microorganisms for their carbon substrates. The most oligophilic microorganism for which kinetic constants have been reported is the aromatic compound-degrading bacterium Cycloclasticus oligotrophus (Button et al., 1998). When grown under substrate limitation on aromatic compounds such as phenol it shows substrate affinities based on total substrate uptake of up to 120,000 l g cells–1 h–1.
Nitrogen Metabolism and Kinetics of AOA
481
However, C. oligotrophus assimilates approximately 60% of the phenol into its biomass. Thus, its true affinity for phenol as its energy source (47,400 l g cells–1 h–1) is slightly below the value obtained for N. maritimus (Button et al., 1998). Even Escherichia coli strains can exhibit substrate affinities in a similar range after long-term adaptation to glucose-limited growth in chemostats, whereas the same strains exhibit 100-fold lower affinity to glucose during exponential growth in a batch culture (Fig. 19.5; Senn et al., 1994). Although the assimilation rate of ammonium by N. maritimus remains to be determined, based on its cell biomass and yields, it is unlikely to account for more than 5% of the total metabolized ammonium. Thus, the true substrate affinities for their energy source of N. maritimus, the most oligocarbophilic marine bacteria, and adapted E. coli strains are surprisingly similar, suggesting that the same biophysical constrains of substrate uptake and metabolism, such as surface to volume ratio of cells and density of transporter molecules in the cytoplasmic membrane, may govern the kinetic characteristics of these distantly related archaea and bacteria. A comparison of kinetic constants of AOB strains reported in the literature suggests that many AOB adapt their kinetic constants according to the growth conditions similar to heterotrophic bacteria, like C. oligotrophus and E. coli. For example, in nutrient-limited chemostats, the half saturation constants for growth (Ks) of N. europaea changes by more than one order of magnitude in relationship to substrate supply and growth rate, and is lower than determined for cell suspensions harvested from exponentially growing batch cultures (Button et al., 1998; Keen and Prosser, 1987; Suzuki et al., 1974). Similar shifts of kinetic constants should, however, also occur in batch cultures as they transition through different growth phases with changing substrate concentrations. Indeed, we could observe this plasticity of the kinetic constants by respirometry even in individual batch cultures. As shown in Fig. 19.5 for Nitrobacter winogradsky, the kinetic constants shift by more than one order of magnitude toward lower Km values, that is, higher substrate affinities, between cells from late-exponential growth phase with excess of substrate and early stationary phase cells 48 h after nitrite depletion (see above). Thus, during transition from substrate excess to limitation, N. winogradsky cells rapidly adapted their kinetic characteristics toward higher substrate affinities in a similar range as previously reported from chemostat experiments (Keen and Prosser, 1987). Interestingly, several AOB strains, for example, N. europaea, possess multiple copies of key metabolic gene clusters involved in ammonia oxidation, which could confer a broader spectrum for adapting kinetic characteristics by differentially expressing and regulating the activity of individual sets of gene clusters. In contrast to the adaptive response of substrate kinetics in AOB and NOB, the Km values for ammonia oxidation in N. maritimus were invariable between late exponential and early stationary phase cells after ammonium depletion, suggesting a constitutively low Km for ammonium and a rather
482
Willm Martens-Habbena and David A. Stahl
limited kinetic plasticity. N. maritimus and likely many other planktonic Thaumarchaeota contain only a single set of metabolic genes for ammonia catabolism and may thus represent oligophilic AOA populations genetically adapted to thrive in the most nutrient-depleted oceanic provinces where permanently high substrate affinities are a prerequisite for survival.
6. Summary and Conclusions The discovery of ammonia oxidation within the Archaea dramatically changed the perspective on this important microbial transformation in the nitrogen cycle. Initial physiological characterization of N. maritimus has for the first time yielded significant insight into the metabolism and kinetics of ammonia oxidation by AOA. Growth of this extremely oligotrophic strain was found to be very sensitive to manual perturbations. Using a novel highly sensitive respirometry technique, the kinetic characteristics of ammonia oxidation could be determined and offer direction to more detailed physiological studies. These data demonstrated for the first time that oligotrophic ammonia oxidizers exist among the AOA and that these organisms have kinetic properties sufficient to carry out ammonia oxidation even in the most oligotrophic ocean provinces. Despite the lack of direct evidence for the catalysis of ammonia oxidation in situ by nitrifying archaea, mounting evidence suggests that these organisms play a major role in the nitrogen cycle of pristine natural environments. In contrast, AOB—known for over a century—are widely distributed in nature, but are rarely abundant in natural microbial communities. It now appears that AOB have significantly lower ammonium affinities and therefore rely on higher substrate concentrations for growth. Therefore, AOB activity dominates in humanimpacted and engineered systems receiving high loads of reduced inorganic nitrogen (Di et al., 2009, 2010; Jia and Conrad, 2009; Koops et al., 2000; Prosser and Nicol, 2008). Future detailed studies particularly on novel AOA strains, for example, from clades thriving in soils and sediments, and AOB strains from the marine water column will be required to more comprehensively illuminate the ecological niches of AOA and AOB (Martens-Habbena et al., 2009; Schleper, 2010). Several biogeochemically important processes, such as nitrification and anammox, are solely carried out by slow-growing microorganisms with doubling times of days to up to several weeks. Slow growth rates are common for environmentally dominant microbial populations adapted to growth under nutrient-limited conditions. Although of obvious biogeochemical significance, obligate slow-growing microorganisms such as AOA pose significant challenges for isolation, and subsequent physiological studies in the laboratory. Physiological studies are further hampered by low
Nitrogen Metabolism and Kinetics of AOA
483
growth yields. Here, we described a simple high-resolution respirometry setup, which is particularly suited to monitor very low microbial activities. The sensitivity of the described setup should permit activity measurements of many other slow growing microorganisms and particularly facilitate tests of low substrate concentrations. Integration of the new STOX sensor with the described setup could help increasing the precision of measurements at low oxygen partial pressures, that is, below 1–2 mM. Further, this setup can be combined with many other electrochemical microsensors developed in the past (e.g., for hydrogen sulfide, hydrogen, nitrous oxide, nitric oxide, hydrogen peroxide, carbon monoxide, glucose, etc.; see Ku¨hl and Revsbech, 2001; Revsbech, 2005; Wang et al., 2008 for reviews and examples), thus, significantly extending the range of sensitive detection systems for microbial physiology experiments.
ACKNOWLEDGMENTS We thank Adam M. Gee and Emily Chang for excellent technical assistance. Hidetoshi Urakawa, Jose´ de la Torre, Paul Berube, Christopher B. Walker, Kyle C. Costa, Suvi Flagan, Donald K. Button, Martin G. Klotz, Lars Bakken, Martin Ko¨nneke, Kristina L. Hillesland, and Lars H. Larsen contributed through fruitful discussions. Martin G. Klotz and three anonymous reviewers are gratefully acknowledged for their suggestions to improve this chapter. This work was supported by NSF award MCB-0604448 to D. A. S. and Jose´ de la Torre.
REFERENCES Agogue´, H., Brink, M., Dinasquet, J., and Herndl, G. J. (2008). Major gradients in putatively nitrifying and non-nitrifying Archaea in the deep North Atlantic. Nature 456, 788–791. Arp, D. J., Chain, P. S. G., and Klotz, M. G. (2007). The impact of genome analyses on our understanding of ammonia-oxidizing bacteria. Annu. Rev. Microbiol. 61, 503–528. Beman, J. M., Sachdeva, R., and Fuhrman, J. A. (2010). Population ecology of nitrifying Archaea and Bacteria in the Southern California Bight. Environ. Microbiol. 12, 1282–1292. Bollmann, A., Ba¨r-Gilissen, M.-J., and Laanbroek, H. J. (2002). Growth at low ammonium concentrations and starvation response as potential factors involved in niche differentiation among ammonia-oxidizing bacteria. Appl. Environ. Microbiol. 68, 4751–4757. Bollmann, A., Schmidt, I., Saunders, A. M., and Nicolaisen, M. H. (2005). Influence of starvation on potential ammonia-oxidizing activity and amoA mRNA levels of Nitrosospira briensis. Appl. Environ. Microbiol. 71, 1276–1282. Brochier-Armanet, C., Boussau, B., Gribaldo, S., and Forterre, P. (2008). Mesophilic Crenarchaeota: Proposal for a third archaeal phylum, the Thaumarchaeota. Nat. Rev. Microbiol. 6, 245–252. Button, D. K. (1985). Kinetics of nutrient-limited transport and microbial growth. Microbiol. Rev. 49, 270–297. Button, D. K. (1998). Nutrient uptake by microorganisms according to kinetic parameters from theory as related to cytoarchitecture. Microbiol. Mol. Biol. Rev. 62, 636–645.
484
Willm Martens-Habbena and David A. Stahl
Button, D. K. (2000). Effect of nutrient kinetics and cytoarchitecture on bacterioplankter size. Limnol. Oceanogr. 45, 499–505. Button, D. K., Robertson, B. R., Lepp, P. W., and Schmidt, T. M. (1998). A small, dilutecytoplasm, high-affinity, novel bacterium isolated by extinction culture and having kinetic constants compatible with growth at ambient concentrations of dissolved nutrients in seawater. Appl. Environ. Microbiol. 64, 4467–4476. Button, D. K., Robertson, B., Gustafson, E., and Zhao, X. (2004). Experimental and theoretical bases of specific affinity, a cytoarchitecture-based formulation of nutrient collection proposed to supercede the michaelis-menten paradigm of microbial kinetics. Appl. Environ. Microbiol. 70, 5511–5521. Clark, L. C., Wolf, R., Granger, D., and Taylor, Z. (1953). Continuous recording of blood oxygen tensions by polarography. J. Appl. Physiol. 6, 189–193. Clegg, S. L., and Whitfield, M. (1995). A chemical model of seawater including dissolved ammonia and the stoichiometric dissociation constant of ammonia in estuarine water and seawater from 2 to 40 C. Geochim. Cosmochim. Acta 59, 2403–2421. de la Torre, J. R., Walker, C. B., Ingalls, A. E., Konneke, M., and Stahl, D. A. (2008). Cultivation of a thermophilic ammonia oxidizing archaeon synthesizing crenarchaeol. Environ. Microbiol. 10, 810–818. Di, H. J., Cameron, K. C., Shen, J. P., Winefield, C. S., O’Callaghan, M., Bowatte, S., and He, J. Z. (2009). Nitrification driven by bacteria and not archaea in nitrogen-rich grassland soils. Nat. Geosci. 2, 621–624. Di, H. J., Cameron, K. C., Shen, J.-P., Winefield, C. S., O’Callaghan, M., Bowatte, S., and He, J.-Z. (2010). Ammonia-oxidizing bacteria and archaea grow under contrasting soil nitrogen conditions. FEMS Microbiol. Ecol. 72, 386–394. Eppley, R. W., and Renger, E. H. (1974). Nitrogen assimilation of an oceanic diatom in nitrogen-limited continuous culture. J. Phycol. 10, 15–23. Francis, C. A., Beman, J. M., and Kuypers, M. M. M. (2007). New processes and players in the nitrogen cycle: The microbial ecology of anaerobic and archaeal ammonia oxidation. ISME J. 1, 19–27. Giovannoni, S. J., Tripp, H. J., Givan, S., Podar, M., Vergin, K. L., Baptista, D., Bibbs, L., Eads, J., Richardson, T. H., Noordewier, M., Rappe, M. S., Short, J. M., et al. (2005). Genome streamlining in a cosmopolitan oceanic bacterium. Science 309, 1242–1245. Glover, H. E. (1985). The relationship between inorganic nitrogen oxidation and organiccarbon production in batch and chemostat cultures of marine nitrifying bacteria. Arch. Microbiol. 142, 45–50. Gundersen, J. K., Ramsing, N. B., and Glud, R. N. (1998). Predicting the signal of O2 microsensors from physical dimensions, temperature, salinity, and O2 concentration. Limnol. Oceanogr. 43, 1932–1937. Hallam, S. J., Mincer, T. J., Schleper, C., Preston, C. M., Roberts, K., Richardson, P. M., and DeLong, E. F. (2006a). Pathways of carbon assimilation and ammonia oxidation suggested by environmental genomic analyses of marine Crenarchaeota. PLoS Biol. 4, e95. Hallam, S. J., Konstantinidis, K. T., Putnam, N., Schleper, C., Watanabe, Y.-i., Sugahara, J., Preston, C., de la Torre, J., Richardson, P. M., and DeLong, E. F. (2006b). Genomic analysis of the uncultivated marine crenarchaeote Cenarchaeum symbiosum. Proc. Natl. Acad. Sci. USA 103, 18296–18301. Harder, W., and Dijkhuizen, L. (1983). Physiological responses to nutrient limitation. Annu. Rev. Microbiol. 37, 1–23. Hashimoto, L. K., Kaplan, W. A., Wofsy, S. C., and McElroy, M. B. (1983). Transformations of fixed nitrogen and N2O in the Cariaco Trench. Deep Sea Res. 30, 575–590. Hatzenpichler, R., Lebecleva, E. V., Spieck, E., Stoecker, K., Richter, A., Daims, H., and Wagner, M. (2008). A moderately thermophilic ammonia-oxidizing crenarchaeote from a hot spring. Proc. Natl. Acad. Sci. USA 105, 2134–2139.
Nitrogen Metabolism and Kinetics of AOA
485
Herrmann, M., Saunders, A. M., and Schramm, A. (2009). Effect of kake trophic status and rooted macrophytes on community composition and abundance of ammonia-oxidizing prokaryotes in freshwater sediments. Appl. Environ. Microbiol. 75, 3127–3136. Holmes, R. M., Aminot, A., Ke´rouel, R., Hooker, B. A., and Peterson, B. J. (1999). A simple and precise method for measuring ammonium and marine and freshwater ecosystems. Can. J. Fish. Aquat. Sci. 56, 1801–1809. Hooper, A. B. (1989). Biochemistry of nitrifying lithoautotrophic bacteria. In “Autotrophic Bacteria,” (H.-G. Schlegel and B. Bowien, eds.), pp. 239–266. Springer, New York. Jia, Z., and Conrad, R. (2009). Bacteria rather than Archaea dominate microbial ammonia oxidation in an agricultural soil. Environ. Microbiol. 11, 1658–1671. Jiang, Q. Q., and Bakken, L. R. (1999). Comparison of Nitrosospira strains isolated from terrestrial environments. FEMS Microbiol. Ecol. 30, 171–186. Karner, M. B., DeLong, E. F., and Karl, D. M. (2001). Archaeal dominance in the mesopelagic zone of the Pacific Ocean. Nature 409, 507–510. Keen, G. A., and Prosser, J. I. (1987). Steady state and transient growth of autotrophic nitrifying bacteria. Arch. Microbiol. 147, 73–79. Klotz, M. G., Arp, D. J., Chain, P. S. G., El-Sheikh, A. F., Hauser, L. J., Hommes, N. G., Larimer, F. W., Malfatti, S. A., Norton, J. M., Poret-Peterson, A. T., Vergez, L. M., and Ward, B. B. (2006). Complete genome sequence of the marine, chemolithoautotrophic, ammonia-oxidizing bacterium Nitrosococcus oceani ATCC 19707. Appl. Environ. Microbiol. 72, 6299–6315. Ko¨nneke, M., Bernhard, A. E., de la Torre, J. R., Walker, C. B., Waterbury, J. B., and Stahl, D. A. (2005). Isolation of an autotrophic ammonia-oxidizing marine archaeon. Nature 437, 543–546. Koops, H.-P., Purkhold, U., Pommerening-Ro¨ser, A., Timmermann, G., and Wagner, M. (2000). The lithoautotrophic ammonia-oxidizing bacteria. In “The Prokaryotes: An Evolving Electronic Resource for the Microbiological Community,” (M. Dworkin, ed.).Springer-Verlag, New York, 3 release 3.13 ed., http://link.springer-ny.com/link/ service/books/10125/. Kowalchuk, G. A., and Stephen, J. R. (2001). Ammonia-oxidizing bacteria: A model for molecular microbial ecology. Annu. Rev. Microbiol. 55, 485–529. Ku¨hl, M., and Revsbech, N. P. (2001). Biogeochemical microsensors for boundary layer studies. In “The Bentic Boundary Layer,” (B. P. Boudreau and B. B. Jrgensen, eds.), pp. 180–210. Oxford University Press, New York. Leininger, S., Urich, T., Schloter, M., Schwark, L., Qi, J., Nicol, G. W., Prosser, J. I., Schuster, S. C., and Schleper, C. (2006). Archaea predominate among ammonia-oxidizing prokaryotes in soils. Nature 442, 806–809. Loureiro, S., Jauzein, C., Garce´s, E., Collos, Y., Camp, J., and Vaque´, D. (2009). The significance of organic nutrients in the nutrition of Pseudo-nitzschia delicatissima (Bacillariophyceae). J. Plankton Res. 31, 399–410. Lunau, M., Lemke, A., Walther, K., Martens-Habbena, W., and Simon, M. (2005). An improved method for counting bacteria from sediments and turbid environments by epifluorescence microscopy. Environ. Microbiol. 7, 961–968. Martens-Habbena, W., Berube, P. M., Urakawa, H., de la Torre, J. R., and Stahl, D. A. (2009). Ammonia oxidation kinetics determine niche separation of nitrifying archaea and bacteria. Nature 461, 976–979. Mincer, T. J., Church, M. J., Taylor, L. T., Preston, C., Karl, D. M., and DeLong, E. F. (2007). Quantitative distribution of presumptive archaeal and bacterial nitrifiers in Monterey Bay and the North Pacific Subtropical Gyre. Environ. Microbiol. 9, 1162–1175. Olson, R. J. (1981). N-15 tracer studies of the primary nitrite maximum. J. Mar. Res. 39, 203–226.
486
Willm Martens-Habbena and David A. Stahl
Pouvreau, L. A. M., Strampraad, M. J. F., Van Berloo, S., Kattenberg, J. H., and de Vries, S. (2008). NO, N2O, and O2 reaction kinetics: Scope and limitations of the Clark electrode. In “Globins and Other Nitric Oxide-Reactive Proteins, pt A,” (R. K. Poole, ed.), pp. 97–112. Elsevier Academic Press Inc., San Diego. Prosser, J. I. (1986). Nitrification. IRL Press, Oxford, UK. Prosser, J. I. (1989). Autotrophic nitrification in bacteria. Adv. Microbial Phys. 30, 125–181. Prosser, J. I., and Nicol, G. W. (2008). Relative contributions of archaea and bacteria to aerobic ammonia oxidation in the environment. Environ. Microbiol. 10, 2931–2941. Rappe´, M. S., Connon, S. A., Vergin, K. L., and Giovannoni, S. J. (2002). Cultivation of the ubiquitous SAR11 marine bacterioplankton clade. Nature 418, 630–633. Reay, D. S., Nedwell, D. B., Priddle, J., and Ellis-Evans, J. C. (1999). Temperature dependence of inorganic nitrogen uptake: Reduced affinity for nitrate at suboptimal temperatures in both algae and bacteria. Appl. Environ. Microbiol. 65, 2577–2584. Renger, G., and Hanssum, B. (2009). Oxygen detection in biological systems. Photosynth. Res. 102, 487–498. Revsbech, N. P. (1989). An oxygen microsensor with a guard cathode. Limnol. Oceanogr. 34, 474–478. Revsbech, N. P. (2005). Analysis of microbial communities with electrochemical microsensors and microscale biosensors. In “Environmental Microbiology,” ( J. R. Leadbetter, ed.), Methods Enzymol. 397, pp. 147–166. Academic Press, Oxford. Revsbech, N. P., and Jrgensen, B. B. (1986). Microelectrodes: Their use in microbial ecology. In “Advances in Microbial Ecology,” (K. C. Marshall, ed.), pp. 293–304. Plenum Press, New York. Revsbech, N. P., Larsen, L. H., Gundersen, J., Dalsgaard, T., Ulloa, O., and Thamdrup, B. (2009). Determination of ultra-low oxygen concentrations in oxygen minimum zones by the STOX sensor. Limnol. Oceanogr. Methods 7, 371–381. Roszak, D. B., and Colwell, R. R. (1987). Survival strategies of bacteria in the natural environment. Microbiol. Rev. 51, 365–379. Schleper, C. (2010). Ammonia oxidation: Different niches for bacteria and archaea? ISME J. 4, 1092–1094. Schleper, C., and Nicol, G. W. (2010). Ammonia-oxidising archaea—Physiology, ecology and evolution. In “Advances in Microbial Physiology,” (R. K. Poole, ed.), Vol 57, pp. 1–41. Academic Press, Oxford. Schleper, C., Jurgens, G., and Jonuscheit, M. (2005). Genomic studies of uncultivated archaea. Nat. Rev. Microbiol. 3, 479–488. Senn, H., Lendenmann, U., Snozzi, M., Hamer, G., and Egli, T. (1994). The growth of Escherichia coli in glucose-limited chemostat cultures: A re-examination of the kinetics. Biochim. Biophys. Acta 1201, 424–436. Simon, M., and Azam, F. (1989). Protein content and protein synthesis rates of planktonic marine bacteria. Mar. Ecol. Prog. Ser. 51, 201–213. Spang, A., Hatzenpichler, R., Brochier-Armanet, C., Rattei, T., Tischler, P., Spieck, E., Streit, W., Stahl, D. A., Wagner, M., and Schleper, C. (2010). Distinct gene set in two different lineages of ammonia-oxidizing archaea supports the phylum Thaumarchaeota. Trends Microbiol. 18, 331–340. Stark, J. M., and Firestone, M. K. (1996). Kinetic characteristics of ammonium-oxidizer communities in a California oak woodland-annual grassland. Soil Biol. Biochem. 28, 1307–1317. Starkenburg, S. R., Chain, P. S. G., Sayavedra-Soto, L. A., Hauser, L., Land, M. L., Larimer, F. W., Malfatti, S. A., Klotz, M. G., Bottomley, P. J., Arp, D. J., and Hickey, W. J. (2006). Genome sequence of the chemolithoautotrophic nitrite-oxidizing bacterium Nitrobacter winogradsky Nb-255. Appl. Environ. Microbiol. 72, 2050–2063.
Nitrogen Metabolism and Kinetics of AOA
487
Stehr, G., Bo¨ttcher, B., Dittberner, P., Rath, G., and Koops, H. P. (1995). The ammoniaoxidizing nitrifying population of the River Elbe estuary. FEMS Microbiol. Ecol. 17, 177–186. Stickland, J. D. H., and Parsons, T. R. (1972). A Practical Handbook of Seawater Analysis. 2nd edn. Fisheries Research Board of Canada, Ottawa. Suwa, Y., Imamura, Y., Suzuki, T., Tashiro, T., and Urushigawa, Y. (1994). Ammoniaoxidizing bacteria with different sensitivities to (NH4)2SO4 in activated sludges. Water Res. 28, 1523–1532. Suzuki, I., Dular, U., and Kwok, S. C. (1974). Ammonia or ammonium ion as substrate for oxidation by Nitrosomonas europaea cells and extracts. J. Bacteriol. 120, 556–558. Treusch, A. H., Leininger, S., Kletzin, A., Schuster, S. C., Klenk, H.-P., and Schleper, C. (2005). Novel genes for nitrite reductase and Amo-related proteins indicate a role of uncultivated mesophilic crenarchaeota in nitrogen cycling. Environ. Microbiol. 7, 1985–1995. Walker, C. B., de la Torre, J. R., Klotz, M. G., Urakawa, H., Pinel, N., Arp, D. J., BrochierArmanet, C., Chain, P. S. G., Chan, P. P., Gollabgir, A., Hemp, J., Hu¨gler, M., et al. (2010). Nitrosopumilus maritimus genome reveals unique mechanisms for nitrification and autotrophy in globally distributed marine crenarchaea. Proc. Natl. Acad. Sci. USA 107, 8818–8823. Wang, W., Richardson, A. R., Martens-Habbena, W., Stahl, D. A., Fang, F. C., and Hansen, E. J. (2008). Identification of a repressor of a truncated denitrification pathway in Moraxella catarrhalis. J. Bacteriol. 190, 7762–7772. Ward, B. B. (1987). Kinetic studies on ammonia and methane oxidation by Nitrosococcus oceanus. Arch. Microbiol. 147, 126–133. Ward, B. B. (1990). Kinetics of ammonia oxidation by a marine nitrifying bacterium: Methane as a substrate analogue. Microb. Ecol. 19, 211–225. Ward, B. B., and Kilpatrick, K. A. (1990). Relationship between substrate concentration and oxidation of ammonium and methane in a stratified water column. Cont. Shelf Res. 10, 1193–1208. Watson, S. W. (1965). Characteristics of a marine nitrifying bacterium, Nitrosocystis oceanus sp. N. Limnol. Oceanogr. 10, R274–R289. Wuchter, C., Abbas, B., Coolen, M. J. L., Herfort, L., van Bleijswijk, J., Timmers, P., Strous, M., Teira, E., Herndl, G. J., Middelburg, J. J., Schouten, S., and Sinninghe Damste, J. S. (2006). Archaeal nitrification in the ocean. Proc. Natl. Acad. Sci. USA 103, 12317–12322. Zhang, L.-M., Offre, P. R., He, J.-Z., Verhamme, D. T., Nicol, G. W., and Prosser, J. I. (2010). Autotrophic ammonia oxidation by soil thaumarchaea. Proc. Natl. Acad. Sci. USA 107, 17240–17245.
Author Index
A Abascal, F., 20 Abbas, B., 6, 43, 384, 466 Abell, G. C., 42 Abrahamse, P. A., 144 Abrams, E. S., 204 Abreu, I. A., 412–413 Aciero, D., 40 Ackerman, I. L., 116–117 Ackermann, B., 359 Adam, B., 103–104 Adamczyk, J., 202, 278, 389 Adams, M. D., 290 Adman, E. T., 412 Aebersold, R., 436–438 Agarwala, R., 308 Agogue´, H., 466 Ahlers, B., 359 Ahmed, A., 440 Aires, L., 116 Aita, C., 94–95, 100 Akhidime, I. D., 258 Akimoto, S., 416 Alawi, M., 186, 203, 294 Albrechtsen, H. J., 186 Aldrigde, J., 79–80 Alexander, N. J., 352 Allen, A. E., 359 Allen, D. E., 65 Allen, J. F., 346 Aller, R. C., 65, 82 Allmaras, R. R., 117 Almeida, G., 406–407 Almeida, J. S., 188 Altabet, M. A., 80 Altieri, K., 347 Altmann, D., 293 Altman, W. E., 301 Altschul, S. F., 46 Alzerreca, J. J., 21, 40, 44, 313 Amann, R. I., 38, 66–69, 77, 79, 104–105, 164, 167, 175, 179, 186–187, 189, 202–203, 239, 276, 278–280, 293 Amano, T., 38, 66–68, 70 Amberger, A., 150 Aminot, A., 469 Ananiev, G., 330 Andersen, G. L., 389
Andersen, J. B., 188 Andersen, K., 166 Andersen, M. K., 95 Anderson, I. C., 65 Anderson, J. B., 426 Andrade, S. L. A., 401 Andreani, M., 80 Andreasen, K. H., 165, 172, 175, 177, 187 Andrews, P. C., 453 Angers, D. A., 94, 100 Angove, H. C., 359, 406–407, 412, 415–416 An, L., 50 Anneser, B., 189, 203, 208–209, 211 Anraku, Y., 400–401 Ansorge, W. J., 364 Antipov, A. N., 406, 408, 412, 416 Antonescu, C., 312 Antonioli, P., 437 Antonucci, F., 437 Apweiler, R., 308 Aragno, M., 68, 70 Arah, J. R. M., 117 Aravind, L., 321, 328, 342 Archer, M., 404, 406–407, 413, 417–418 Arciero, D. M., 40, 227, 243, 409, 424–425 Arckens, L., 437 Arendsen, A. F., 413 Arnaiz, C., 251 Arp, D. J., 5, 14–15, 21, 37, 40, 145, 186, 189, 219, 226–228, 242–244, 291, 293, 304, 357, 359–362, 424–425, 430, 466–467, 477–478 Arrigo, K. R., 347 Arts, P. A. M., 257 Arumugam, M., 313 Arvin, E., 186 Ashburner, M., 308 Asirvatham, V. S., 450, 452, 459 Aßmuss, B., 187 Assmus, B., 175 Astner, H., 437 Atkinson, B., 250–251, 256, 258 Atkinson, K. R., 440 Atkinson, S. J., 407, 410 Attiya, S., 301 Attwood, T. K., 308 Audeh, M., 204 Auer, N., 439 Augspurger, C., 189 Auguet, J.-C., 14
489
490
Author Index
Augustine, A. J., 424 August, P. R., 321 Aury, J. M., 305 Ausubel, F. M., 230, 364 Avrahami, S., 46, 358 Ayala-del-Rio, H. L., 358 Azam, F., 470 Azimi, N., 303 Aziz, R. K., 309–310 B Ba˚a˚th, E., 94 Babu, M., 348, 352 Backman, V., 384 Bader, J. S., 301 Badger, J. H., 308 Badretdin, A., 308 Bae, H., 46 Bae, J.-W., 66–67, 71–73 Baggs, E. M., 93, 141, 155–156 Bailey, C. M., 309 Bailey, M. J., 7 Bairoch, A., 308 Baker, A. R., 347 Baker, M. S., 437 Bakken, L. R., 93, 99–100, 470 Bakke, P., 310 Baldock, J. A., 94 Baldwin, M. J., 121 Ball, T., 116 Bamford, V. A., 406–407, 412, 415–416 Bandick, A. K., 94 Ban˜eras, L., 14 Bano, N., 186 Bantscheff, M., 438 Baptista, D., 467 ˆ .R., 71, 77, 305, 321, 358 Barbe, V.A Barcza, Z., 116 Bardawill, C. J., 222 Barford, C., 80 Ba¨r-Gilissen, M.-J., 476 Baron, V. S., 116 Baross, J., 346 Barrie, A., 96 Bartels, D., 306, 309–310 Bartholomew, W. V., 95–96, 103 Bartol-Marvel, D., 71, 77 Bartol-Mavel, D., 321, 358 Barton, L. L., 402 Bartossek, R., 41, 154, 319, 321, 342, 359 Bartunik, H. D., 402, 404–406, 410 Basu, P., 402 Bateman, A., 308 Bates, S. T., 11 Battin, T. J., 189 Baudouin-Cornu, P., 437 Bauer, M., 351
Baumann, K., 94 Baxter, J. D., 349 Bayer, K., 439 Bazmi, H., 353 Beare, M. H., 92 Beaumont, H. J. E., 424 Beckloff, N., 289 Beck, N. A., 240 Bedard-Haughn, A., 117, 119, 140 Beer, C., 255 Behrens, S., 105, 108 Beja, O., 321, 328, 342 Bekunda, M., 347 Belasco, J. G., 354 Belelli, L., 116 Bellucci, M., 269 Belmonte, M. K., 302 Belokopitov, V., 77 Beltrami, H., 116, 128 Belvedere, O., 295 Beman, J. M., 5, 12–13, 18, 23, 37, 41, 43–46, 293, 358, 374, 384, 388–389, 466 Bemben, L. A., 301 Bendtsen, J. D., 308 Benes, V., 353 Bengtson, P., 93 Bengtsson, G., 93 Bennett, J., 92 Benson, D. A., 102, 290 Bent, S. J., 17 Beppu, T., 154 Berelson, W. M., 77 Berg, I. A., 14–15 Berg-Lyons, D., 11 Bergman, B., 103–104 Bergman, D. J., 359 Bergmann, D., 359 Bergman, N. H., 352 Berg, P., 121 Beringer, J., 116, 127 Berkelman, T., 442 Berks, B. C., 400 Bernhard, A. E., 5, 12–13, 36, 41, 43, 46, 186, 294, 359, 466 Bernhard, J. M., 77 Bernhardt, J., 437 Bernoux, M., 117 Berriman, M., 295 Berth, M., 437 Berube, P. M., 40, 291, 293, 359, 389, 425, 467–468, 474–476, 479–480, 482 Berven, F. S., 437, 454 Besemer, J., 308 Best, A. A., 309–310 Bettermann, A. D., 321 Betts, J. C., 454 Beyenal, H., 188 Bhandari, B., 145
Author Index
Bibbs, L., 467 Bickerdike, M., 295 Billesbach, D., 116 Binns, D., 308 Birch, J. R., 448, 452–453 Birney, E., 302 Birol, I., 302 Birren, B., 295, 321, 324 Birrien, J. L., 79 Bissett, A. P., 42 Bjellqvist, B., 437 Bjerrum, L., 167, 186–187, 239 Black, G. M., 250–251, 256, 258 Black, L., 308 Black, M. A., 440 Blackmore, R., 402 Blackshields, G., 46 Blad, B. L., 126 Blair, N., 101 Blakis, A., 186 Blasco, R., 359 Blomberg, A., 440 Blume, E., 121 Bock, E., 186, 294, 358–359 Bockman, O. C., 140 Bodelier, P. L. E., 40 Bodrossy, L., 378, 381, 389 Boeckx, P., 151, 153 Boehm, A. B., 37, 43–45, 358, 384 Boehrer, B., 66 Bo˜hlke, J. K., 80 Bo¨hlke, J. K., 65, 151, 155 Boiko, K. M., 406 Boisvert, S., 302 Boles, T. C., 204 Bollmann, A., 470, 476 Bolton, H., Jr., 9 Bonal, D., 116 Bonch-Osmolovskaya, L., 12, 19 Bongaerts, R. J., 348 Bonin, P. C., 82, 84, 153 Bonnard, G., 407 Bonventre, J., 102 Boone, R. D., 116 Boon, N., 37 Booth, M. G., 359 Bordalo, A. A., 186 Bo¨rjesson, G., 93 Bork, P., 308 Borodovsky, M., 308 Borrego, C. M., 14 Boschker, H. T. S., 29 Bo¨ttcher, B., 470, 478 Botte, J., 151 Bottomley, P. J., 25, 40, 91–92, 94, 101, 103–105, 107, 219, 227–228, 244, 291, 293, 359, 425, 478 Bouchez, T., 105
491 Bourbonnais, A., 77 Bourenkov, G. P., 402, 404–406, 408, 410, 412, 416 Bouskill, N. J., 373, 377, 384–386 Boussau, B., 6, 466–467 Bouwman, A. F., 65 Bowatte, S., 479, 482 Boxer, S. G., 102 Boyer, E. W., 150 Boyko, K. M., 406, 408, 412, 416 Boyle-Yarwood, S. A., 25 Bradford, E., 116 Braker, G., 46, 358 Brandes, J. A., 359 Brandmuller, A., 440 Brandt, M., 94, 100 Bratke, K. A., 308 Brazzorrotto, D., 258 Breland, T. A., 93 Bremer, H., 352 Brenden, M., 364 Brent, R., 230 Brettar, I., 154 Brettske, I., 45–46 Breznak, J. A., 155, 359 Brink, M., 466 Brinkman, F. S., 307 Brinza, D., 302 Briones, A. M., 186 Britschgi, T. B., 45 Brittain, T., 402 Brochier-Armanet, C., 6, 41, 186, 357, 359, 425, 466–467 Brodie, E. L., 389 Brookes, P. C., 99 Brooks, P. D., 144 Brown, A., 251, 260 Brown, B., 353 Brownley, A., 303 Brown, N. P., 46 Brown, P. O., 375, 380 Brown, S. M., 126 Bruce, D. A., 357, 359 Bru¨hl, A., 189 Brummell, M. E., 115 Brunak, S., 308 Brunet, R. C., 154 Bruns, M. A., 327 Bruns, M. V., 5 Brus, D., 144, 152 Brzezinski, E. E., 439–440, 447, 449–450 Buchner, A., 45–46 Buchwald, C., 146, 155 Buckel, W., 14–15 Buckingham-Meyer, K., 240 Buffiere, P., 251 Bukka, A., 352 Bukovska, A., 231
492
Author Index
Bulliard, V., 308 Bulow, S. E., 66, 74, 76, 377, 389 Bungartz, H.-J., 188 Burgdorf, K. S., 313 Burggraf, S., 154 Burgin, A. J., 153 Burlat, B., 415–416 Burns, D. A., 150 Burns, L. C., 117 Burnum, K. E., 101 Burow, L. C., 65 Burton, E. O., 238, 435 Busam, D., 305 Bush, A., 43, 46 Bustin, S. A., 353–354 Butler, C. S., 359, 400 Butler, J. N., 231, 302 Butler, M. K., 64, 360 Butt, J. N., 406–407, 410, 412, 415–416 Button, D. K., 467–468, 470, 479–481 Byrne, N., 79 Byrom, S., 258 C Cabello, P., 154, 359 Cai, Z., 347 Caldwell, D. E., 186 Cameron, K. C., 479, 482 Campbell, B. J., 359 Campbell, M., 345 Camp, J., 470 Campostrini, N., 437 Canfield, D. E., 38, 65–67, 79, 358 Cantera, J. J., 41 Canuel, E. A., 65 Cao, H., 35, 37, 40, 43, 47 Capone, D. G., 103–104, 108, 347 Caporaso, J. G., 11 Caprioli, R. M., 101 Cardon, Z. G., 98 Carey, S. K., 117, 128 Carney, N., 310 Carvalho, J. E. M., 116–117 Cary, S. C., 359 Casamayor, E. O., 14 Casciotti, K. L., 80, 84, 145–146, 151, 155, 293 Caskey, W. H., 153 Castagna, A., 437 Castillo, F., 359 Cathala, G., 349 Cattaˆnio, J. H., 116–117 Ceasar, R., 440 Cecconi, D., 437 Cerutti, L., 308 Ceschia, E., 116 Chadoeug, J., 101 Chaffron, S., 308
Chain, P. S. G., 37, 40, 186, 227, 243, 289–293, 304–305, 357, 359, 361–362, 424–425, 466–467, 477–478 Chaisson, M. J., 302 Chalamet, A., 153 Chalkley, R., 295 Chandler, D. P., 9 Chandran, K., 238 Chandra, S., 101 Chang, B. X., 66, 74, 76, 79 Chang, L., 13, 27, 293 Chan, P. P., 186, 357, 359, 425, 466–467 Chapin, F. S., 347 Chapman, S. K., 407, 410 Chapuis-Lardy, L., 117 Chaudhuri, R. R., 309 Chedin, S., 437 Cheesman, M. R., 406, 410 Chen, F., 352, 365 Chen, G. L., 308 Chen, H., 50, 348, 352 Chen, I. M., 309–310 Chen, J., 92 Chenna, R., 46 Chen, P., 38, 43–45, 47, 54, 66–68, 74, 76–77 Chen, R., 37–38, 40, 43–49, 52–55, 66–68, 74, 76–77 Chen, S., 45, 47, 54, 66 Chenu, C., 94, 100–101 Chen, Y., 190 Chetvernin, S., 308 Chevalier, F., 437 Chevallet, M., 438 Chich, J. F., 440 Chick, J. M., 437 Chien, D. M., 386 Chirgwin, J. M., 349 Chitsaz, F., 426 Choe, L. H., 454, 457–458 Choi, H., 436 Choi, O., 219 Choi, P. J., 348, 352 Chomczynski, P., 349, 355 Chong, S. C., 377 Chotte, J.-L., 117 Chris Detter, J., 289 Christensen, B. B., 188 Christensen, D., 177 Christensen, S., 120 Christensen, T. R., 121 Chu, K., 309–310 Church, M. J., 43, 466 Cikos, S., 231 Cirpus, I., 44, 67, 69, 358 Ciufo, S., 308 Clark-Curtiss, J. E., 364 Clarke, T. A., 406–407, 410, 415–416, 418 Clark, I., 77
493
Author Index
Clark, L. C., 470 Claus, R. A., 351 Clayton, R. A., 290 Clegg, C. D., 293 Clegg, S. L., 470 Cleugh, H., 127 Cliff, J. B., 101–105, 107–108 Clode, P. L., 101–102, 104, 106–108 Cochrane, B., 348 Coffin, J. M., 353 Coggill, P., 308 Cohen, P. S., 26 Cohen, Y., 189 Cole, J. A., 359, 400–402, 404, 406–407, 410, 412, 415–416, 418 Coleman, D. C., 92 Collins, J., 321 Collos, Y., 470 Colwell, R. R., 467 Conen, F., 116 Connon, S. A., 467 Cono, V. L., 12, 14 Conrad, R., 7, 46, 116, 120, 358, 479, 482 Conway, C., 295 Coolen, M. J. L., 6, 43, 153, 384, 466 Coon, J. J., 437 Corbeil, J., 302 Cornell, S., 347 Cornwell, J. C., 65 Corre, M. D., 119 Coskuner, G., 270, 276, 281, 283 Costa, C., 404, 406–407, 409 Costerton, J. W., 186 Costesso, D. D., 254 Cottrell, J. S., 444 Cottrell, M. T., 172 Cowtan, K., 431 Crabtree, J., 309 Crawford, J. W., 92 Creasy, D. M., 444 Creevey, C., 308 Crepeau, V., 79 Criddle, C. S., 46, 377 Crossley, D. A., 92 Crossman, L. C., 400 Cruaud, C., 305 Cruz, J. A., 309 Cummings, L., 308 Cunha, C. A., 406–407 Curmi, P., 416 Curtis, T. P., 21, 269, 283 Cynamon, M., 352 Cytryn, E., 203 Czimczik, C. I., 121 D Daae, F. L., 12 Daigger, G. T., 261
Dai, H. Y., 382 Daims, H., 11, 71, 77, 172, 185–187, 189, 191–192, 201–209, 211, 270, 273, 277–278, 282, 293–294, 321–322, 358–359, 466 Dale, O. R., 38, 65–68, 70, 74, 79–80, 82 Daligault, H. E., 289 Dalsgaard, T., 38, 65–67, 78–80, 82–83, 358, 474 Daly, C., 295 Damste´, J. S. S., 65, 186 Dang, H., 35, 37–40, 43–50, 52–55, 66–68, 74, 76–77 Daniel, H., 126–127 Dapena, A., 44, 67, 69 Datta, R. S., 308 Davenport, K. W., 289 Davenport, R. J., 21, 283 David, M. M., 222 David, O., 440 Davidson, E. A., 95–97, 116–117, 120–121 Davies, C. A., 79–80 Davison, L., 79 Dazzo, F. B., 189 DeAngelis, K. M., 93 de Baets, B., 151 de Beer, D., 64, 166–168, 171, 186–187, 189, 203, 242, 250, 293, 360 de Boer, W., 5 Debouzie, D., 99, 101 de Brouwer, J. F., 188 de Bruijn, P., 36, 65 de Castro, E., 308 Dechesne, A., 92, 94, 99 Decker, E. M., 171 Deflandre, B., 78–82 de Jong, E., 128 DeJongh, M., 309–310 de Jong, P. J., 321, 324 de la Torre, J. R., 5, 12–15, 21, 36, 41, 186, 203, 291, 293–294, 357, 359, 389, 425, 466–468, 474–476, 479–480, 482 Delcher, A. L., 303, 308, 312 Dell, C. J., 117 Deloache, W., 310 DeLong, E. F., 12, 14–15, 21, 23, 43, 105, 186–187, 276, 320–321, 328, 359, 466–467 del Prado, A., 153 Dempfle, L., 354 Dempsey, M. J., 247, 251, 255–256, 258, 260 Denaro, R., 12, 14 den Camp, H. J. M. O., 408, 425 de Neergaard, A., 94, 100 Deng, X., 440 Deng, Y., 381, 389 Denison, R. F., 40 Dennison, V., 415–416 Dennis, P. P., 352 Dentener, F., 347 De Paepe, A., 353
494 De Preter, K., 353 Derbyshire, M. K., 426 DeRisi, J. L., 375 DeRito, C. M., 101 DeSantis, T. Z., 389 Desiderio, D. M., 450, 452 de Sieyes, N. R., 37, 43–45, 384 Dessaux, Y., 93 Dethlefsen, L., 20 Deutsch, C., 359 Devito, K. J., 126 Devol, A. H., 40, 44, 66–70, 74, 76, 79, 358–359 Devraj, K., 437 de Vries, S., 71, 470, 474 de Vries, W., 402 de Waal, E. C., 17–18, 273–274 Dewar, R. L., 353 DeWeese-Scott, C., 426 de Winter, A., 295 de Wit, C. A., 347 Dias, J. M., 406–407 Dick, J., 140 Dick, R. P., 94 Diederichs, K., 413 Diemer, H., 438 Diercks, A., 351 Di, H. J., 479, 482 Dijkhuizen, L., 467 Dinasquet, J., 466 Ding, Y., 39, 47, 50 DiRisi, J. L., 380 Dispirito, A. A., 424 Distel, D. L., 102, 104, 108, 188 Disz, T., 309–310 Dittberner, P., 470, 478 Diz, A. P., 440 Dobbie, K. E., 116 Dodson, E. J., 431 Doerks, T., 308 Doherty, M. K., 407, 410 Dolan, M. E., 219, 224, 226–229, 238, 242 Dolfing, J., 141, 144, 146, 152 Dollinger, G., 353 Domazet-Loso, T., 377, 384 Donaldson, A., 384 Donati, C., 312 Dondoshansky, I., 308 Dong, L. F., 65, 359 Dong, X., 309 Donovan, C., 188 Donrad-Koszler, M., 389 Dorador, C., 40 Dorovatovskii, P. V., 406 Douglas, R., 77 Dowd, S. R., 437–438 Downward, J., 230 Doyle, R. M. A. S., 406, 410 Drewette, K., 407, 410
Author Index
Drobner, E., 154 D’Souza, M., 310 Dua, R. D., 145 Du, B., 71 Duce, R. A., 347 Dudley, J., 46 Duerrschmid, K., 439 Dufva, I. H., 351, 354 Dufva, M., 351, 354 Dular, U., 223, 470, 481 Dunbar, J., 322 Duncan, K., 454 Dunn, I. J., 255 Dunn, M. J., 453 Dupree, P., 447, 452 Durbin, R., 295 Durisch-Kaiser, E., 66–67 Durka, W., 150 Du¨rr, C., 189 Dutilh, B. E., 64, 360 Dutt, M. J., 453 E Eads, J., 467 Eaves, D. J., 400, 404, 407 Eberl, L., 188–189 Eck, J., 342 Eddy, S. R., 307–308 Edwards, R. A., 309–310 Egholm, M., 301 Egli, T., 470, 481 Ehlers, S., 359 Ehrenberg, M., 352 Eichler, R., 401 Einsle, O., 358, 399–407, 409–414, 417–418 Eisel, F., 407, 410 Eisen, J. A., 13, 36, 293, 359, 374 Elberling, B., 121 Ellert, B. H., 151 Elliott, E. M., 150–151 Elliott, E. T., 94, 98 Elliott, J. A., 120 Ellis-Evans, J. C., 470 Elmaleh, S., 251 El-Sheikh, A. F., 291, 293, 361–362, 425, 477 Elvers, K. T., 359 Ely, R. L., 219, 222, 226–229, 242 Emadali, A., 436 Embley, T. M., 5, 36, 40, 46 Emili, A., 348, 352 Emory, S. A., 354 Emsley, P., 431 Engelbrektson, A., 21 Enger, W. A., 251 Engstro¨m, P., 65–66, 79, 82–84 Enrich-Prast, A., 65–66, 79, 82–83 Eppley, R. W., 470
495
Author Index
Erguder, T. H., 37 Erisman, J. W., 347 Erler, D. V., 79 Ermler, U., 413 Ernst, J., 389 Ersboll, B. K., 188 Escribano, R., 79 Ettwig, K. F., 64–65, 360 Evans, C., 437 Eveillard, D., 377, 384–386 Eyre, B. D., 79 F Faergestad, E. M., 440 Falkengren-Grerup, U., 93 Falk, S., 358 Fallon, S. J., 103–104, 108 Fang, C., 121 Fange, D., 352 Fang, F. C., 483 Fang, J., 190 Fang, X., 302 Faraco, V., 424 Farias, L., 79 Farinelli, L., 303 Farrell, R. E., 117, 119–120, 128, 140 Faulkner, R. D., 101, 126–127 Faulkner, S. P., 121 Fedorova, N. D., 308 Fedorov, B., 308 Feldblyum, T., 305 Feldman, R. A., 320–321 Felsenstein, J., 45–46 Feng, K., 140 Feng, X. J., 438 Feret, R., 437–438 Ferguson, S. J., 117, 359, 400 Fermin, D., 436 Fernandez-Busnadiego, R., 424 Ferriera, S., 305 Fesefeldt, A., 358 Fiandaca, M., 67 Fields, M., 377, 381 Fiencke, C., 186, 294 Fierer, N., 11 Fike, D. A., 189 Filimonenkov, A. A., 406 Fillery, I. R. P., 95, 98 Findlay, R. H., 9 Finlay, R. D., 93 Finn, R. D., 308 Finzi-Hart, J. A., 103–104 Finzi, J. A., 103–104, 108 Firestone, M. K., 93, 95–97, 99–100, 104, 116–117, 120, 470, 478 Firestone, R. B., 117 Fischer, J. C. V., 155
Fishback, L. A. E., 119, 140 Fishbain, S., 189 Fitzgerald, M. G., 305 Flandrois, J. P., 99 Flardh, K., 26 Fleischmann, R. D., 290 Flessa, H., 155–156 Fletcher, I. R., 101, 104, 106–107 Flood, F., 250 Flood, J., 203 Fockler, C., 353 Foesel, B. U., 203 Folke, C., 347 Fong, J. H., 426 Fonknechten, N., 71, 77, 321, 358 Forney, L. J., 12, 17 Forster, W., 45–46 Forterre, P., 6, 466–467 Foster, R. G., 231 Fouts, D. E., 36, 374 Frahm, C., 351 Frame, C. H., 145, 155 Francis, C. A., 5, 12–13, 18, 37, 41, 43–46, 293, 358, 374, 377, 379, 381, 384, 388–389, 466 Francois, P., 303 Franco, R., 409 Franza, B. R., 436–437 Frappier, S. L., 101 Frawley, E. R., 407 Freeman, W. M., 437 Freitag, T. E., 12, 19, 22, 26–27, 41, 46, 293 Freitas, T. A. K., 289 Freney, J. R., 347 Friedman, R., 305 Friedman, S. P., 94 Frischer, M. E., 359 Fromin, N., 68, 70 Frost, P., 231 Froula, J. L., 365 Fry, B., 80–81 Fuchs, B. M., 38, 66, 68, 79, 187 Fuchs, G., 14–15 Fuchs, J. A., 40, 270 Fuchsman, C. A., 66–67, 77, 358 Fuerst, J. A., 36, 66, 80, 358 Fuhrman, J. A., 165, 172, 466 Fu, H.-X., 71 Fujita, T., 400–401 Fujiwara, T., 408 Fukumori, Y., 408 Fulton, R. S., 305 Fung, D. C., 190 Furukawa, K., 71 Furumichi, M., 308 G Gaillard, B., 94, 100 Gala´n, A., 66
496 Galanter Hastings, M., 151 Galanter, M., 80 Galchenko, V. F., 116 Galens, K., 309 Gallagher-Gambarelli, M., 436 Galloway, J. N., 347 Gammon, C. L., 189 Gandhi, H., 155, 359 Ganeshram, R. S., 347 Gans, J., 322 Gantner, S., 189 Garber, E. A. E., 154 Garce´s, E., 470 Garcia-Fuentes, O., 219 Garcia-Gil, L. J., 154 Garfin, D. E., 437 Garson, J. A., 353 Gaspar, D. J., 101, 103–105, 107 Gaudet, J. P., 99 Gaul, T., 67 Gearing, M., 310 Gebauer, G., 150, 153 Gebreyesus, B., 40 Geer, L. Y., 426 Geer, R. C., 426 Geerts, W., 40, 44 Geffers, R., 359 Geguchadze, R., 437 Geider, R. J., 347 Geier, M., 377, 384 Gelfand, M. S., 219, 227–228 Gemmell, M. A., 440, 453 Gentry, T. J., 377, 381, 389 Georgius, P. J., 144 Gerards, S., 153 Gerbl, F. W.X, 186 Gerstein, M. B., 295 Ghosal, S., 108 Giardina, P., 424 Giavalisco, P., 438 Giblin, A. E., 65, 79, 81 Gibson, T. J., 46 Gieseke, A., 166–168, 171, 186–187, 203, 239, 242, 270, 278 Gijzen, H. J., 219 Gilmanov, T. G., 116 Gilroy, C. A., 222 Giometti, C. S., 440, 453 Giovannoni, S. J., 45, 69, 467 Giuliodori, A. M., 349 Givan, S., 467 Givskov, M., 188 Glagoleva, O., 189 Glansdorff, N., 346 Glasbey, C. A., 440 Glaser, F., 351 Glass, E. M., 310 Gleasner, C. D., 289
Author Index
Glo¨ckner, F., 202 Gloerich, J., 64, 360, 437 Glover, H. E., 470 Glud, R. N., 473 Go¨bel, U. B., 17 Godfroy, A., 79 Godoy, R., 153 Goeres, D. M., 240 Gogarten, J. P., 306 Golabgir-Anbarani, A., 357, 359 Goldberg, S. M., 305 Goldman, B., 407 Gollabgir, A., 186, 425, 466–467 Go, N., 424, 426 Goncalves, L. L., 406–407 Goncalves, M. L. F. C., 427 Gonod, L. V., 101 Gonzales, N. R., 426 Gooley, A. A., 437 Gorfer, M., 93 Gornall, A. G., 222 Goto, S., 308, 440 Go¨ttlein, A., 98 Goulding, K. W. T., 95 Gouw, J. W., 436 Graco, M., 66 Grafham, D. V., 305 Graham, D. W., 273 Graham, J. E., 345, 351–352, 359, 364 Grandy, A. S., 155 Granger, D., 470 Granli, T., 140 Grass, G., 424 Gray, N. D., 172 Green, A., 104 Green, E. D., 295 Greene, E. A., 401 Green, L. D., 289 Green, S. J., 189 Gribaldo, S., 6, 466–467 Griffiths, A. D., 296 Griffiths, I., 400, 404, 407 Griffiths, R. I., 7, 187 Griner, E., 377, 379, 381 Grinstein, G., 382, 384 Groeneweg, J., 238 Groffman, P. M., 128, 153 Grosskopf, R., 12 Gross, R., 401 Grove, H., 440 Grove, J., 400, 404, 407 Gruber, N., 347 Grundmann, G. L., 92, 99, 101 Gru¨nhage, L., 121 Gualerzi, C. O., 349 Gu, B., 377 Guerquin-Kern, J. L., 105 Gugliuzza, T., 402
497
Author Index
Guipponi, M., 258 Gu, J.-D., 35, 37–41, 43–45, 47, 50–51, 54–55, 66–68, 72–74 Gulledge, J., 351–352, 359 Gull, K., 6 Gundersen, J. K., 473–474 Gunderson, T., 103–104 Guo, A., 309 Guo, L., 37–38, 40, 43–49, 52–55, 66–68, 74, 76–77 Gussman, A., 309 Gustafson, E., 468 Gustafsson, J. S., 440 Gutie´rrez, D., 66–67, 77 Gvakharia, B. O., 219, 227–228, 244 Gwadz, M., 426 Gygi, S. P., 436–437 H Haaijer, S., 358 Hacin, J., 7 Hackett, M., 348 Hadas, O., 40 Haft, D. H., 308 Hagen, W. R., 413 Hakansson, J., 351 Hallam, S. J., 14–15, 21, 291, 320–322, 359, 466–467 Hallin, S., 93 Hall, N., 21 Hall, Z., 437 Halm, H., 104–105 Halpern, A. L., 13, 36, 293, 374 Hamady, M., 47–48 Hamdan, M., 437 Hamer, G., 470, 481 Hamersley, M. R., 66, 69, 74, 79 Hamilton, M. A., 240 Hamilton, S. K., 153, 348 Hammesfahr, U., 13 Hammond, D. E., 77 Hammond, P. W., 204 Han, C. S., 289 Handelsman, J., 45, 320 Han, D. K., 436 Handlesman, J., 377 Hands, R. E., 354 Hang, J. Q., 439–440, 447, 449–450 Hanning, M., 66, 79 Hannon, J. E., 155 Hansen, E. J., 483 Hanson, B. T., 101 Hanson, T. E., 359 Hanssum, B., 470 Harcourt, R. L., 440 Harder, W., 467 Harhangi, H., 358
Harkin, G., 188 Harms, G., 271–272 Harms, H., 359 Harris, D., 141, 144, 152 Harris, J., 66 Harrison, J. A., 65 Hartmann, A., 175, 187, 189 Hart, P. J., 424 Hart, S. C., 93, 95–98 Harvey, J. W., 65 Hasenfuss, G., 436 Hashimoto, L. K., 470, 478 Hatano, K., 154 Hatch, D. J., 95 Hatzenpichler, R., 6, 41, 186, 359, 466–467 Hauser, L. J., 40, 227, 243, 291–293, 308, 361–362, 424–425, 477–478 Hausner, M., 188–189 Hawkes, C. V., 93 Hawkins, R. A., 437 Hawley, A., 322 Hayatsu, M., 141, 154 Haynes, P. A., 437 Hazen, T. C., 381, 389 Hazzard, J. T., 424 Head, I. M., 21, 36, 40, 172, 251, 260 Hearn, J., 348, 352 Heck, A. J. R., 436–437 Hedman, B., 424 Heeren, R. M. A., 101 Heger, A., 308 Heidelberg, J. F., 13, 36, 293, 320, 342, 374 Heijen, J. J., 66 Heijnen, J. J., 251 Heijnen, S. J., 251 Heinemann, T. A., 261 Heitmann, D., 409, 418 He, J.-Z., 14, 27, 29–30, 41, 466, 479, 482 Helbig, A. O., 437 Held, G. A., 382, 384 Hellemans, J., 353 Hemme, C. L., 381, 389 Hemmings, A. M., 406–407, 410, 412, 415–416, 418 Hemp, J., 186, 425, 466–467 Hendrich, M. P., 359 Hendrickson, E. L., 348 Hendrix, P. F., 92 Hendry, M. J., 117, 128 Hentschel, D., 102 Hentzer, M., 188 Herbert, B. R., 437 Herbert, R. A., 21 Herfort, L., 6, 43, 384, 466 Herman, D. J., 93, 99–100, 104 Hermansson, A., 274 Hermansson, M., 197 Hernandez, D., 303
498 Herndl, G. J., 43, 202, 384, 466 Herrmann, A. M., 101–102, 104, 106–108 Herrmann, M., 438, 466 Herron, P. M., 98 Herschleb, J., 330 He, S., 365, 426 Hesselsoe, M., 202 Heydorn, A., 188 He, Z., 377, 381, 389 Hickey, R., 250 Hickey, W. J., 238, 435, 478 Hietanen, S., 65 Higuchi, R., 353 Hilkert, A., 151 Hillion, F., 102, 104–105 Hill, T., 66 Hilyard, J. D., 240 Hinkel, I., 153 Hinrichs, K.-U., 105 Hinsinger, P., 93 Hinton, J. C., 348 Hintze, J., 127 Hiorns, W. D., 36, 40 Hirakawa, M., 308 Hirata, A., 40, 65 Hirsch, M. D., 67, 70, 72–74, 77 Hochstrasser, D. F., 437 Hodge, A., 104 Hodgson, K. O., 424 Ho¨fferle, S., 7, 16 Hoffland, E., 144 Hohn, B., 321 Hole, U., 402, 404, 411–412, 417 Hollibaugh, J. T., 186 Hollocher, T. C., 145, 154 Hollung, K., 440 Holmes, R. M., 80–81, 469 Holt, C., 98 Homer, N., 312 Hommes, N. G., 219, 227, 242–243, 291, 293, 361–362, 425, 477 Hong, Y.-G., 37–41, 43–45, 47, 50–51, 55, 66–68, 71–74 Hood-Novotny, R., 93 Hood, R. C., 117 Hooijmans, C. M., 219 Hooker, B. A., 469 Hooker, T., 98 Hooper, A. B., 40–41, 44, 67, 71–73, 145, 227, 243, 270, 359, 408–409, 424–425, 467 Hopkins, D. W., 140 Hopmans, E. C., 66 Hoppe, P., 104–105 Horgan, G. W., 354, 440 Horinouchi, S., 412 Horn, M., 11, 71, 77, 187, 202–203, 321, 358 Horreard, F., 104–105 Horst, S., 359
Author Index
Horton, R., 128 Hoshino, T., 40, 187 Hossain, M. S., 303 Hostetler, J., 305 House, C. H., 104–105 Hovanec, T. A., 186 Howard, C. V., 189, 191, 194 Hoyle, B. D., 186 Hrebicek, T., 439 Hristova, K. R., 40 Hsu, B. T., 409 Huang, W. E., 187 Huang, Z., 377 Huber, H., 413 Huber, J. A., 20 Huber, R., 154, 402–407, 409–410, 412, 414 Hubert, C., 401 Huelsenbeck, J. P., 46 Huet, S., 440 Hugenholtz, P., 21, 365 Hugger, J., 353 Hu¨gler, M., 186, 425, 466–467 Huizinga, K. M., 155 Hulo, N., 308 Hulth, S., 38, 65–67, 79, 82 Humbert, S., 68, 70 Hummelink, E. J. W., 144 Hunik, J. H., 238 Hunter, S., 308 Huntington, T. G., 116 Hunt, S. M. N., 440 Hurek, T., 389 Hurwitz, D. I., 426 Hu, S., 65 Huse, S., 20 Huson, D. H., 322 Hutcheon, I. D., 103–105, 108 Hutchinson, G. L., 128 Hu¨tsch, B. W., 140 Hutzler, P. C. L., 175, 187, 189 Huygens, D., 153 Huynh, B. H., 404, 409 Hu, Z. Q., 219 Hwang, S. I., 436 Hyatt, D., 308 Hyman, M. R., 219, 226, 360 I Igarashi, N., 408 Iguchi, A., 164 Ikeda, M., 164 Ikonomi, P., 353 Illumina, 267, 296 Imamura, Y., 470, 478 Imhoff, J. F., 40 Inamori, Y., 40, 65 Indahl, U., 440
499
Author Index
Ineson, P., 172 Ingalls, A. E., 359, 466 Ingraham, J. L., 442 Ingvorsen, K., 310 Ingwersen, J., 153 Inman, J. M., 309 Inoue, T., 424 Inselsbacher, E., 93 Israel, D. W., 94, 97–98, 100 Itoh, T., 308 Ito, S., 102 Ito, T., 164–165, 167, 172–174, 177, 180–181, 240, 436 Ivanova, N. N., 309–310 Ivanov, M., 116 Iversen, N., 202 Iverson, T. M., 409 Iwata, S., 416 Iyer, V. R., 375, 380 J Jackman, S. D., 302 Jackson, G. A., 377, 384–386, 389 Jackson, J. B., 400 Jackson, J. D., 308 Jackson, L. E., 40 Jacobs, A. R., 308 Jacobsen, S., 440 Jacoby, M., 101 Jaeger, C. H., 93, 99–100 Jaeschke, A., 79 Ja¨ger, H.-J., 121 Jain, A. K., 189 Jakobsen, B. H., 121 James, D. C., 448, 452–453 James, P., 400, 404, 407 Jansch, L., 437, 440 Jansson, J. K., 4 Jardine, P., 377 Jarvis, S. C., 95 Jastrow, J. D., 92–93 Jauzein, C., 470 Jayakumar, A., 66, 74, 76, 79, 386 Jehmlich, N., 29 Jenkins, B. D., 389 Jenkinson, D. S., 99 Jenneman, G. E., 401 Jensen, H. B., 437, 454 Jensen, K. N., 440 Jensen, L. J., 308 Jensen, L. S., 95 Jensen, M. M., 66–67, 77 Jensen, M. S. M., 79 Jepson, B. J. N., 359 Jeris, J. S., 250, 255 Jessen, F., 440
Jetten, M. S. M., 36, 38, 40–41, 44, 65–68, 70–73, 77, 79–80, 82–83, 291, 293, 358–360, 408, 425, 437 Jiang, Q. Q., 470 Jiang, Y., 44–45 Jia, S. L., 409 Jia, Z., 7, 14, 27, 479, 482 Jickells, T. D., 65, 347 Jin, W., 37, 39, 45, 47, 50 Jobb, G., 45–46 Joergensen, R. G., 98 Johnson, J. M. F., 117, 305 Johnson, K. K., 93, 99–100 Jones, A., 359 Jones, D. L., 93, 101–102, 104, 108 Jones, K., 77 Jones, S. J. M., 302 Jonuscheit, M., 293, 320, 466 Joost, I., 359 Jrgensen, B. B., 66, 79, 104–105, 470–471 Jorgensen, B. M., 440 Jorgensen, S. L., 319 Jormakka, M., 416 Jozsa, P. G., 294 Julien, P., 308 Junier, P., 40 Junier, T., 40 Juretschko, S., 40, 46, 66–68, 70, 165, 172, 175, 177, 187, 189, 202–203, 270, 278, 377 Jurgens, G., 12, 202, 293, 320, 466 Jurgens, K., 66, 79 Jury, W. A., 128 Ju, X., 153 K Kabwe, L. K., 117, 128 Kahnt, J. R., 360 Kaije, S., 400–401 Kakirde, K. S., 342 Kamagata, Y., 164 Kamman, C., 121 Kampf, J. P., 102 Kampschreur, M. J., 238 Kana, T. M., 65 Kanehisa, M., 308 Kang, U. B., 436 Kapfer, P., 175 Kaplan, W. A., 470, 478 Karin, M., 349 Karl, D. M., 43, 466 Karlsen, O. A., 437, 454 Karner, M. B., 466 Karp, N. A., 437–438 Karsch-Mizrachi, I., 290 Kartal, B., 36, 38, 40, 44, 66–69, 79–80, 358, 437 Karwautz, C., 189
500 Kathuria, S., 359 Kato, I., 154 Kato, K., 38 Kattenberg, J. H., 470, 474 Kattge, J., 95–96 Kaul, A., 436 Kavanaugh, K., 116–117 Kawabata, T., 424 Kawahara, Y., 71 Kawano, Y., 240 Kaye, J. P., 93 Kearney, M. M., 254 Keech, A., 400 Keen, G. A., 441, 445, 467, 470, 478, 481 Keller, J., 65 Kelley, D., 346 Kelley, S. T., 47–48 Kellman, L., 116–117, 128 Kelly, D. J., 359 Kelly, S., 6 Keltjens, J. T., 36, 358 Kemp, G. L., 406, 410 Kemp, W. M., 65 Kendall, C., 150–151 Kenney, M., 204 Kerlavage, A. R., 290 Kern, M., 407, 410 Ke´rouel, R., 469 Khouri, H. M., 359 Kietzin, A., 5, 13 Kikuchi, K., 164 Kilburn, M. R., 101, 104, 106–107 Kilpatrick, K. A., 478 Kim, D., 153–154 Kim, H. J., 359, 436 Kim, O. S., 40 Kim, U. J., 321, 324 Kimura,T., 38 Kindaichi, T., 163–165, 167, 171–175, 177, 180–181, 240 Kingston, R. E., 230 Kirchman, D. L., 172 Kirk, G., 117 Kirkham, D., 95–96, 103 Kirkness, E. F., 290 Kirkpatrick, J., 66–67 Kiryutin, B., 308 Kito, K., 436 Kjaergaard, C., 424 Kjaer, T., 166, 170–171 Kjelleberg, S., 26 Klapholz, S., 295 Klappenbach, J. A., 273 Kleber, M., 302 Kleinfeld, A. M., 102 Klein Gunnewiek, P. J. A., 153 Klein, M., 66–68, 70 Klemme, J. H., 402
Author Index
Klenk, H. P., 5, 13, 36, 41, 46, 154, 320–321, 327, 342, 359, 374, 466–467 Kletzin, A., 36, 41, 46, 293, 320–321, 327, 341–342, 374, 466–467 Kliburn, M. R., 101–102, 104, 108 Klimke, W., 308 Klimmek, O., 401, 404, 417 Klinger, M. E., 437 Kloppenborg, M., 177 Klose, J., 438 Klotz, M. G., 14–15, 21, 37–41, 43–55, 66–68, 71–74, 76–77, 186, 227, 243, 291–293, 304, 313, 345, 347, 351–352, 357, 359, 361–362, 408, 424–425, 466–467, 477–478 Knapp, C. W., 273 Knight, R., 11, 47–48 Knights, A. J., 250 Kobayashi, K., 424 Kocher, T., 436 Koch, H., 186, 292 Koch, L., 203 Kockelkorn, D., 14–15 Koehler, C. J., 436 Kolbe, M., 437 Ko¨nneke, M., 5, 12–13, 36, 41, 186, 294, 359, 466 Konopka, A., 121 Konovalov, S. K., 77 Konstantinidis, K. T., 291, 320–321, 466–467 Kool, D. M., 139, 141, 144, 146, 148, 151–153 Koonin, E. V., 308, 321, 328, 342 Koop-Jakobsen, K., 79, 81 Koops, H.-P., 37, 40–41, 46, 179, 186, 189, 202–203, 270, 278, 359, 377, 466, 470, 478, 480, 482 Koppel, J., 231 Korber, D. R., 186 Koren, S., 301, 303 Kosman, D. J., 423–427 Kostner, H., 351 Koteishi, H., 424 Kouros-Mehr, H., 321 Koval’chuk, M. V., 406 Kowalchuk, G. A., 5, 21, 36–37, 40, 221, 273–274, 466 Kozarewa, I., 295 Kozielski, F., 436 Kraft, M. L., 102 Kramer, E. H. M., 36, 358 Kranz, R. G., 407, 410 Krest, R. L., 45 Krijgsveld, J., 436 Kro¨ger, A., 401, 403–404, 406–407, 409–410, 417 Krogh, A., 308 Kroneck, M. H., 402, 404, 411–412, 417 Kroneck, P. M. H., 154, 358, 400–407, 409–414, 417 Kru¨ger, S., 66 Krumholz, L., 276, 280
501
Author Index
Kubal, M., 310 Kubista, M., 351, 353 Kuehn, M., 188 Kuenen, G., 71 Kuenen, J. G., 36, 44, 65–67, 69, 257, 358 Ku¨hl, M., 166–168, 171, 470–471, 483 Ku¨hn, M., 189, 308 Kukimoto, M., 412 Kumar, S., 46 Kumon, Y., 154 Kunin, V., 21 Kuparinen, J., 65 Kurakov, A. V., 154 Kurganova, I., 155 Kurtz, S., 312 Kurun, E., 402, 411–413 Kuster, B., 438 Kuypers, M. M. M., 38, 64, 66–68, 71–73, 77, 79, 103–105, 171, 187, 358, 360, 466 Kuzyakov, Y., 116 Kwok, E. Y., 427 Kwok, S. C., 223, 470, 481 Kyrpides, N. C., 309–310 L Laanbroek, H. J., 40, 140, 153, 347, 359, 476 Labarre, J., 437 Labedan, B., 346 Lafleur, D., 77 Lagniel, G., 437 Lai, T., 45–46 Lambin, E. F., 347 Lamerdin, J., 40, 227, 243, 290–291, 304, 424–425 Lam, P., 38, 66–68, 71–73, 77, 104, 187 Lampreia, J., 406–407 Lamzin, V. S., 406, 408, 412, 416 Lander, E. S., 302 Land, G., 261 Landman, A., 99 Land, M. L., 40, 227, 243, 290–293, 304, 308, 424–425, 478 Lane, D. J., 69 Lane, N., 346 Langendijk-Genevaux, P. S., 308 Langille, M. G., 307 Langlois, R., 104 Lant, P., 65 Lanzen, A., 21, 41, 154, 321–322, 342, 359 Lao, V., 40, 227, 243, 290–291, 304, 424–425 Lappin-Scott, H. M., 348 LaQuier, F., 40 Larimer, F. W., 40, 227, 243, 290–293, 304, 308, 361–362, 424–425, 477–478 Larin, Z., 321 Larkin, M. A., 46 LaRoche, J., 104, 347
Larsen, L. H., 164, 170–171, 186, 474 Larsson, B., 308 Lauchnor, E. G., 217, 228–229, 242–243 Lauf, J., 153 Laughlin, R. J., 95–96, 116–117, 153–155 Lavik, G., 38, 66–67, 77, 79, 103–104, 358 Lavil, G., 66 Laviolette, F., 302 Lawrence, J. R., 186 Lawton, T. J., 423–425, 430 Lebauer, D., 40 Lebecleva, E. V., 466 Lebedeva, E. V., 186, 294, 359 Leblon, G., 105 Lebrato, J., 251 Lechene, C. P., 102, 104, 106, 108, 188 Ledgard, S. F., 95 Lee, C. K., 359, 436 Lee, E., 309 Lee, H., 121 Lee, K. H., 453–454, 457–458 Lee, N. M., 67, 165, 172, 175, 177, 187, 276, 389 Lee, S.-T., 66–67, 71–73, 322 LeGall, J., 401–402, 412–413 Lehner, A., 71, 77, 202, 321, 358, 389 Leigh, J. A., 348 Leighton, T., 108 Lein, A., 116 Leininger, S., 5–8, 10–13, 15–16, 18, 21–22, 36, 41, 46, 153, 293, 320–321, 327, 342, 359, 374, 466–467, 479 Leize-Wagner, E., 438 Lemanceau, P., 93 Lemke, A., 469 Lemmer, H., 277 Lendenmann, U., 470, 481 Lens, S. I., 424 Lenton, T. M., 347 Le Paslier, D., 64, 186, 360 Lepp, P. W., 470, 479–481 Lepsˇ, J., 52 Lesongeur, F., 79 Letunic, I., 308 Leutenegger, C. M., 40 Levy, S., 36, 374 Lewandowski, Z., 188 Lewis, S., 308 Lide, D. R., 222, 224 Liebich, J., 377, 381, 389 Liebscher, V., 189 Lien, C., 384 Liesack, W., 5, 12, 40, 43, 274, 383 Li, F., 155, 359 Li, G. W., 348, 352 Li, H., 44–45, 47, 54, 66, 312 Li, J., 37–40, 43–50, 52–55 Likolammi, M., 202 Liles, M. R., 342
502 Lilley, K. S., 437–438 Lill, R., 407 Li, M., 35, 37–41, 43–45, 47, 50–51, 55, 66–68, 71–74 Limburg, P., 40 Lim, E., 384 Lindgren, P.-E., 274 Lind, M., 197 Lindquist, E. A., 365 Lindstro¨m, K., 12 Lin, J. T., 359 Lipman, D. J., 46, 290, 308 Lipscomb, J. D., 424 Lipski, A., 186, 203 Li, R., 302, 313 Li, S., 38, 43–45, 47, 54, 66–68, 74, 76–77 Li, T., 37, 39, 45, 47, 50, 105 Liu, B. F., 358, 438 Liu, J., 189, 352 Liu, M.-C., 400, 402, 404 Liu, M.-Y., 402 Liu, S., 50, 353 Liu, W.-T., 4 Liu, X., 380, 438 Liu, Z. L., 352 Livak, K. J., 231 Livingston, G. P., 128 Li, X.-R., 71, 377, 381, 389 Lo, C., 289 Locascio, P. F., 308 Lockyer, N. P., 101 Loeffler, B., 171 Loetterle, L. R., 240 Lo¨ffler, F. E., 67 Logan, M. S. P., 40, 409 Logemann, S., 36, 358 Loman, N. J., 309 Lomsadze, A., 308 Long, Z. T., 67, 70, 72–74, 77 Lopes de Gerenyu, V., 155 Lopez, R., 46 Lorenzen, J., 170–171 Lorenz, P., 342 Losekann, T., 105, 108 Lotz, M., 310 Loureiro, S., 470 Lovell, R. D., 95 Love, N. G., 238 Lowe, T. M., 307–308 Low, J. M., 40 Lowrance, R., 65 Loy, A., 172, 203, 389 Lozupone, C. A., 47–48 Luan, X. W., 47 Lubberding, H. J., 219 Lucchini, S., 348 Luche, S., 438
Author Index
Lu¨cker, S., 186, 189, 191–192, 201, 204, 206, 273, 282, 292 Ludwig, W., 45–46, 69, 187, 276 Lueders, T., 29 Lukashin, A. V., 308 Lukat, P., 404, 406–407, 412–413 Lukey, P. T., 454 Lunau, M., 469 Lundgren, D. H., 436 Luo, Q. M., 438 Luo, X. Z., 349 Lu, P., 348 Luster, J., 98 Lutomski, D., 440 Luyten, Y., 102, 104, 108, 188 Lydmark, P., 197 M Maas, B., 44, 67, 69 MacCallum, I., 302 MacDonald, R. J., 349 Machonkin, T. E., 423 Macieira, S., 406–407 Macko, S. A., 65 Madden, T. L., 46 Maddock, J. R., 453 Madsen, E. L., 101 Magalhaes, C., 186 Magdassi, S., 296 Magenot, S., 71, 77 Magid, J., 94, 100 Mahon, P., 447, 452–453 Maixner, F., 186, 189, 203, 208–209, 211, 292, 294 Ma, J. G., 409 Maldarelli, F., 353 Malfatti, S. A., 361–362, 425, 477–478 Mallet, M.-P., 68, 70 Malm, S., 359 Malone, J. P., 153 Ma, M., 352 Mancino, V., 321, 324 Mandic´-Mulec, I., 7 Manefield, M., 29 Mangenot, S., 64, 305, 321, 358, 360 Manichanh, C., 313 Manning, G., 357, 359 Ma˚nsson, K., 93 Mantri, Y., 307 Manzoni, S., 96 Manz, W., 278, 280 Marcelino, L. A., 384 Marchler-Bauer, A., 426 Marcotte, E. M., 348 Margulies, M., 301 Marietou, A., 359 Markowitz, V. M., 309–310
Author Index
Mark Welch, D., 20 Marschner, P., 94 Marshall, C. T., 448, 452–453 Marsh, T. L., 18, 321, 328 Martens, D. A., 140 Martens-Habbena, W., 42, 66, 79, 359, 389, 465, 467–469, 474–476, 479–480, 482–483 Martial, J. A., 349 Martin-Cuadrado, A. B., 320 Martinelli, L. A., 347 Martinez-Luque, M., 359 Martin-Laurent, F., 271 Martin, W., 346 Martiny, A. C., 186, 359 Martyn Harvey, S., 21 Mary, B., 95–96, 98 Marzorati, M., 37 Masignani, V., 312 Massana, R., 12 Massheder, J., 116 Mastepanov, M., 121 Matias, P. M., 413 Matson, A. L., 117 Mauk, A. G., 412 Maurer, M. H., 438 Mavromatis, K., 309–310 Ma, W. K., 117, 119, 140 Mazeas, L., 105 McAdam, R. A., 454 McAlister, G. C., 437 McBride, M. B., 117 McCaig, A. E., 5, 21, 46 McCarthy, A. J., 36, 40 Mccarthy, J. E. G., 400 McCaslin, H., 188 McClelland, J. W., 81 McCorkle, D. C., 80 McDonnell, L. A., 101 McDougal, R., 117 McDowell, M. T., 439–440, 447, 449–450 McElroy, M. B., 470, 478 McGettigan, P. A., 46 McGinnis, D. F., 66 McIlvin, M., 84 McIlvyn, M., 146, 155 McInteer, B. B., 144 McIver, L., 407, 410 McJannet, D. L., 127 McKeegan, K. D., 105 McLain, J. E. T., 140 McLeod, M. K., 126–127 McMahon, G., 102, 104, 108, 188 McMahon, S. K., 94 McMurry, K. K., 289 McTavish, H., 40, 270 McWilliam, H., 46 Meacham, C., 308 Mechtler, K., 436
503 Medema, M. H., 360 Medini, D., 312 Meier, H., 45–46, 389 Meijer, H. J. G., 238 Meincke, L. J., 289 Mellon, J. W., 353 Mendes, I. C., 94 Mendez, B., 349 Mendoza, C., 126 Merchant, S., 407 Merod, R. T., 188 Messerschmidt, A., 402–407, 409–410, 412–414, 417, 423 Metay, A., 117 Metcalf, J. A., 353 Metzger, J. W., 66–68, 70 Meurer, G., 293 Mevarech, M., 154 Meyer, F., 306, 310 Meyer, H. E., 437–438 Meyer, M., 382 Meyer, R. L., 65–66, 79, 82–83 Mican, J. M., 353 Michael, L. L., 359 Michener, R., 80 Michotey, V. D., 82, 84 Micklinghoff, J., 359 Middelburg, J. J., 43, 384, 466 Miles, C. S., 407, 410 Miller, J. R., 301, 303 Miller, O. J., 296 Miller, R. M., 92–93 Miller, W., 46 Mincer, T. J., 14–15, 21, 43, 359, 466–467 Minden, J. S., 437–438 Minjeaud, L., 82, 84 Minor, W., 430 Minz, D., 189 Mironov, A., 352 Mischoff, M., 121 Mistry, J., 308 Miura, Y., 164 Mobarry, B. K., 179, 202, 221, 270, 278 Moberg, J. P., 389 Model, M. A., 190 Moffett, B., 66 Mohan, S., 359 Moin, N. S., 43, 46 Moir, J. W. B., 400 Moisander, P. H., 389 Mokashi, A., 437 Moletta, R., 251 Molina, V., 40, 66 Molin, S., 186, 188 Moller, S., 188 Molloy, M. P., 437, 439–440, 447, 449–450, 453 Monaco, A. P., 321
504 Moncrieff, J. B., 121 Montfort, W. R., 424 Montonen, L., 202 Moore, B. C., 348 Moore, D. D., 230 Moorman, T., 121 Moraru, C. L., 103–104, 187 Moreira, D., 320 Morely, C., 79–80 Moreno-Vivia´n, C., 154, 359 Moriyama, H., 408 Morozkina, E. V., 154 Morrison, A. E., 389 Moser, F. M., 437 Mosier, A. C., 37, 43–46 Mosier, A. R., 128 Motteram, P. A. S., 400 Moura, I., 359, 404, 406–407, 409 Moura, J. J. G., 359, 404, 406–407, 409 Moussa, M. S., 219 Mowat, C. G., 407, 410 Mu, B.-Z., 44–45, 47, 54, 66, 74 Mueller, J. A., 255 Mueller, L. N., 188 Mueller, R., 353 Mulder, A., 36, 65–66 Mulholland, F., 348 Mu¨ller, B., 66 Mu¨ller, C., 95–96, 148, 152–153 Muller, J., 308 Mu¨ller, T., 98 Mullins, T. D., 45 Mulvaney, R. L., 441 Mumy, K. L., 9 Mundfrom, G., 40 Mu¨nster,U., 202 Murillo, F. M., 402 Murison, R., 126–127 Murphy, D. V., 95, 98, 101–102, 104, 106–108, 230 Murphy, M. E. P., 412 Murray, A. E., 12 Murray, J. W., 66–67, 77 Murrell, J. C., 172, 381, 437, 454 Murshudov, G. N., 431 Muruganandam, S., 94, 97–98, 100 Musat, F., 104 Musat, N., 103–105 Mußmann, M., 189 Mustafa, M., 251, 260 Mutobe, H., 155 Muyzer, G., 17–18, 36–37, 44–45, 189, 273–274, 358 Muzny, D., 305 Myers, R. M., 295 Myrold, D. D., 25, 91–92, 94–96, 101, 103–105, 107
Author Index N Naik, H., 66, 74, 76, 79 Nakagami, T., 424 Nakajima, J., 38 Nakamura, K., 164, 424, 426 Nakamura, Y., 38, 171 Namsaraev, B., 186, 294 Naqvi, S. W. A., 38, 68 Narihiro, T., 164 Nealson, K. H., 103–104, 108 Nebrich, G., 438 Nedwell, D. B., 65, 359, 470 Neef, A., 69 Neese, F., 406–407, 412, 414 Neidhardt, F. C., 442 Nei, M., 46 Nelson, K. A., 43, 46, 374 Nelson, K. E., 36 Nelson, W., 36, 374 Nemati, M., 401 Nesvizhskii, A. I., 436, 438 Neuvians, T. P., 353 Newbold, L., 187 Neyer, C., 308 Nguyen, C., 93 Ng, W. O., 105, 108 Nicholas, D. J. D., 145 Nicholls, J. C., 65, 78–84 Nicolaisen, M. H., 40, 470 Nicolella, C., 251 Nicol, G. W., 3, 6–8, 10–16, 18–22, 24, 27, 29–30, 37, 41, 153–154, 293, 321, 342, 359, 388, 466–467, 479, 482 Niekus, H. G., 402 Nielsen, A. T., 188 Nielsen, H., 308 Nielsen, J. L., 165, 172, 174–177, 187, 202–203, 208, 293 Nielsen, L. P., 79, 82–83 Nielsen, P. H., 165, 172, 174–177, 187, 202–203, 208, 277, 293 Niftrik, L. V., 36, 358 Nijburg, J. W., 153 Nilsen, F., 231 Ning, Z., 295 Nishiyama, M., 412 Nishiyama, T., 71 Nistico, L., 171 Nitschke, W., 346 Noble, P. A., 377, 384 Noda, N., 40, 65 Noguchi, H., 308 Noguera, D. R., 189, 203, 208–209, 211 Noirel, J., 437 Nojiri, M., 424 Nolan, T., 353–354
505
Author Index
Nold, S. C., 40 Nolte, A. W., 377, 384 Nomura, N., 164 Noone, K., 347 Noordewier, M., 467 Norimatsu, N., 164 North, R. A., 440 Norton, J. M., 21, 40, 44, 93, 227, 243, 291, 293, 313, 361–362, 424–425, 477 Nowack, B., 98 Nuccio, E., 104 Nudler, E., 352 Numata, Y., 41 Nunan, N., 92, 101, 104, 106–107 Nyerges, G. R., 359 Nykvist, B., 347 O Oades, J. M., 94 Oakley, B. B., 5, 12–13, 18, 41, 43, 46, 66–67, 293, 358, 374, 384, 388–389 O’Brian, M. R., 407 Obuchi, A., 38, 66 Oby-Robinson, S., 349 O’Callaghan, M., 479, 482 Ochman, H., 21 Ochsenreiter, T., 12, 19, 293, 320–321 O’Connor, G., 437 Odom, J. M., 402 O’Donnell, A. G., 7, 101, 104, 106–107 Odum, E. P., 92 Oenema, O., 140–141, 144, 146, 148, 151–153, 347, 359 Offre, P. O., 12–16, 19, 21–24, 27, 29–30, 41 Offre, P. R., 41, 466, 479 Okabe, S., 38, 164, 186–187, 197, 240 Okada, K., 38, 66 Okano, Y., 40, 272 Okou, D. T., 352 Okuyama, H., 186 Oliveira, T. F., 404, 406–407, 413, 417–418 Olsen, G. J., 69, 308 Olson, R. J., 310, 478 Omnes, P., 153 O’Mullan, G. D., 313, 377, 384–386 Ondov, B. D., 352 Op den Camp, H. J. M., 36, 38, 40–41, 44, 65–67, 71–73, 358–360 Or, D., 94 Orphan, V. J., 104–105, 189 Orvis, J., 309 Osboni, A. M., 359 Osborn, A. M., 22, 65 Osborne, B., 309 Ostell, J., 290 Osteras, M., 303 Ostrom, N. E., 155, 359
Ostrom, P. H., 155, 359 O’Sullivan, S. K., 127 Ottengraf, S. P. P., 187, 189, 250 Otwinowski, Z., 430 Ouverney, C. C., 165, 172 Overbeek, R., 306 vrea˚s, L., 12, 322 Owens, R. W., 250 Ow, S. Y., 437 Ozinsky, A., 351 P Paarmann, D., 310 Pace, N. R., 69, 187, 276 Pal, G. W., 7 Pallen, M. J., 309 Pallud, C., 92, 99 Palmer, S., 353 Palmquist, D. E., 352 Papaspyrou, S., 65 Papen, H., 153 Pappin, D. J. C., 444 Parekh, N. R., 172 Parey, K., 413 Park, B. J., 41, 43, 293 Park, H. D., 46 Parkinson, R. J., 95 Parkin, T. B., 94 Park, J. R., 66–67, 71–73, 308 Park, K. M., 102 Park, S. F., 219, 226–228, 242, 359 Park, S. J., 41, 43, 293 Park, Y.-H., 66–67, 71–73 Parsley, L. C., 342 Parsons, T. R., 469 Passalacqua, K. D., 352 Pattyn, F., 353 Paulsen, I., 36, 374 Paustian, K., 94 Pavlekovic, M., 67 Payne, W. J., 402 Peck, H. D. Jr., 400, 402, 404 Pedersen, S. K., 440 Peduzzi, S., 104–105 Peirson, S. N., 231 Peisajovich, S. G., 296 Pelletier, E., 64, 71, 77, 186, 292, 321, 358, 360 Pellitteri, M. C., 238 Penninger, J. M., 436 Pennock, D. J., 117, 119, 128 Pennok, D., 117 Penque, D., 437 Penton, C. R., 44, 66–70, 79 Pereira, A. S., 359 Pereira, I. A. C., 401–402, 404, 406–407, 413, 417–418 Pereira, I. C., 412–413
506 Perkins, D. N., 444 Permina, E. A., 219, 227–228 Pernthaler, A., 202, 276 Pernthaler, J., 202, 276 Persson, A., 347 Peteranderl, R., 104, 106 Petersen, J., 38, 66–67, 79 Peterson, B. J., 65, 81, 469 Petrone, R. M., 126 Pett-Ridge, J., 91, 101, 103–108 Pevzner, P. A., 302 Pezzella, C., 424 Pfaffl, M. W., 353–354 Pfeffer, M., 144, 152 Pfeiffer, E.-M., 186, 203 Phadke, N. D., 453 Phanstiel, D., 437 Philhofer, M., 67 Philippot, L., 93, 154 Phillippy, A., 312 Phillips, C. J., 5, 21 Phipps, K., 117 Piceno, Y. M., 389 Pichler, P., 436 Pickup, R. W., 21 Pietrzak, S., 153 Pinard, R., 295 Pinches, A., 250, 258 Pinel, N., 14–15, 21, 186, 291, 293, 357, 359, 425, 466–467 Pinto, M., 153 Pisa, R., 401 Piscitelli, A., 424 Pitt, A. J., 155, 359 Pittman, M. S., 359 Pittman, T. L., 349 Piubelli, C., 437 Planta, A., 353 Plant, R. N., 295 Ploug, H., 103–104 Plum, G., 364 Podar, M., 467 Pol, A., 65 Polerecky, L., 166, 171 Polis, M., 353 Pollington, J. E., 308 Polyakov, K. M., 406, 408, 412, 416 Polz, M. F., 384 Pommerening-Ro¨ser, A., 37, 40–41, 44, 46, 67, 71–73, 186, 189, 202–203, 278, 377, 466, 480, 482 Pon, C. L., 349 Poole, R. K., 359, 400, 404, 407 Popa, R., 103–104, 108 Pop, M., 301 Popov, A. N., 406, 408, 412, 416 Popov, V. O., 406, 408, 412, 416 Popp, B. N., 13, 43
Author Index
Poppe, B., 353 Poptsova, M. S., 306 Porat, I., 348 Poret-Peterson, A. T., 351–352, 359, 361–362, 425, 477 Porporato, A., 96 Porter, J., 348 Porto, I., 251, 260 Posada, D., 20 Potter, L., 359 Pouvreau, L. A. M., 470, 474 Powers, E. C., 308 Pozhitkov, A., 377, 384 Prakhash, O., 402 Pratihary, A., 66, 74, 76, 79 Preheim, S. P., 384 Preston, C. M., 12, 14–15, 21, 43, 320–321, 359, 466–467 Preston, T., 144 Prgomet, C., 353 Price, C. T., 352 Priddle, J., 470 Prieme, A., 358 Prieur, D., 79 Prince, K. E., 101 Pritchard, C., 437 Propenko, M. G., 77 Proshkin, S., 352 Prosser, J. I., 3–7, 10–16, 18–20, 22, 24, 26–27, 29–30, 37, 40–42, 46, 153, 238, 293, 359, 388, 441, 445, 466–467, 470, 476–479, 481–482 Prosser, S. J., 96 Prudencio, M., 424 Pruden, G., 99 Przybyh, A. E., 349 Pulverer, G., 364 Pumphrey, G. M., 101 Purkhold, U., 37, 40–41, 46, 377, 466, 480, 482 Putnam, N., 291, 320–321, 466–467 Q Qayyum, M., 424 Qian, W., 302 Qi, J., 6–8, 16, 21, 153, 293, 322, 359, 466, 479 Qin, J., 313 Quaglia, M., 437 Quail, M. A., 295 Quaiser, A., 12, 19, 293, 320–321 Quan, Z.-X., 66–67, 71–73 Quince, C., 21 Quintanar, L., 424 Quirion, R., 437 R Rabilloud, T., 438 Rachel, R., 154
Author Index
Racher, A. J., 448, 452–453 Radajewski, S., 172, 381 Raddatz, G., 293, 320–321, 341 Radniecki, T. S., 217, 219, 222, 224, 226–229, 238, 242–243 Raes, J., 313 Raghoebarsing, A. A., 65 Rahmouni, A. R., 352 Ramette, A., 47, 50–51 Ramsing, N. B., 40, 164, 186, 189, 473 Rappe´, M. S., 467 Rappuoli, R., 312 Rath, G., 179, 202–203, 278, 470, 478 Rattei, T., 6, 41, 71, 77, 186, 321, 358, 466–467 Rattray, J. E., 66, 80 Rawlins, S. L., 126 Raz-Yaseef, N., 127 Read, H. W., 238 Read, T. D., 309 Rearick, D. E., 254 Reay, D. S., 470 Recknagel, P., 351 Recous, S., 94–96, 98, 100 Reeburgh, W. S., 116 Reed, M. G., 189, 191, 194 Rees, D. C., 409 Regala, W., 40, 227, 243, 290–291, 304, 424–425 Rehman, F. N., 204 Rehman, I., 437 Rehr, B., 402 Reichardt, W., 186 Reichenauer, T. G., 389 Reichert, J. M., 121 Reicosky, D. C., 117 Reid, G. A., 407, 410 Reigstad, L. J., 319, 321–322 Reijnders, W. N. M., 424 Reilly, A., 400 Reinhold-Hurek, B., 389 Reinthaler, T., 202 Reitenga, K. G., 289 Relman, D. A., 20, 105, 108 Remington, K., 13, 36, 293, 320, 342, 374 Renger, E. H., 470 Renger, G., 470 Ren, J., 50 Rennenberg, H., 153 Rensing, C., 424 Resenchuk, S., 308 Revill, A. T., 42 Revsbech, N. P., 65–66, 79, 81–83, 94, 164, 166, 170–171, 186, 470–471, 474, 483 Rey, A., 116 Rhee, S.-K., 41, 43, 66–67, 71–73, 293 Rheinheimer, G., 154 Richard-Fogal, C., 407 Richard, G., 94, 100 Richardson, A. R., 483
507 Richardson, D. J., 359, 400, 406–407, 410, 412, 415–416, 418 Richardson, P. M., 14–15, 21, 359, 466–467 Richardson, T. H., 467 Rich, J. J., 65–66, 74, 76, 79–80, 82 Richnow, H.-H., 29 Richter, A., 186, 322, 359, 466 Richter, L., 45–46 Rick, J., 438 Riethman, H., 295 Rigaard-Petersen, N., 65 Righetti, P. G., 437 Rijpstra, I. C., 65 Rijpstra, W. I., 66 Riley, L., 308 Ripka, K., 93 Risgaard-Petersen, N. S., 38, 65–67, 79, 81–84 Risk, D., 116, 128 Rittmann, B. E., 179, 189, 202, 221, 270 Ritz, K., 92, 101, 104, 106–107 Rizzi, A., 439 Robarge, W. P., 94, 97–98, 100 Robb, L. C., 454 Roberton, A. M., 402 Roberts, K. J., 5, 12–15, 18, 21, 41, 43, 46, 293, 358–359, 374, 384, 388–389, 466–467 Robertson, B. R., 468, 470, 479–481 Robertson, G. P., 153, 155 Robertson, L. A., 36, 65–66, 257 Robert, S. S., 42 Roberts, S. A., 424 Robin, D., 95–96, 98 Robinson, J. M., 359 Roche, 295–296 Rochon, Y., 436–437 Rock, L., 151 Rockstro¨m, J., 347 Rodenacker, K., 189 Rodrigo, A. G., 440 Rodrigues, M. L., 404, 406–407, 417–418 Rodriguez-Valera, F., 320 Rogier, O., 305 Rolda´n, M. D., 154, 400 Romao, M. J., 406–407 Ro¨mheld, V., 156 Rondon, M. R., 321 Ronquist, F., 46 Rosell, F. I., 412 Rosenberg, N. J., 126 Rosenzweig, A. C., 423–425, 430 Roskams, J., 295 Roslev, P., 202 Rossetti, S., 276 Roszak, D. B., 467 Rotenberg, E., 127 Roth, A., 308 Rothery, E., 407, 410 Rotthauwe, J.-H., 5, 40, 43, 274, 383
508
Author Index
Rousk, J., 94 Rowan, A. K., 251, 260, 271 Ruan, J., 302 Ruan, X. H., 38 Rubtsov, D. V., 437–438 Rudemo, M., 440 Rudolf, M., 404, 406–407, 412–413 Rusch, D. B., 13, 36, 293, 320, 374 Russell, M. J., 346 Rustad, L. E., 116 Rutter, W. J., 349 Ru¨tting, T., 95–96, 153 Rysgaard, S., 38, 65–67, 79, 81–83 S Saano, A., 12, 202 Sacchi, N., 349, 355 Sachdeva, R., 466 Sadana, J. C., 402 Sagi, D., 438 Sahan, E., 37, 44–45 Saito, M., 141, 154 Sakka, K., 38 Sakka, M., 38 Sako, Y., 38, 66 Salim, M., 437 Salzberg, S. L., 308, 312 Samad, B., 308 Samson, G., 305 Sanchez, J. C., 437 Sa´nchez-Martı´n, L., 140 Sanders, M. J., 295 Sanders, R., 65 Sanders, T., 186, 203 Sannia, G., 424 Sansom, M. S. P., 406, 417 Santegoeds, C. M., 166–168, 171 Santo Domingo, J. W., 364 Santoro, A. E., 5, 12–13, 18, 37, 41, 43–46, 293, 358, 374, 384, 388–389 Sapra, R., 352 Sarkis, G. J., 295 Sarret, G., 98 Sasaki, H., 412 Sasaki, Y., 154 Satoh, H., 38, 163–165, 167, 171, 175, 177, 180, 186–187, 197, 240 Sato, R., 400–401 Sauer, T. J., 117 Saunders, A. M., 466, 470 Saunders, J. R., 21, 36, 40 Savouret, J. F., 349 Sayavedra-Soto, L. A., 40, 219, 227–228, 242–244, 292–293, 304, 424–425, 430, 478 Sayers, E. W., 290 Scally, A., 295 Schadt, C. W., 377, 380 Schaeffer, B., 440
Schaffer, A. A., 46 Schalk, J., 66, 71, 358 Schappert, H. J. V., 128 Schautz, A., 119, 140 Scheachter, M., 442 Schechter, A. N., 353 Scheffer, M., 347 Schein, J. E., 302 Scheithauer, J., 407, 410 Schellnhuber, H. J., 347 Schenk zu Schweinsberg-Mickan, M., 98 Schiffer, A., 413 Schiff, S. L., 151 Schimel, J. P., 92, 96 Schirle, M., 438 Schleifer, K.-H., 40, 66–70, 164–165, 172, 175, 177, 179, 186–187, 189, 202–203, 208, 276, 293, 389 Schleper, C., 5, 10–15, 18–19, 21–22, 36–37, 41, 46, 153–154, 291, 293, 319–322, 327, 342, 359, 374, 466–467, 479, 482 Schlesner, H., 69 Schloss, P. D., 45, 47, 377 Schloter, M., 6–8, 16, 21, 153, 202, 293, 359, 466, 479 Schlouten, S., 79 Schmider-Poignee, N., 67 Schmid, M. C., 38, 40–41, 44, 46, 65–73, 77, 79–80, 82–83, 189, 202–203, 358–359, 377, 408 Schmidt, F., 29 Schmidt, H. L., 150, 155 Schmidt, I., 44, 67, 69, 359, 470 Schmidt, M., 358 Schmidt, T. M., 470, 479–481 Schmittgen, T. W., 231 Schmitz-Esser, S., 70 Schofer, D., 389 Scholz, M. B., 289 Schouten, S., 29, 43, 65–66, 293, 384, 466 Schramm, A., 164–168, 171, 186–187, 189, 203, 270, 293, 466 Schreiber, F., 64, 166, 171, 360 Schrenzel, J., 303 Schroder, S., 437, 440 Schubert, C. J., 66–67, 104 Schubert, S., 140 Schuhegger, R., 189 Schu¨ller, E., 93 Schultze, M., 66 Schultze, S., 359 Schulze, A., 230 Schulze, E. D., 150 Schulze, W. X., 437 Schumacher, W., 400, 402, 404–405, 409, 411–413, 417 Schuster, S. C., 5, 13, 36, 41, 46, 153, 320–321, 327, 342, 359, 374, 466–467, 479 Schutzbier, M., 436
Author Index
Schuur, E. A. G., 121 Schwark, L., 6–8, 16, 21, 153, 293, 322, 359, 466, 479 Schwartz, D. C., 330 Schwartz, E., 93, 99–100 Schwarz, U., 153 Schwermer, C., 203 Scollard, D. M., 349 Scott, K. A., 406, 417 Scow, K. M., 40 Sears, H. J., 400 Sebastian, L. T., 440 Seidman, J. G., 230 Seifert, J., 29 Seitzinger, S. P., 65, 347 Sejr, M. K., 38, 66–67, 79 Sekido, T., 40, 272 Sekiguchi, Y., 164 Selengut, J. D., 308 Selezi, D., 12, 19 Sellner, B., 238 Semb, H., 351 Semprini, L., 219, 222, 224, 226–229, 238, 242–243 Senko, J., 402 Senn, H., 470, 481 Sessitsch, A., 378, 381, 389 Severance, S., 427 Seward, H. E., 406–407, 412, 415–416 Sexstone, A. J., 94 Shanks, C. A., 96 Shanks, O. C., 364 Shelnutt, J. A., 409 Shen, J.-P., 479, 482 Shen, X., 289 Shigetomo, H., 71 Shi, J.-H., 71 Shimamura, M., 71 Shimamura, T., 416 Shima, S., 360 Shin, M. W., 40, 425 Shipley, G. L., 353 Shiraishi, K., 164 Shi, Z., 302 Shizuya, H., 321, 324, 328 Shlyakhter, I. A., 302 Shoji, T., 40 Short, J. M., 467 Shoun, H., 153–154 Shouten, S., 66, 80 Shrivastava, S., 309 Shumway, M., 312 Si, B. C., 119, 128 Siciliano, S. D., 115, 117, 119, 140 Sieber, M. W., 351 Sigman, D. M., 80–81, 151 Sigrist, C. J., 308 Sigsgaard, C., 121
509 Simkins, S., 120, 128 Simmons, B. A., 352 Simon, J., 358–359, 400–401, 403–404, 406–407, 409–410, 412–413, 417 Simon, M. I., 321, 324, 469–470 Simpson, I. A., 437 Simpson, J. T., 302 Singha, B., 104 Singh, K., 365 Sinninghe Damste, J. S., 384 Sinninghe Damste´, J. S., 29, 43–44, 66–67, 69, 80, 293, 466 Siripong, S., 270 Six, J., 94 Sjolander, K., 308 Skern, R., 231 Skiba, U. M., 140 Skibinski, D. O. F., 440 Skiena, S., 303 Slepak, T., 321, 324 Sliekers, A. O., 66 Sliekers, O., 358 Slijper, M., 437 Sloane, A. J., 440 Slutsky, A., 406, 408, 412, 416 Smales, C. M., 448, 452–453 Smernik, R. J., 94 Smets, B. F., 94 Sˇmilauer, P., 50–52 Smith, C. J., 22, 42, 65, 359 Smith, F., 295 Smith, J. A., 230 Smith, J. L., 359 Smith, K. A., 116 Smith, M. S., 153 Smith, R. D., 353 Smith, R. L., 155 Smith, Z., 5, 46 Smits, T. J., 38 Smolders, A. J. P., 65 Smoot, M., 312 Snider, D. M., 151 Snozzi, M., 470, 481 Snyder, L. A., 309 Sogin, M. L., 20 Solomon, E. I., 423–424 Sondergaard, I., 440 Sondergaard, J., 121 Song, B., 38, 63, 65–67, 70, 72–74, 77, 79–80, 82 Song, L., 50 Song, S., 50 Sonnenberg, R., 377, 384 Sonnhammer, E. L., 308 Sorek, R., 352, 365 Sorensen, H. A., 440 Srenson, J., 65 Sorensson, F., 197 Souvorov, A., 308
510 Spang, A., 6, 41, 466–467 Sparling, G. P., 98 Speleman, F., 353 Spieck, E., 6, 41, 186, 203, 294, 359, 466–467 Spoelstra, J., 151 Spormann, A. M., 105, 108 Springer, N., 175 Spring, S., 67 Srinivasan, S., 66–67, 358 Stach, P., 402–407, 409–413, 417 Stackebrandt, E., 17 Stahlberg, A., 351 Stahl, D. A., 5, 12–13, 36, 41–42, 69, 179, 186, 189, 202, 221, 276, 280, 294, 359, 389, 465–468, 474–476, 479–480, 482–483 Staley, J. T., 66–67, 358 Stal, L. J., 188 Stange, C. F., 153 Stange, F. C., 93 Stangegaard, M., 351, 354 Stan-Lotter, H., 186 Stannard, D. I., 126 Starkenburg, S. R., 40, 289, 292–293, 304, 425, 478 Stark, J. M., 92, 95, 97–98, 144, 470, 478 Stark, M., 308 Staudenmann, W., 400, 404, 407 Steadman, C., 384 Steffen, W., 347 Stehler, P., 377, 384 Stehr, G., 470, 478 Steidle, A., 189 Steiner, W., 427 Stein, J. L., 321, 328 Stein, L. Y., 5, 40–41, 145, 189, 219, 273, 291–293, 304, 347, 359, 361–362, 425 Stein, T., 401 Stekel, D. J., 309 Stenstedt, T., 442 Stepanauskas, R., 292 Stepaniants, S., 382 Stephen, J. R., 5, 21, 36–37, 40, 46, 221, 466 Stephens, P. J., 295 Steppi, S., 45–46 Sternberg, C., 188 Stetter, K. O., 154, 413 Steuber, J., 413 Stevenson, B. S., 105, 108 Stevens, R. J., 95–96, 116–117, 153–155 Stevens, S. E. Jr., 349 Stewart, A. C., 309 Stewart, V., 359 Stickland, J. D. H., 469 Stief, P., 203, 293 Stingl, C., 436 Stockdale, E. A., 95, 101–102, 104, 106–108 Stoecker, K., 186–187, 189, 203–205, 208–209, 211, 359, 466
Author Index
Stoj, C. S., 424 Stolz, J. F., 402 Stoodley, P., 171 Stothard, P., 309 Stott, A., 65 Stott, L., 77 Stoughton, R., 382 Stouthamer, A. H., 402 Stralis-Pavese, N., 381, 389 Strampraad, M. J. F., 470, 474 Straus, D., 364 Strauss, J., 93 Streck, T., 153 Streit, W., 41, 466–467 Strous, M., 36, 38, 43, 65–68, 70–71, 77, 79–80, 321, 358–360, 384, 408, 466 Strozynski, M., 436 Strub, J. M., 438 Struhl, K., 230 Strunk, O., 45–46 Stuart Grandy, A., 155 Stubner, S., 12 Stuhler, K., 437–438 Sugahara, J., 291, 466–467 Sugiyama, J., 153–154 Sumner, L. W., 450, 452, 459 Sundaram, U. M., 423 Sun, J., 37, 45, 47, 50 Sun, S., 50 Sutka, R. L., 155, 359 Sutton, G., 301, 320 Sutton, M. A., 347 Suwa, Y., 21, 38, 40, 44, 66, 313, 470, 478 Suzuki, I., 223, 470, 481 Suzuki, M. T., 23, 321, 328, 342 Suzuki, S., 424 Suzuki, T., 470, 478 Swanson, R. V., 320–321 Sweetman, G., 438 Szklarczyk, D., 308 T Taaffe, L. R., 424 Tachiiri, Y., 321, 324 Tago, K., 141, 154 Tajima, Y., 41 Takagi, T., 308 Takao, F., 71 Takaya, N., 154 Tamakoshi, M., 416 Tamura, K., 46 Tanabe, M., 308 Tanaka, H., 255 Tanaka, N., 408 Tang, Z., 38, 43–45, 47, 54, 66–68, 74, 76–77 Taniguchi, T., 308 Taniguchi, Y., 348, 352
511
Author Index
Tanimoto, T., 154 Tanji, Y., 155 Tanokura, M., 412 Tapper, N. J., 127 Tappe, W., 238 Tarnawski, S., 68, 70 Taroncher-Oldenburg, G., 377, 379, 381 Tartaro, K. R., 295 Tashiro, T., 470, 478 Tate, J., 308 Tate, M. E., 145 Tatusova, T., 308 Tatusov, R. L., 308 Taubert, M., 29 Taub, F., 348 Taupp, M., 322 Tautz, D., 377, 384 Tavares, P., 359 Tawfik, D. S., 296 Taylor, A. B., 424 Taylor, J. S., 407, 440, 453 Taylor, L. T., 23, 43, 186, 466 Taylor, M. W., 71, 77, 321, 358 Taylor, P., 407, 410 Taylor, Z., 470 Teira, E., 43, 202, 384, 466 Teissier, S., 186 Teixeira, M., 401–402, 412–413 Terada, T., 164 ter Braak, C. J. F., 50–51 Terry, K. R., 145 Terzulli, A. J., 425 Tettelin, H., 312 Teucher, N., 436 Thakali, K., 424 Thamdrup, B., 38, 65–67, 78–80, 82, 358, 474 Theriot, J. A., 190 Thiede, B., 436 Thingstad, T. F., 322 Thoene, B., 153 Thomas, M. R., 440 Thompson, J. D., 46 Thompson, R. J., 384 Thomson, A. J., 400, 406–407, 412, 415–416 Thomson, B., 29 Tho¨ny-Meyer, L., 407 Thuoc, C. V., 38 Thu, P. T., 38 Tian, F., 37–39, 43–45, 47, 50, 54, 66–68, 74, 76–77 Tichopad, A., 353 Tiedje, J. M., 40, 44, 66–70, 94–96, 117, 120, 128, 153, 327, 358 Tiffert, Y., 359 Tikhonova, T. V., 406, 408, 412, 416 Till, A. R., 101 Timlin, R., 77
Timmermann, G., 37, 40–41, 189, 202–203, 377, 466, 480, 482 Timmers, P., 6, 43, 384, 466 Tischler, P., 6, 41, 466–467 Tisdall, J. M., 94 Tobias, C. R., 38, 63, 65 Tocheva, E. I., 412 Toffin, L., 105 Tollaksen, S. L., 440, 453 Tollin, G., 424 Torre, M., 186 Torsvik, V. L., 12, 322 Tourna, M., 12, 19, 22, 41 Tovell, N., 406, 410 Townsend, A. R., 347 Toyoda, S., 155 Toyomoto, T., 71 Traini, M., 437 Tramper, J., 238 Treumann, A., 436 Treusch, A. H., 5, 13, 36, 41, 46, 293, 320–322, 327, 341–342, 374, 466–467 Trimmer, M., 65, 78–84 Trincone, A., 154 Tringe, S. G., 365 Tripp, H. J., 467 Trofimov, A. A., 406 Truebano, M., 440 Trumbore, S. E., 121 Tscherko, D., 13 Tsuneda, S., 40–41, 65 Tsushima, I., 164 Tu, Q., 381, 389 Turco, R. F., 121 Turk, K. A., 104 Turley, S., 412 Turner, D. J., 295 Tu, Y., 382, 384 Twachtmann, U., 66–68, 70 Tyler, M. I., 437 U Ubbink, M., 424 Uchiyama, H., 153–154, 164 Ueda, S., 38, 66 Uhlen, A. K., 440 Uitterlinden, A. G., 17–18, 273–274 Ulloa, O., 66, 79, 474 Umana, N. H. N., 93 Umemiya, Y., 186 Underhill, S. E., 238 Unwin, R., 437 Upadhyay, A. K., 359 Urakawa, H., 14–15, 21, 41–42, 186, 291, 293, 357, 359, 389, 425, 466–468, 474–476, 479–480, 482 Urbain, V., 179, 202, 221
512
Author Index
Urich, T., 6–8, 16, 21, 153, 293, 322, 359, 466, 479 Urushigawa, Y., 470, 478 Usadel, B., 437 Uzman, S., 255 V Vacherie, B., 186, 292 Vagin, A. A., 431 Vagner, T., 103–104 Valcu, C. M., 440 Valcu, M., 440 Valentin, F., 46 Vallejo, A., 140 van Alen, T., 65, 360 van Berchum, H., 402 van Berloo, S., 470, 474 van Beusichem, M. L., 347, 359 van Bleijswijk, J., 6, 43, 384, 466 VanBogelen, R. A., 439–440, 447, 449–450 van Cleemput, O., 151, 153 van de Graaf, A. A., 36, 65–66 van den Bergh, G., 437 van den Heuvel, J. C., 187, 189, 250 van de Pas-Schoonen, K., 44, 66–67, 69 van de Pas-Schoonen, K. T., 36, 65, 358, 360 van der Biezen, E., 437 van der Star, W., 358 Vandesompele, J., 353 van de Vossenberg, J., 38, 44, 66–67, 69, 77, 79–80, 358 van Domselaar, G. H., 309 van Dorsselaer, A., 438 van Drecht, G., 65 van Groenigen, J. W., 139, 141, 144, 146, 148, 151–153 Vanhulle, S., 424 van Kessel, C., 119, 144, 151, 153 van Loosdrecht, M. C. M., 219, 238, 251 van Niel, E. W. J., 257 van Niftrik, L. A., 44, 66–67, 69, 80, 358 van Nostrand, J. D., 381, 389 van Rijn, J., 203 van Roy, N., 353 van Spanning, R. J. M., 424 van Wonderen, J. H., 406, 410 Vaque´, D., 470 Varadarajan, A., 352 Velthof, G. L., 140, 144, 347, 359 Venceslau, S. S., 413 Veneziano, D., 384 Venkiteswaran, J. J., 151 Venter, E., 303 Venterea, R. T., 117, 140 Venter, J. C., 13, 36, 293, 320, 342, 374 Verbruggen, M. J., 66 Vercauteren, F. G. G., 437 Verchot, L. V., 116–117
Vergez, L. M., 361–362, 425, 477 Vergin, K. L., 467 Verhamme, D. T., 14, 27, 29–30, 41, 466, 479 Verity, P. G., 359 Verma, S. H., 126 Vermeulen, J., 151 Verstraete, W., 37 Vertessy, R. A., 127 Vickerman, J. C., 101 Villers, F., 440 Vitek, O., 438 Vlasie, M. D., 424 Voerkelius, S., 150 Vogel, C., 348 Vogel, J. G., 121 Vogel, T. M., 99 Vogt, C., 29 Volkl, P., 154 Volkman, J. K., 42 von Bergen, M., 29 von Berg, R., 153 von Heijne, G., 308 von Mering, C., 308 von Ohle, C., 171 Vonrhein, C., 413, 430 Vonstein, V., 306 Voordouw, G., 401 W Wagner, M., 11, 37, 40–41, 44, 46, 66–70, 165, 167, 172, 175, 177, 179, 185–189, 191–192, 201–209, 211, 221, 239, 273, 278, 282, 292–293, 359, 377, 389, 466–467, 480, 482 Wagnon, C. A., 9 Wait, R., 453 Walenz, B. P., 303 Walker, C. B., 5, 12–15, 21, 36, 41, 186, 291, 293–294, 357, 359, 425, 466–467 Walkinshaw, M. D., 407, 410 Wallace, I. M., 46 Walsh, B. J., 437 Walsh, K., 66 Walters, W. A., 11 Walther, K., 469 Wanek, W., 93 Wang, C., 39, 47, 50 Wang, J. G., 99–100 Wang, L., 37–38, 40, 43–49, 52–55, 66–68, 74, 76–77 Wang, R.-F., 71, 348 Wang, T., 348 Wang, W., 483 Wang, X., 140 Wang, Y. N., 71, 404, 409 Wang, Z., 365 Wankel, S. D., 151 Wantland, N. B., 345 Wan, Y., 153
513
Author Index
Ward, B. B., 37, 65–66, 74, 76, 79–80, 82, 313, 361–362, 373, 377, 379, 381, 384–386, 389, 425, 470, 477–478 Warkentin, E., 413 Warren, J. E., 188 Watanabe, Y., 164–165, 167, 171, 175, 180, 186–187, 197, 291, 466–467 Waterbury, J. B., 5, 12–13, 36, 41, 186, 292, 294, 359, 466 Watson, B. S., 450, 452, 459 Watson, R. S., 261, 353 Watson, S. W., 470 Watzig, H., 437, 440 Webb, R. E., 36, 66, 358 Webb, R. I., 66, 80 Weber, I., 359 Weber, P. K., 102–105, 108 Webster, E. A., 140 Webster, G., 40 Wegl, G., 189, 203, 208–209, 211 Wehrfritz, J. M., 400 Wehrli, B., 66–67 Weichsel, A., 424 Weidler, G. W., 186 Weilharter, A., 381, 389 Wei, X. M., 40, 425 Welker, J. M., 121 Well, R., 155–156 Wells, G. F., 46, 271–273 Werber, M. M., 154 Werner, R. A., 155 Wesselink, B. J., 257 Wessels, H. J. C. T., 64, 360, 365, 437 West, B. L., 349 Westbrook, J. A., 453 Westerhoff, H. V., 424 Westram, R., 45–46 Whalen, S. C., 116 Wheeler, K. E., 108 Wheelock, A. M., 440 Whiteley, A. S., 7, 29, 187 White, O., 290, 308 White, S. A., 400, 404, 407 Whitfield, M., 470 Whitman, W. B., 348 Whittaker, M., 227, 243, 359 Wickens, K., 77 Wickham, G. S., 187, 276 Wickstead, B., 6 Wiebe, W. J., 186 Wiegand, A. P., 353 Wilderer, P. A., 188 Wilkins, M. R., 440 Williams, D. L., 349 Williams, K. L., 437 Williams, K. P., 307 Williams, M. A., 94 Williams, R., 296
Wilm, A., 46 Wilson, G. W., 117, 128 Wincker, P., 71, 77, 321, 358 Winefield, C. S., 479, 482 Winkler, G., 189 Winogradsky, S., 186, 359 Winterholler, B., 104–105 Wintzingerode, F. V., 17 Wittebolle, L., 37, 271 Witte, O. W., 351 Wittwer, C. T., 353 Witzel, J. P., 40 Witzel, K. P., 40, 43, 274 Witzel, K.-P., 5, 358, 383 Woebken, D., 38, 66–68, 71–73, 77, 79 Wofsy, S. C., 470, 478 Wohlleben, W., 359 Woldendorp, J. W., 5 Wolf, R., 470 Wolinsky, M., 322 Wong, K., 302 Wood, H. M., 295 Wrage, L., 117 Wrage, N., 139–141, 144, 146, 148, 151–153, 347, 359 Wraith, J. M., 94 Wright, P. C., 437 Wuchter, C., 6, 29, 43, 384, 466 Wu, D., 36, 359, 374 Wuertz, S., 188–189 Wu, K. Y., 320–321, 328 Wu, L. F., 358, 377, 381, 389, 436 Wu, L. Y., 380 Wurtzel, O., 352, 365 Wu, S. H., 440 Wu, T. D., 105 Wu, W., 377 X Xavier, A. V., 401–402, 412–413 Xavier, J. B., 188 Xian, X., 351 Xiaotang, J., 156 Xia, Q., 348 Xie, G., 289 Xie, X. S., 348, 352 Xing, L., 156 Xue, D., 151 Xu, M., 381, 389 Xu, Y., 346 Y Yadhukumar, Buchner, A., 45–46 Yakimov, M. M., 12, 14 Yakir, D., 127 Yamagishi, H., 155 Yamagishi, T., 38, 66 Yamaguchi, K., 424
514
Author Index
Yamauchi, T., 164 Yamulki, S., 153 Yan, F., 140 Yang, G., 37, 45, 47, 50 Yang, J., 322 Yang, Y., 66–67, 71–73 Yan, J. X., 453 Yano, T., 416 Yao, X., 348 Yates, T., 117 Yates, T. T., 119, 128 Yawata, Y., 164 Yeom, J., 436 Yeung, E. S., 437, 440 Yilmaz, S., 365 Yin, Y., 381, 389 Yokoyama, K., 416 Yoon, D. N., 293 Yoon, J., 424 Yooseph, S., 320 Yoshida, N., 155 Yoshie, S., 65 Yoshinaga, I., 38, 66 Young, I. M., 92 Yuan, Z., 65 Yu, B., 189 Yu, K., 121 Yu, R., 238 Yura, K., 424 Yuvaraj, P., 190 Z Zabel, C., 437, 440 Zani, S., 359
Zardoya, R., 20 Zatsman, A., 359 Zechmeister-Boltenstern, S., 93, 144, 152 Zedelius, J., 64, 360 Zehr, J. P., 359, 389 Zeng, R. J., 65 Zerbino, D. R., 302 Zeytun, A., 289 Zhang, F., 153 Zhang, G., 50 Zhang, H., 437, 440 Zhang, J., 46, 50, 409 Zhang, L.-M., 14, 27, 29–30, 41, 389, 466, 479 Zhang Newby, B. M., 190 Zhang, X., 37, 39, 45, 47, 50 Zhang, Y., 38, 348 Zhang, Z., 37–40, 43–50, 52–55 Zhan, X. Q., 450, 452 Zhao, X., 468 Zhou, J. Z., 40, 327, 358, 377, 380–381 Zhu, H., 302 Zhu, Y., 352 Ziebis, W., 189 Ziegler, L., 424 Ziman, M., 382 Zimmerman, K., 153 Zopfi, J., 68, 70 Zubieta, I. X., 389 Zumft, W. G., 154, 358 Zuo, J.-E., 66–67, 71–73 Zvyagilskaya, R. A., 406, 408, 412, 416 Zwart, K. B., 144 Zwick, M. E., 352
Subject Index
A Aerobic and anaerobic ammonia/ammoniumoxidizing microorganisms Beta-AOB, 37 community change and environment Nitrosomonas amoA gene, 54–55 community structure analyses classification, 47–50 diversity and richness, 44–46 phylogenetic, 46–47 inorganic nitrogen species, 37–38 molecular ecological characterization AOA and Beta-AOB abundance, 43–44 genetic markers, 39–41 genomic DNA and clone library, extraction, 42–43 niche specificity, 38 physicochemical parameters and community structure statistical results, CCA, 52–54 sampling sites and physicochemical characterization environmental parameters, 39 “hypereutrophied” habitats, 38 water samples, 39 Ammonia monooxygenase specific oxygen uptake rate (AMO-SOUR) enzymes, 242 O2 consumption, 225 qRT-PCR assay, 234 Ammonia-oxidizing archaea (AOA). See also Nitrogen metabolism and kinetics, AOA activity, soil gene abundance data, 25 inhibitors, 24–25 nitrification, 23–24 transcriptional, quantification, 26 amoA genes, 5–6 and AOB amoA gene, 375 DNA microarray, 375 functional gene approach, 375 robust measure, 381 array and community composition, 388 biogeography, 388 cellular characteristics, 467 CO2 fixation, 3-hydroxypropionate/ 4-hydroxybutyrate cycle
acetyl-CoA carboxylase genes analysis, 14 hcd genes analysis, 15, 16 community composition and diversity, characterization, 15–16 clone libraries analysis, 18–20 diversity, 17 high-throughput sequencing methods, 20–21 limitations, 16–17 nucleic acid fingerprinting, 17–18 technical issues, amoA genes, 17 growth and abundance gene quantification, 22–23 marker gene quantification, 21 most probable number (MPN) method, 21 relative changes, 21–22 molecular methods, 4–5 monoxygenase, 6 nucleic acid extraction method, 8–9 solutions and reagents, 7–8 spiked soils samples, 9 PCR amoA genes, 13 16S rRNA genes, 10–13 population and community ecology, 5 reverse transcription and cDNA production, soil control reactions, 10 DNA/RNA nucleic acid dilution and DNase, 9–10 negative control, 10 protocol, 10 RNA, 9 sampling and experimental design, 6–7 thaumarchaeal, 6 Ammonia-oxidizing bacteria (AOB). See also Ammonia-oxidizing archaea (AOA); Wastewater, AOB biofilm community, 239–240 human impacted and engineered systems, 482 Nitrosomonas europaea, model, 221 AMO-SOUR. See Ammonia monooxygenase specific oxygen uptake rate Amperometric microsensors, 166–167
515
516
Subject Index
Anammox. See also Molecular methods, anammox bacteria; Stable isotope methods, anammox bacteria microbial interactions, 66 N removal, 65 AOA. See Ammonia-oxidizing archaea AOB. See Ammonia-oxidizing bacteria Apre´s sequencing annotation components, 310 gene prediction, 306–308 nitrifier genomes analysis, 306, 307 resources, 307–308, 310 web-based packages and pipelines, 309–311 comparative analysis orthologs finding, 311 protein-based, 311 tBLASTx and MUMmer tools, 312 Area-under-the-curve (AUC) analysis soil gas profile, 127 surface flux, 129 Array printing, hybridization and scanning applications community composition characterization, 386 covarying archetypes, 384, 385 Nitrosopumilus maritimus, 389 signals comparison, 387 sediment and oceanic clades, 388 temporal patterns (TPs), 386 DeRisi style arrayer, 380 influencing factors incubation length, 382 posteriori tests, 381 sensitivity and probe capacity, 383–384 wash conditions, 381–382 possibilities and limitations clone libraries, 390 functional gene sequences, 389 relative fluorescence ratio (RFR), 381 AUC. See Area-under-the-curve analysis B Bacterial gene expression, nitrogen cycle metabolism environment dinitrogen gas, 346 nitrous oxide (N2O), 347 nucleic acids, markers cDNA synthesis, 351 isolation RNA, 354–356 PCR primers, 351–352 quality RNA, 348–351 relative mRNA, 352–354 RNA analyses, 347–348
transformations laboratory culture, aerobic bacteria, 360–361 organisms and reactive pathways, 356–360 reconstruction, genome-informed, 361–364 Batch bioreactors, stress response identification experimental protocols and physiological measurements AMO, HAO enzymes, 224–225 colorimetric assay, 224 cometabolism, 225–226 ICP-OES spectroscopy, 226 late-exponential/early-stationary phase, 224 minimal growth media, 223–224 Monod curve, 223 oxidative stress, 226 redox state/morphology, 225 tert-butyl rubber septa caps, 224 trace metals, 224 O2 and NH3, 223 transcriptional assays and sentinel gene expression annealing temperature, 232 cuvette-free spectrophotometer, 230 dissociation curve, 232 fluorescence, 231 gene expression level, 230 inhibitors, 228–229 methods, 231–232 microarrays, 227 Qiagen RNeasy Mini-Kit column, 230 qRT-PCR, 223, 227 random hexameric primers, 232 RNA isolation, 227 Trizol reagent, 227 Batch growth assay cell accumulation, 234 colorimetric method, 234 inhibition testing, 233 BCO. See Blue copper oxidase Biogeochemical N cycle discovery, 64 denitrification rates, 65 high salinities, 65 rivers and estuaries, 64 Blue copper oxidase (BCO) activity, 430 crystal structure, 431 detection in-gel activity assay, 427 methods, 427–428 dioxygen reduction, 424 C Canonical correspondence analysis (CCA) data standardization, 51 description, 50
517
Subject Index
statistics Beta-AOB, 52, 54 cluster–environment relationship, 54 ordination plots, 53 CCA. See Canonical correspondence analysis CLSM. See Confocal laser scanning microscope Community structure, aerobic and anaerobic ammonia oxidizers CCA (see Canonical correspondence analysis) classification data accuracy, 48 input files preparation, 47–48 UniFrac, 48–50 diversity and richness, microbial community DOTUR, 45 estimators comparison, 46 indices and estimators, 44–45 phylogenetic lineages AOA, 46–47 resident microbial community, 46 tree structure, 46 Confocal laser scanning microscope (CLSM) AOB quantification, 281 biofilm analyses, 190 detector sensitivity, 282 fluorescence-stained biofilm sample, 188 Continuous growth reactor acyl-homo-serine lactone molecule, 238 ammonium concentration, 238 contamination, 239 culture bioreactor design, 237 growth media, 238 influent and effluent feed, 239 qRT-PCR, 239 sentinel genes, 238 Cytochrome c nitrite reductase (NrfA) anaerobic respiratory pathway, 400 Harker peaks, 404, 405 molecular replacement method, 404 Patterson maps, 404, 405 synchrotron radiation source, 404 assays and reactivity absorption change, 411 HPLC, 411 sulfite reductase activity, 413 van-der-Waals radius, 412 dissimilatory nitrate ammonification, 400 electron transfer system chain topology, 417, 418 heme-packing motifs, 418 NrfH monomer asymmetry, 417 quinol dehydrogenase NrfCD, 415, 416 Thermus thermophilus, 415–416 heme group arrangement lysine role, 410 porphyrin planarity and electron storage, 409 protein folding core, 408–409 redox potential range, 409
isolation aminoterminal sequencing, 402 DEAE anion exchange chromatography, 402 nitrite reductase activity, 402 membrane-associated respiratory complex, 401 nitrite detoxification, 401 and NrfHA crystallization diffraction quality crystals, 402 reproducibility, 403 resolution structures and vapor diffusion, 403, 404 Q-loop mechanism, 400 quinol-oxidizing systems, 400, 401 reaction mechanism protein crystallography, 413 proton affinity, 415 soaking/cocrystallization, 413 tyrosine radical, 415 site architecture active cavity, stereo representation, 410, 411 calcium coordination, 410 electrostatic surface potential, 410 structure active site heme porphyrin ring, 408 e-proteobacterium Sulfurospirillum deleyianum, 405 heme group, 406, 407 intramolecular electron transfer, 406 pentaheme nitrite reductases, 405–406 sulfate and azide inhibitors, 407 Wolinella succinogenes purification, 403 D DAIME digital image analysis software “image segmentation”, 207 Linear Dipole/Inflate Algorithm, 208 multicolor images, 207 object editor, 208 thresholding, 207–208 workflow, 206–207 2-DE. See Two-dimensional gel electrophoresis Denaturing gradient gel electrophoresis (DGGE) PCR primers sequences and references, 273–275 procedure, 275 DFR. See Drip flow biofilm reactor DGGE. See Denaturing gradient gel electrophoresis Dissolved oxygen (DO), 261–262 Drip flow biofilm reactor (DFR), 221, 240 E EBBR technology. See Expanded bed biofilm reactor technology Enrichment ratio retention (ERR) incubation, 151–152 KCI extraction, 151
518
Subject Index
Enrichment ratio retention (ERR) (cont.) ‘O’ exchange quantification, 146 ‘O’ isotopic signature, 151 ERR. See Enrichment ratio retention Expanded bed biofilm reactor (EBBR) technology biofilm systems, 250 bioparticle performance data miniature, 262, 265 pilot plant, 262–264 cell immobilization, 250–252 design and operation aeration, 256 biofilm thickness control, 255–256 biomass support materials, 255 column ends, 254–255 fluidization, 253–254 layout, 252, 253 miniature, 258–259 pH control, 256–257 lab-scale, 254 startup, 257–258 nitrification measurement DO, 261–262 inorganic nitrogen, 260–261 nitrogen mass balance, 259–260 raw/used water treatment ammonia removal, 248–249 legal requirements, 249–250 static-fluidized transition, 250–251 surface area, colonization, 248, 249 F FDRs. See Fill and draw reactors Fields of view (FOV), 282 Fill and draw reactors (FDRs) cell culture, 236 nitrification inhibition, 236 NO2–accumulation, 234, 235 progressive addition, 236–237 pseudo-steady state, 234 spike and steady state addition, 237 FISH. See Fluorescence in situ hybridization Fluorescence in situ hybridization (FISH) AOB detection and quantification, 275 fixation and cryosectioning, 276 fluorescently labeled oligonucleotide probes cyanine and fluorescein dyes, 277 Nitrosomonas spp. and Nitrosospira spp., 277, 279 probes list, analysis, 277, 278 in situ detection, nitrifiers PAA-embedding, biofilm, 204–205 polyacrylamide (PAA) gel, 204 probes, 201 rRNA-targeted oligonucleotide probes, 202–203
microscope slide, 276–277 microscopy and AOB detection cell total number calculation, 282–283 direct/indirect cell, 282 methodology, 283 slides biomass, 279 solution, 281 Fosmid library biotechnological screening, 342 colony transfer, 339 construction E.coli, 324 steps, 323 genome fragments, archaea, 342 high-throughput sequencing, 341 picking, colonies, 338–339 replications, 339–340 screening, genes gene-containing clones, 340 384-well PCR plate, 341 sequencing, 341 titration, 337 Fourier transformed infrared (FTIR) spectroscopy advantages, 120 calibration absolute, 129 recirculating vs. static chambers, 128 evapotranspiration, 126 FTIR-TGA, 122, 125 H2O activity measures, 132 measurement issues advantages, 134 disadvantages, 132–133 vs. GC-based design, 133 N2 gas supply, 133–134 quick-disconnect system, 134 syringe-based sampling, 133 FTIR. See Fourier transformed infrared spectroscopy Functional gene array utility AOB and AOA, 374 array application, 384–389 detailed protocol, 390–394 DNA microarrays, 375 hybridization factors, 381–384 and scanning, 380–381 molecular methods, 374 operational taxonomic units (OTUs), 374 possibilities and limitation, 389–390 probe selection amoA gene, 375 Cy5-labeled oligonucleotide, 378 flourescence ratio (FR), 378 hybridization intensity, 377 mismatch (MM) target binding, 377 Mixall normalization, 378
519
Subject Index
preparation steps, 376 probe-target pairs, 377 target preparation N-hydroxysuccinimidyl (NHS), 379 PCR targets, 380 whole DNA (WDNA), 380 G Gas chromatograph (GC) syringe-based sampling, 133 vacutainers, 119 GC. See Gas chromatograph Genome fragment enrichment (GFE), 364 Genomics, N cycle Apre´s sequencing (see Apre´s sequencing) assembling sequence reads amount and types, 304 data combination solutions, 301, 304 next-generation sequencing, tools, 301–303 overlap algorithms and Newbler assembler, 301 closure and polishing draft assemblies, 304 finishing task, 304–305 hard-stops, 305 homopolymer base additions/deletions, 305 product categories, 305–306 Guinea pigs bacterial lab strains cultures, 293 functional genes, 290 microbial sequences, 293–294 NGS, 290 nitrification-centric genome projects, 290–293 libraries creation fluorophore signal, 297 Illumina genome analyzer, 296–297 454 paired-end sequencing, 296 sheared fragments size selection, 295–296 454 shotgun, 296 “next-gen” era sequencing Illumina GAiiX, 299–300 paired-end, 300 platforms and associated attributes, 297–299 454 pyrosequencing, 299 Sanger, 299 sample and sequencer considerations amplification, 295 cloneless libraries requirements, 295 platforms and associated attributes, 297, 298 quantity and quality, 294 GFE. See Genome fragment enrichment GHG. See Greenhouse gas Greenhouse gas (GHG) CH4 and N2O, 116–117
CO2, 116 flux function, 125, 131 H HAO-SOUR. See Hydroxylamine oxidoreductase specific oxygen uptake rate High-molecular weight (hmw) DNA and metagenomic libraries preparation ammonia-oxidizing archaea, 320 bacterial artificial chromosome (BAC), 321 cloning end repair, 335 fosmid vectors, 335 ligation, 335–336 Escherichia coli F-(fertility) factor, 321 infection, 336–337 fosmid library biotechnological screening, 342 colony transfer, 339 construction, 323–324 genome fragments, archaea, 342 high-throughput sequencing, 341 picking, colonies, 338–339 replications, 339–340 screening, genes, 340–341 sequencing, 341 titration, 337 genomic scaffolds, 320 in vitro packaging, 336 isolation acidic hot spring mud samples, 325–326 agarose matrix, 332–334 clay minerals and prokaryotic cells, 325 filamentous hot spring, 326 procedure, 327–329 soil samples, 326 marine sponge symbiont, 321 purification, PFGE electrical pulses, 332 electrophoresis, 331–332 humic and fulvic acids, 331 quality testing, fosmid clones, 337–339 sampling and preservation hot spring samples, 324 temperature, 342–325 size adjustment, shearing, 332 analysis, PFGE, 330 Homopolymer errors, 299 Hybridization buffer (HB), 280 Hydroxylamine oxidoreductase (HAO), 467 Hydroxylamine oxidoreductase specific oxygen uptake rate (HAO-SOUR) analytical measurement, 238 assay, 243 electron transport chain, 226 inhibitor, 225
520
Subject Index I
Image segmentation, 206, 207 Inflate Algorithm, spatial arrangement quantification “analyzed” and “reference” population, 197 vs. Linear Dipole Algorithm, 200–201 localization patterns, 201 null hypothesis, 199 overlapping pixels, 197–198 “positional fractions”, 200 principle, 198 “random analyzed” population, 199 Isotope ratio mass spectrometers (IRMS) analysis, soil microhabitats labelling, physical dissection chloroform fumigation-extraction, 98–99 15 N isotope dilution approach, 99–100 nitrogen assimiliation, 100–101 soil microhabitats, 99–101 physical separation, labelling experimental design, features, 97–98 FLUAZ model, 98 fractionation method, 96 L Linear Dipole Algorithm, spatial arrangement quantification autofluorescence, biomass, 197 density, population, 193 2-D images, 194 drawback, 194 geometric center, cell aggregates, 190 “linear dipole probes”, 191 mask image, 196–197 pair correlation function, 193 principle, 192 spatial arrangement patterns and g(r) plots, 195 Liquid ion exchange (LIX)-based microsensors, 167–169 M MALDI. See Matrix assisted laser desorption/ ionization MALDI-TOF MS. See Matrix-assisted laser desorption/ionization time of flight mass spectrometry MAR–FISH. See Microautoradiography combined with fluorescent in situ hybridization Matrix assisted laser desorption/ionization (MALDI), 101, 102 Matrix-assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS), 454, 457 MBBRs. See Moving bed biofilm reactors Michaelis–Menten equation, 476
Microarray oligonucleotide probes dUaa labeling, 379 hybridization protocol, 381–384, 391–394 Microautoradiography combined with fluorescent in situ hybridization (MAR–FISH) application chemical microprofiles, 177 polyphasic approach, 178 steady-state concentration profiles, CO2, 177–178 thin-sectioned autotrophic nitrifying biofilms, 179 ecophysiological interaction, community members cross-feeding experiment, 180 uptake patterns, 14C-labeled microbial products, 181 methodology FISH, 175–176 MAR, 176 microscopic observation, 176–177 sample fixation, washing and slide preparation, 174–175 sample incubation with radioactive compound, 173–174 principle, 172 Microbial activities, biofilm concentration profiles, 171 diffusional transport, 170 liquid flow, 169–170 numeric integration, 170 Microbial communities classification, UniFrac, 47-50 diversity and richness calculation, 45 DOTUR, 45 estimators, 45–46 indices, 44–45 rRNA sequence-based molecular techniques, 164 Microsensors amperometric, 166–167 application, nitrifying biofilms, 177–179 description, 165–166 measurements intact biofilm samples, 169 limitations, 171 potentiometric, 167–169 spatial resolution, 165 Mixall normalization, 378 Molecular ecological analysis, aerobic and anaerobic ammonia oxidizers AOA and Beta-AOB abundance amo gene clusters, 44 qPCR protocols types, 43 16S rRNA gene, 43
Subject Index
genetic markers amoA gene, 40–41 monophyletic lineages, 40 nirK nitrite reductase genes, 41 16S rRNA gene, 39 genomic DNA and clone library extraction, 42–43 Molecular methods, anammox bacteria detection and identification, 67 discovery, 66 FISH and PCR amplification, 67 PCR protocols hzo gene detection, 71–74 quantification, 74–77 16S rRNA gene detection, 68–70 Moving bed biofilm reactors (MBBRs), 251 Multicopper oxidase (MCO), Nitrosomonas europaea AOB and AOA, 425 BCO, Blue Copper Oxidase, 424–425 cell lysates, BCO detection, 427–428 characterization and crystallization activity, 430 metal content, 430 and structure solution, 430–431 description, 425–426 dioxygen reduction, 423–424 domains number and metal site location, 424, 425 function, 424 identification and classification, 426 isolation, 429 N Nitrogen metabolism and kinetics ammonia oxidation, 467 constants variability, AOB batch cultures, 481 N. maritimus ammonia oxidation values, 481–482 oligophilic microorganism, 480 substrate affinities, 480–481 HAO, 467 microbial activities monitoring, 483 transformation, 482 microorganisms growth and survival, 468 microrespirometry setup classical Clark-type oxygen sensor, 474 described experiments, 471, 472 electronic and electromagnetic noise sources, 471–472 measurements, oxygen uptake, 474 metabolic activity monitoring, 470 microsensor based respiration system, 471 oxygen trace recording and levels monitoring, 473 nitrification and anammox, 482
521 Nitrosopumilus maritimus and AOB ammonia oxidation, stoichiometry genome sequence, 478 half saturation constant, Michaelis–Menten equation, 476 individual oxygen traces, 474 microorganism metabolic activity, 479 N. winogradsky variable nitrite oxidation, 477 substrate affinities, 479–480 and uptake, 475, 476 strain cultivation and analytical methods culture media and growth conditions, 468–469 nutrient measurements, 469 Nitrogen mineralization and assimilation methodological approaches IRMS analysis application, 96–101 isotope pool dilution, 95–96 SIMS analysis applications, 101–108 undisturbed cores/sieved soils, 94–95 15 N isotope dilution, 109 soil microhabitats plant detritus, 93–94 rhizosphere, 93 soil aggregates, 94 Nitrosomonas europaea bacterial strain and culture conditions continuous culture, 440–441 growth and activity, 441 sequential variation, coefficient, 441–442 batch bioreactors response identification cell density measurement, 222 cell harvesting, 222 evaluation, 222 experimental protocols and physiological measurements, 223–227 O2 and NH3 prevention, 222–223 transcriptional assays and sentinel gene expression, 227–233 batch growth assay, 233–234 between-sample variability base state and heat-shocked gel comparison, 448–450 physical properties vs. cellular location, 453 protein expression, 448, 449 proteins interest identifications, 450 silver staining, 452–453 50-spot data set, 452 biofilms response identification concentration profile, 242 drip flow biofilm reactor, 240 effluent sample, 241–242 frosted microscope slides, 240 laminar film flow, 240 liberal use, ethanol, 241 natural environment and WWTP, 239 nitrite production, 241
522 Nitrosomonas europaea (cont.) biological and technical variability experimental protocols, 439–440 Molloy and pilot study, 440 proteomic experiments, 439 biosensors, 220–221 cell harvest and lysis, 442 chemostat stability and growth data biofilm cells, 445–446 continuous culture, 445 dilution rate, 445 contaminants, 219 continuous growth system response identification batch growth assay, 233–234 FDRs, 234–237 long term exposure effect, 233 reactors, 237–239 formation, biofilm, 243 image analysis master 2D software, 443 spot volumes, 443–444 NH3 oxidation, 219 nitrification inhibition test, 221, 242 nitrogen, cycle, 219 physiological and transcriptional response, 221 planktonic cell, 221 protein identification MALDI-TOF MS, 454, 457 mass spectrometry, 453–456 SDS-PAGE gels, 444 proteomics technologies analysis approach, 436–437 2-DE, 437 mass spectrometry, 438–439 physiological adjustments stimulus, 436 poststaining, 437–438 protein visualization, 437 removal, WWTPs, 220 sample preparation and isoelectric focusing, 442 second dimension separation gels, 443 protean II XL cell, 442 terrestrial and freshwater habitat, 221 variability, proteomic studies gel-to-gel, 454, 458 IEF/SDS-PAGE batch, 457–458 image analysis limitations, 459–460 low inherent methods, 458–459 samples, 457–459 “var load” test, 454 within-sample variability replicate experiment, 446 replicate gels, 447–448 spot number vs. staining intensity, 446, 447 spot volume, 447
Subject Index
Nitrous oxide (N2O), source determination application codenitrification, 154 d18O/SP fingerprint, tool, 156 dual isotope method, 153 genome sequencing, 154 isotopomer composition, 155 microbial activity, 153 moisture content, 152 oxygen exchange, 152 substrate availability, 155 data evaluation ammonia oxidation, 145 15 N data analyses, 147 nitrification, 145 nitrifiers vs. denitrifiers, 145–146 18 O data analyses, 148–150 ‘O’ exchange quantification, ERR approach, 146 ERR principle, 150–152 experimental setup headspace saturation, 143 incubation temperature, 143 soil samples, 144 formation pathways, 140 isotope ratios, 144 isotope tracing approach, 141 ‘O’ isotopic signature representation, 142 soil mineral ‘N’ analyses, 144–145 NrfA. See Cytochrome c nitrite reductase Nucleic acid fingerprinting technique, thaumarchaeal ammonia oxidizers, 17–18 Nucleic acids, N-metabolic activity markers cDNA synthesis, 351 isolation RNA, protocol, 354–356 PCR primers “artificial” differences, templating efficiency, 351–352 decay pathways, 352 multiple transcript regions, 352 selection, 351 quality RNA cellular mRNA levels, 349 extraction and agarose gels analysis, 350 mesophilic bacteria, 349 microbes, collection, 348 RT-qPCR assays, 350–351 relative mRNA Ct method, 353–354 external RNA standard usage, 352 “housekeeping” transcripts, 353 REST approach, 354 RT-qPCR, 353 RNA analyses microbes identification, 347 microbial metabolism, 348 protein-encoding RNA, 348
523
Subject Index P PCR. See Polymerase chain reaction PFGE. See Pulsed-field gel electrophoresis Polymerase chain reaction (PCR) amoA genes, 13 hzo gene detection protocols amino acid sequence regions, 74, 75 Ca. Kuenenia stuttgartiensis enrichment cultures, 71 primers and PCR conditions, 71–74 primers, DGGE sequences, 273–275 16S rRNA gene, 273 quantitative, anammox bacteria, 74–77 16S rRNA genes detection protocol, 68–70 and functional genes, 10–11 primers, 11–13 Potentiometric microsensors, 167–169 Pulsed-field gel electrophoresis (PFGE) gels, 330 hmw DNA purification, 331–332 Q qPCR. See Quantitative polymerase chain reaction qRT-PCR. See Quantitative real-time polymerase chain reaction Quantitative polymerase chain reaction (qPCR) analysis, AOA growth, 24 PCR primer sets, 274 preparation, 272 procedure, 273 Quantitative real-time polymerase chain reaction (qRT-PCR) gene expression, 234 genomic tool, 243–244 linear exponential phase, 232 microarray, 230 NH3 oxidation, 227 RNA isolation, 236 target genes, 231 R Reactive nitrogen transformations laboratory culture growth conditions, 360 N. oceani cells, 361 pH dependent availability, ammonia, 361 organisms and pathways ammonia, 359 denitrification, 358 dismutation, NO, 360 fixed reactive nitrogen species, 356 interconversion, 357 nitrate reduction, 357–358
oxidation state, intermediates, 357 reconstruction, genome-informed catabolic electron transport flow, 361–362 expression ratios, 363 N. oceani, 363–364 selected genes, transcript level analysis, 362 Relative Expression Software Tool (REST), 354, 363 Relative fluorescence ratio (RFR), 381 Revised isotope pairing (r-IPT) approach, 82 RFR. See Relative fluorescence ratio S SCOTS. See Selective capture of transcribed sequences Secondary ion mass spectrometry (SIMS) analysis, soil microhabitats NanoSIMS instrument 1–5 pA Csþ primary beam, 107–108 error propagation techniques, 108 structure, 101, 102 N assimilation and microbial identification ecophysiology studies, 105–106 “El-FISH”/“FISH-SIMS”, 105 N uptake rate, 103 proof-of-principle tests, 104–105 quantitative measurements, 104 sample preparation electron microscopic techniques, 106–107 ultrahigh vacuum, 106 TOF-SIMS and MALDI-TOF, 101, 102 Selective capture of transcribed sequences (SCOTS), 364 SIP. See Stable isotope probing Soil gas probes additional vacutainers, 119–120 CO2 concentration line, 124 data analysis calibration factor (C), 127 evapotranspiration, 126 gas concentration, 125–126 vapor density (pv), 126–127 water potential, 126 drawback, recirculating detection system, 119 field-based analysis, 118 flux data collection, 120–121 FTIR advantages, 120 description, 118–119 soil interface, 121–122 GHG, 116–117, 125 measurement categories, 118 nondestructive detectors use, 119 percent deviation, 123, 124
524 Soil gas probes (cont.) profile analysis peaks and troughs, 128 profile concentrations and surface flux green house gas flux function, 131 static and active chamber, relationship, 130 time-dependent factor, 132 sample collection, 117 Soil profile analysis individual peaks and troughs, 128 Spatial arrangement quantification biofilms, growth, 186 cultivation-independent molecular techniques, 186 FISH, 187 fluorescence-stained biofilm samples, 188 Linear Dipole Algorithm, 189 microbial mat, 189 mutualistic symbioses, 188 nitrifying biofilm populations lineage 1/2, Nitrospira, 208–209 oxidizers, 210 small-scale nitrite concentration, 211 Nitrosospira, 187–188 protocols, nitrifiers digital image analysis, 206–208 in situ detection, FISH, 201–205 microscopy and image acquisition, 206 stable isotope-labeled substrates, 188 theory, digital image analysis Inflate Algorithm, 197–201 Linear Dipole Algorithm, 190–197 Stable isotope methods, anammox bacteria DIN and N2, 77–78 in situ rates N2O collection/analysis, 84 r-IPT approach, 82 r14 value estimation, 82–83 sediment slurries anaerobic incubations, water, 78 15 NH4þ labeling, 81–82 15 NO3–or 15NO2–(15NOx–) labeling, 78–80 tracer methodology, 78 Stable isotope probing (SIP) DNA/RNA, 172 heterotrophic and autotrophic metabolism, soil, 14 thaumarchaeal ammonia oxidizers buoyant density distribution, 30 13 CO2 gas, 28
Subject Index
DNA, 29 incubation protocol, 27–29 RNA-SIP, 27 T Time-of-flight (TOF), 101, 102 Two-dimensional gel electrophoresis (2-DE) complex protein mixtures separation, 437 protein identification, 444 U UniFrac statistical software package data accuracy, 48 hierarchical clustering analysis, 49 input files, 47–48 internet Web site, 48 microbial community classification, 48 ordination diagrams, 49 principal coordinate plots Hzo protein sequences, 51 16S rRNA gene, 50 V “Var load” test, 454 W Washing buffer (WB), 280 Wastewater, AOB characterization, 271 DGGE PCR primers, 273–275 procedure, 275 DNA extraction, 271–272 FISH (see Fluorescence in situ hybridization (FISH)) genomic methods, 283 qPCR, 272–273 sampling, 271 WWTPs, 270 Wastewater treatment plants (WWTPs) AOB, 269 biofilm stree identification, 239 NH3 oxidation, 219 nitrification inhibitor, 244 nitrogen removal, 220 Nitrosomonas europaea cells, 243 WWTPs. See Wastewater treatment plants