An Introduction to Ecological Genomics
This page intentionally left blank
An Introduction to Ecological Genomics Ni...
31 downloads
1378 Views
15MB Size
Report
This content was uploaded by our users and we assume good faith they have the permission to share this book. If you own the copyright to this book and it is wrongfully on our website, we offer a simple DMCA procedure to remove your content from our site. Start by pressing the button below!
Report copyright / DMCA form
An Introduction to Ecological Genomics
This page intentionally left blank
An Introduction to Ecological Genomics Nico M. van Straalen and Dick Roelofs Vrije Universiteit, Amsterdam
1
1
Great Clarendon Street, Oxford OX2 6DP Oxford University Press is a department of the University of Oxford. It furthers the University’s objective of excellence in research, scholarship, and education by publishing worldwide in Oxford New York Auckland Cape Town Dar es Salaam Hong Kong Karachi Kuala Lumpur Madrid Melbourne Mexico City Nairobi New Delhi Shanghai Taipei Toronto With offices in Argentina Austria Brazil Chile Czech Republic France Greece Guatemala Hungary Italy Japan Poland Portugal Singapore South Korea Switzerland Thailand Turkey Ukraine Vietnam Oxford is a registered trade mark of Oxford University Press in the UK and in certain other countries Published in the United States by Oxford University Press Inc., New York # Oxford University Press 2006 The moral rights of the authors have been asserted Database right Oxford University Press (maker) First published 2006 All rights reserved. No part of this publication may be reproduced, stored in a retrieval system, or transmitted, in any form or by any means, without the prior permission in writing of Oxford University Press, or as expressly permitted by law, or under terms agreed with the appropriate reprographics rights organization. Enquiries concerning reproduction outside the scope of the above should be sent to the Rights Department, Oxford University Press, at the address above You must not circulate this book in any other binding or cover and you must impose the same condition on any acquirer British Library Cataloguing in Publication Data Data available Library of Congress Cataloging in Publication Data Straalen, N. M. van An introduction to ecological genomics / Nico M. van Straalen and Dick Roelofs. p. cm. ISBN-13: 978-0-19-856671-7 (alk. paper) ISBN-10: 0-19-856671-9 (alk. paper) 1. Molecular microbiology. 2. Microbiology. 3. Ecology. I. Roelofs, Dick. II. Title. 2005029756 QR74.S78 2006 576.5 0 8—dc22 Cover design by Janine Marie¨n Typeset by Newgen Imaging Systems (P) Ltd., Chennai, India Printed in Great Britain on acid-free paper by Ashford Colour Press, Hampshire ISBN 0–19–856670–0 978–0–19–856670–1 ISBN 0–19–856671–9 (Pbk.) 978–0–19–856671–7 (Pbk.) 10 9 8 7 6 5 4 3 2 1
Preface
This book is an introduction to the exciting new field of ecological genomics, for use in MSc courses and by those beginning their PhD studies. When we became involved in a national research programme on ecological genomics, or ecogenomics as it became known, we realized that information on this newly emerging subject needed to be brought together. In order to start up a research programme in such a new discipline, not only the students, but also we as teachers, had to get to grips with the subject. Furthermore, although obtaining a PhD implies mastering a specialized field, the PhD student must be able to place this field in a broader context if he or she is to become a mature scientist. This approach may be called the T-model of education; the horizontal bar of the T representing a broad understanding, and the vertical bar an investigation in depth, going down to the root of the problem. Our book uses this approach. We assume a basic level of knowledge in the biological sciences to BSc level: ecology, evolutionary biology, microbiology, plant physiology, animal physiology, genetics, and molecular biology. We have tried to link up with the content of the most common textbooks in these fields, at the same time realizing that students of ecological genomics have a variety of backgrounds. However, our main targets are students with subjects closely related to ecology and evolutionary biology, which is why we place the emphasis on aspects that we judge to be particularly new to them. Evolutionary genomics and bioinformatics are companion disciplines to ecological genomics. In the last 10 years interest in both disciplines has grown enormously. Several textbooks on bioinformatics have already been published and
subjects encompassed by evolutionary genomics, such as comparative genomics, phylogenetic analysis, and molecular evolution, can now be considered as fields in their own right. They are certainly too large to be covered in an introductory book on ecological genomics; indeed, evolutionary genomics deserves a textbook of its own. We have organized this book around three issues important in modern ecology, choosing questions for which the links to genomics are best developed. At the outset, we perhaps use rather ambitious phrasing to announce the genomics approach to these ecological questions. Maybe our questions cannot be answered at this stage. However, we decided not to suppress unanswered, and thus open, issues. Instead we hope to stimulate discussion as well as provide factual information. We have included an appraisal section at the end of each chapter to emphasize this questionorientated approach. Combined with information given in the introductory section, this allows the reader to grasp the main points of each chapter, even if the detailed treatment of molecular principles and case studies are left aside. Case studies are taken from literature published since the year 2000. Nevertheless, a book on genomics runs the risk of becoming outdated very quickly: the rate at which knowledge is being accrued and insight developed is unprecedented. However, we hope that our question-orientated set-up will be useful for some years to come, even when new and better case studies are available. Before this book was written, journal articles comprised the only literature on ecological genomics. These, although very inspiring, were scattered widely. Today, most textbooks on v
vi
PREFACE
genetics and evolution have a chapter on genomics. Gibson and Muse published a primer on genome science in 2002, but this did not cover ecological questions. So, for us, writing this book was ploughing unknown ground. We have attempted to add structure to the field, and hopefully have put ecological genomics on the map. However, we welcome constructive criticism and suggestions from our readers. We thank the colleagues who reviewed parts of the book, suggested issues that had escaped us, or helped with correcting the English: Martin Feder, Claire Hengeveld, Jan Kammenga, Rene´ Klein Lankhorst, Bas Kooijman, Jan Kooter, Wilfred
Ro¨ling, and Martijn Timmermans. We thank Desire´e Hoonhout and Karin Uyldert for checking the reference list, and Nico Schaefers, for preparation of the figures. Ian Sherman at Oxford University Press provided us with stimulating discussion. We thank members of the Animal Ecology Department at the Vrije Universiteit for your friendship and encouragement. N.M.vS. also thanks the Faculty of Earth and Life Sciences of the Vrije Universiteit for granting the sabbatical leave during which most of this book was written. Nico M. van Straalen and Dick Roelofs, Amsterdam, July 2005
Contents
1
What is ecological genomics? 1.1 The genomics revolution invading ecology . 1.2 Yeast, fly, worm, and weed . . . . . . . . . . . . 1.3 -Omics speak . . . . . . . . . . . . . . . . . . . . . . . 1.4 The structure of this book . . . . . . . . . . . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
1 . 1 . 4 11 15
Genome analysis 2.1 Gene discovery . . . . . . . . . . . . . . . . 2.2 Sequencing genomes . . . . . . . . . . . . 2.3 Transcription profiling . . . . . . . . . . . 2.4 Data analysis in ecological genomics
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
. . . .
17 17 26 36 43
3
Comparing genomes 3.1 Properties of genomes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3.2 Prokaryotic genomes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3.3 Eukaryotic genomes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
56 56 74 84
4
Structure and function in communities 4.1 The biodiversity and ecosystem functioning synthetic framework . . . . . . . 4.2 Measurement of microbial biodiversity . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.3 Microbial genomics of biogeochemical cycles . . . . . . . . . . . . . . . . . . . . . . . 4.4 Reconstruction of functions from environmental genomes . . . . . . . . . . . . . 4.5 Genomic approaches to biodiversity and ecosystem function: an appraisal
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
113 . 113 . 115 130 145 159
Life-history patterns 5.1 The core of life-history theory . . . . . . . . . . . . . . . . . . . . . 5.2 Longevity and aging . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.3 Gene-expression profiles in the life cycle . . . . . . . . . . . . . 5.4 Phenotypic plasticity of life-history traits . . . . . . . . . . . . . 5.5 Genomic approaches to life-history patterns: an appraisal
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
. . . . .
161 161 166 179 195 205
Stress responses 6.1 Stress and the ecological niche . . . . . . . . . . . . . . . . . . 6.2 The main defence mechanisms against cellular stress . 6.3 Heat, cold, drought, salt, and hypoxia . . . . . . . . . . . . 6.4 Herbivory and microbial infection . . . . . . . . . . . . . . . 6.5 Toxic substances . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.6 Genomic approaches to ecological stress: an appraisal
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
. . . . . .
208 208 . 211 230 239 247 255
2
5
6
. . . .
. . . .
. . . .
. . . .
. . . .
. . . . . .
. . . . . .
. . . . . .
vii
viii
7
CONTENTS
Integrative ecological genomics 257 7.1 The need for integration: systems biology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 257 7.2 Ecological control analysis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 263 7.3 Outlook . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 266
References
271
Index
299
CHAPTER 1
What is ecological genomics?
We define ecological genomics as a scientific discipline that studies the structure and functioning of a genome with the aim of understanding the relationship between the organism and its biotic and abiotic environments.
With this book we hope to contribute to this new discipline by summarizing the developments over the last 5 years and explaining the general principles of genomics technology and its application to ecology. Using examples drawn from the scattered literature, we indicate where ecological questions can be analysed, reformulated, or solved by means of genomics approaches. This first chapter introduces the main purpose of ecological genomics. We describe its characteristics, its interactions with other disciplines, and its fascination with model species. We also touch on some of its possible applications.
1.1 The genomics revolution invading ecology The twentieth century has been called the ‘century of the gene’ (Fox Keller 2000). It began with the rediscovery in 1900 of the laws of inheritance by DeVries, Correns, and Von Tschermak, laws that had been formulated about 40 years earlier by Gregor Mendel. With the appearance of the Royal Horticultural Society’s English translation of Mendel’s papers, William Bateson suggested in a letter in 1902 that this new area of biology be called genetics. The word gene followed, coined by Wilhelm Ludvig Johannsen in 1909, and then in 1920 the German botanist Hans Winkler proposed the word genome. The term genomics did not
appear until the mid-1980s and was introduced in 1987 as the name of a new journal (McKusick and Ruddle 1987). The century ended with the genomics revolution, culminating in the announcement of the completion of a draft version of the humane genome in the year 2000. Realizing the importance of Mendel’s papers, William Bateson announced that genetics was to become the most promising research area of the life sciences. One hundred years later one cannot avoid the conclusion that the progress in understanding the role of genes in living systems indeed has been astonishing. The genomics revolution has now expanded beyond genetics, its impact being felt in many other areas of the life sciences, including ecology. In the ecological arena, the interaction between genomics and ecology has led to a new field of research, evolutionary and ecological functional genomics. Feder and Mitchell-Olds (2003) indicated that this new multidiscipline ‘focuses on the genes that affect evolutionary fitness in natural environments and populations’. Our definition of ecological genomics given above seems at first sight to include the basic aim of ecology, viewing genomics as a new tool for analysing fundamental ecological questions. However, the merging of genomics with ecology includes more than the incorporation of a toolbox, because with the new technology new scientific questions emerge and existing questions can be answered in a way that was not considered before. We expect therefore that ecological genomics will develop into a truly new discipline, and will forge a mechanistic basis for ecology that is often felt to be missing. This could also strengthen the relationship between ecology and the other life 1
2
INTRODUCTION TO ECOLOGICAL GENOMICS
sciences, because to a certain extent ecological genomicists speak the same language and read the same papers as molecular biologists. Fig. 1.1 illustrates the various fields from which ecological genomics draws and upon which it is still growing. First of all, as indicated by Feder and Mitchell-Olds (2003), ecological genomics is closely linked to evolutionary biology and the associated disciplines of population genetics and evolutionary ecology. Another major area supporting ecological genomics is plant and animal physiology, which have their base in biochemistry and cell biology. A special position is held by microbial ecology, the meeting place of microbiology and ecology, where the use of genomics approaches has proceeded further than in any other subdiscipline of ecology. We consider genomics itself as a mainly technological advance, supporting ecological genomics in the same way as it supports other areas of the life sciences, such as medicine, neurobiology, and agriculture. The genomics revolution is not only due to advances in molecular biology. Three major technological developments that took place in the 1990s also made it possible: microtechnology, computing, and communication. Microtechnogy. The possibility of working with molecules on the scale of a few micrometres, given
by advances in laser technology, has been very important for one of genomics’ most conspicuous achievements, the development of the gene chip. Computing technology. To assemble a genome from a series of sequences requires tremendous computational power. Extensive calculations are also necessary for the analysis of expression matrices and protein databases. Without the advent of high-speed computers and datastorage systems of vast capacity all this would have been impossible. Communication technology. Consulting genome databases all over the world has become such normal practice that the scientific progress of any genomics laboratory has become completely dependent on communication with the rest of the World Wide Web. The Internet has become an indispensable part of genomics. The essence of genomics is that it is the study of the genome and its products as a unitary whole. In biology, the suffix -ome signifies the collectivity of units (Lederberg and McCray 2001), as for example in coelome, the system of body cavities, and biome, the entire community of plants and animals in a climatic region. In aiming to investigate many genes at the same time genomics differs from ecology, which although investigating many phenotypes, usually deals with only a few genes at a time (Fig. 1.2). Ecological genomics borrows from these two extremes, investigating phenotypic
Evolution
No. of genes
Evolutionary ecology
Microbiology
Microbial ecology
Ecological genomics
Population genetics
No. of phenotypes
Genetics
Physiological ecology
Plant and animal physiology
Figure 1.1 The position of ecological genomics in the middle of the other life-science disciplines with which it interacts most intensively.
Genomics
Ecology
Figure 1.2 The playing field of ecological genomics, in between genomics, with its focus on the single genome of a model organism, studying all the genes that it contains, and ecology, studying a few genes in many species.
WHAT IS ECOLOGICAL GENOMICS?
biodiversity as well as diversity in the genome. With this new discipline, ecology is enriched by genomics technology and genomics is enriched by ecological questioning and evolutionary views. Because genomics analyses the genome in its entirety, it transcends classical genetics, which studies genes one by one, relating DNA sequences to proteins and ultimately to heritable traits. Genomics is based on the observation that the impact of one gene on the phenotype can only be understood in the context of the expression of several other genes or, in fact, of all other genes in the genome, plus their products, metabolites, cell structures, and all the interactions between them. This is not to say that every study in genomics deals with everything all the time, but that the mind is set and tools are deployed to maximize awareness of any effects elsewhere in the genome, outside the system under study. Consequently genomics is invariably associated with unexpected findings. The discovery aspect of genomics is expressed aptly in a public-education project of Genome Canada entitled The GEEE! in Genome (www.genomecanada.ca). The work of Spellman and Rubin (2002) and their discovery of transcriptional territories in the genome of the fruit fly, Drosophila melanogaster, is an example of how the genomics approach can fundamentally alter our way of thinking about the relationship between genes and the environment (see also Weitzman 2002). The authors carried out transcription profiling with DNA microarrays (see Section 2.3) to investigate the expression of almost all of the genes in the fruit fly’s genome under 88 different environmental conditions. Their work was in fact a meta-analysis of transcription profiles collected earlier in six separate investigations. Because the complete genome sequence of Drosophila is known, it was possible to trace every differentially expressed gene back to its chromosomal position. They concluded that genes physically adjacent in the genome often had similar expression when comparing different environmental challenges. The window of correlated expression appeared to extend to 10 or more adjacent genes and they estimated that 20% of the genome was organized in such ‘expression
3
clusters’. Most astonishingly, genes in one cluster proved to be no more similar in structure or function than could be expected from a random arrangement. Spellman and Rubin (2002) suggested that local changes in chromatin structure trigger the expression of large groups of genes together. Thus a gene may be expressed not because there is a particular need for its product, but because its neighbour is expressed for a reason completely unrelated to the function of the first gene. At the moment it is not known whether such mechanisms lead to unexpected correlations between phenotypic traits, but surely the discovery of transcriptional territories could never have been made on a gene-by-gene basis, and this is due to the genomics approach. The interactions between the genes within the genome and the dynamic character of the genome on an evolutionary scale have been sketched vividly by Dover (1999) as an internal tangled bank. This idea goes back to Darwin (1859) who, after investigating the banks of hollow roads in the English countryside, was intrigued by the great variety of organisms tangled together: It is interesting to contemplate an entangled bank, clothed with many plants of many kinds, with birds singing on the bushes, with various insects flitting about, and with worms crawling through the damp earth . . .
Darwin considered the way in which all organisms depended on each other as the template for evolution. Inspired by Darwin, Dover (1999) made a distinction between the ‘external tangled bank’ (the ecology) and the ‘internal tangled bank’ (the genome), attributing to them complementary roles in the evolutionary process (Fig. 1.3). The concept of the internal tangled bank emphasizes the role of genetic turbulence (gene duplication, genetic sweeps, exon shuffling, transposition, etc.) in the genome and it illustrates that there is ample scope for ‘innovation from within’. These innovations are then checked against the external tangled bank, and this constitutes the process of evolution. This agrees with Franc¸ois Jacob’s famous description of ‘evolution through tinkering’ (Jacob 1977). It should not surprise us that genetic turbulence leaves many traces in the genome that do not have
4
INTRODUCTION TO ECOLOGICAL GENOMICS
External tangled bank Natural selection Genetic drift
Internal tangled bank Genetic turbulence Molecular reorganization
Adaptation, molecular co-evolution
Biological novelties, new species Figure 1.3 Evolution viewed as an interplay between the two ‘tanged banks’ of genetic turbulence and natural selection. Modified after Dover (1999), by permission of Oxford University Press.
direct negative phenotypic consequences; these traces from the past provide a valuable historical record for genome investigators to discover.
1.2
Yeast, fly, worm, and weed
A striking feature of genomics is its focus on a limited number of model species with fully sequenced genomes and large research networks organized around them. The genomes of these model species have been sequenced completely and the information is shared on the Internet, allowing scientists to take maximal advantage of progress made by others. This explains the extreme speed with which the field is developing. Ecology does not have a strong tradition in standardized experimentation with one species. Thus the genomics approach is all the more striking to an ecologist, who is often more fascinated by the diversity of life than by a single organism, and engaged in a very wide variety of topics, systems, and approaches. In this section we examine the arguments for introducing model species in ecological genomics.
The best-known completely sequenced genomes, in addition to those of mouse and human, are those of the yeast Saccharomyces cerevisiae, the ‘fly’ Drosophila melanogaster, the ‘worm’ Caenorhabditis elegans and the ‘weed’ Arabidopsis thaliana. Investigations into the genomes of these model organisms are supported by extensive databases on the Internet that provide a wealth of information about genome maps, genomic sequences, annotated genes, allelic variants, cDNAs, and expressed sequence tags (ESTs), as well as news, upcoming events, and publications. These four model genomes and their relationships with evolutionary related species will be discussed in more detail in Chapter 3. The genomics of the mouse and human are not discussed at length in this book because the model status of these two species has mainly a medical relevance. The first genome to be sequenced completely was that of Haemophilus influenzae (Fleischmann et al. 1995). This bacterium is associated with influenza outbreaks, but is not the cause of the disease, which is a virus. Although several years earlier the ‘genome’ of bacteriophage FX174 had
WHAT IS ECOLOGICAL GENOMICS?
been sequenced (Sanger 1977a), 1995 is considered by many as the true beginning of genomics as a science, not in the least because the H. influenzae project demonstrated the usefulness of a new strategy of sequencing and assembly (wholegenome shotgun sequencing; see Chapter 2). With 1.8 Mbp the genome of H. influenzae was about 10 times larger than that of any virus sequenced before, but still two to four orders of magnitude smaller than the genome of most eukaryotes. Genome sequences of many other prokaryotes soon followed, including that of Methanococcus jannaschii an archaeon living at a depth of 2600 m near a hydrothermal vent on the floor of the Pacific Ocean (Bult et al. 1996). The genome of this extremophile was interesting because of the many genes that were completely unknown before. In 1989, a large network of scientists embarked on a project for sequencing the yeast genome, which was
5
completed in 1996 and was the first eukaryotic genome to be elucidated (Goffeau et al. 1996). Thus, by 1996, the first genomic comparisons were possible between the three domains of life: Bacteria, Archaea, and Eucarya. The international Human Genome Project initiated by the US National Institutes of Health and the US Department of Energy, was launched in 1990 with completion due in 2005. However, in the meantime a private enterprise, Celera Genomics, embarked on a project with the same aim but a different approach and actually overtook the Human Genome Project. The competition was settled with the historic press conference on 26 June 2000, when US President Bill Clinton, J. Craig Venter of Celera Genomics, and Francis Collins of the National Institutes of Health jointly announced that a working draft of the human genome had been completed (Fig. 1.4). Many commentators have
Figure 1.4 From left to right: J. Craig Venter (Celera Genomics), President Clinton, and Francis Collins (National Institutes of Health) on the historic announcement of 26 June 2000 of the completion of a working draft of the human genome. Ó Win McNamee/Reuters.
6
INTRODUCTION TO ECOLOGICAL GENOMICS
Table 1.1 List of complete and published genomes (not including viruses) by June 2005 Taxonomic group
No. of genomes
Remarks on species
Bacteria total Archaea total Eukarya* Myxomycota Entamoeba Apicomplexa Kinetoplastida Cryptomonadina Bacillariophyta Rhodophyta Plants
211 21
Many common laboratory models and pathogens Several methanogens and extremophiles
Fungi Animals Nematoda Insecta
14
Tunicata Pisces
1 3
Aves Mammalia
1 5
Animals: total Eukarya: total Total
16 47 279
1 1 6 2 1 1 1 4
2 4
Dictyostelium discoideum (slime mould) Entamoeba histolytica (amoeba causing dysentery) Four Plasmodium and two Microsporidium species Trypanosoma brucei, Leishmania tropica (parasites) Guillardia theta (flagellated unicellular alga) Thalassiosira pseudonana (marine diatom) Cyanidioschyzon merolae (small unicellular red alga) Chlamydomonas reinhardtii (green alga), Populus trichocarpa (black cottonwood), Arabidopsis thaliana (thale cress), Oryza sativa var. japponica, var. indica (rice) Including Saccharomyces cerevisiae (baker’s yeast) Caenorhabditis elegans (free-living roundworm), Caenorhabditis briggsae Bombyx mori (silk worm), Drosophila melanogaster (fruit fly), Anopheles gambiae (mosquito, malaria vector), Apis mellifera (honey bee) Ciona intestinalis (sea squirt) Takifugu rubripes (puffer or fugu fish), Tetraodon nigroviridis (puffer fish), Danio rerio (zebrafish) Gallus gallus (red jungle fowl) Rattus norvegicus (brown rat), Mus musculus (house mouse), Canis familiaris (domestic dog), Pan troglodytes (chimpanzee), Homo sapiens (human)
Sources: from www.genomesonline.org, genomenewsnetwork.org, GenBank Nucleotide Sequence Database, and sundry sources.
qualified this announcement as more a matter of public communication than scientific achievement. At that time the accepted criterion for completion of a genome sequence, namely that only a few gaps or gaps of known size remained to be sequenced and that the error rate was below 1 in 10 000 bp, had not been met by far. The euchromatin part of the genome was not completed until mid-2004, although that milestone was again considered by some to be only the end of the beginning (Stein 2004). Nevertheless, the Human Genome Project can be regarded as one of the most successful scientific endeavours in history and the assembly of the 3.12 billion bp of DNA, requiring some 500 million trillion sequence comparisons,
was the most extensive computation that had ever been undertaken in biology. The number of organisms whose genome has been sequenced completely and published is now approaching 300 (Table 1.1). Bacteria dominate the list, as the small size of their genomes makes these organisms well-suited for whole-genome sequencing. By June 2005, no fewer than 730 prokaryotic organisms and 496 eukaryotes were the subject of ongoing genome sequencing projects. The list in Table 1.1 will certainly be out of date by the time this book goes to press, as new genome projects are being launched or completed every month. The list of species with completed genome sequences does not represent a random choice from
WHAT IS ECOLOGICAL GENOMICS?
the Earth’s biodiversity. From an ecologist’s point of view, the absence of reptiles, amphibians, molluscs, and annelids is striking, as also is the scarcity of birds and arthropods other than the insects. How did a species come to be a model in genomics? We review the various arguments below, asking whether they would also apply when selecting model species for ecological studies. Previously established reputation. This holds for yeast, C. elegans, Drosophila, mouse, and rat. These species had already proven their usefulness as models before the genomics revolution and were adopted by genomicists because so much was known about their genetics and biochemistry, and, perhaps just as important, because a large research community was interested, could support the work, and use the results. Genome size. One of the first questions that is asked when a species is considered for whole-genome sequencing is, what is the size of its genome? At least in the beginning, a relatively small genome was a major advantage for a sequencing project. The genome size of living organisms ranges across nine orders of magnitude, from 103 bp (0.001 Mbp) in RNA viruses to nearly 1012 bp (1 000 000 Mbp) in some protists, ferns, and amphibians. The puffer fish, Takifugu rubripes, was indeed chosen because of its relatively small genome (one-eighth of the human genome). Possibility for genetic manipulation. The possibility of genetic manipulation was an important reason why Arabidopsis, Drosophila, and mouse became such popular genomic models. The ultimate answer about the function of a gene comes from studies in which the genome segment is knocked out, downregulated, or overexpressed against a genetic background that is the same as that of the wild type. Also, the introduction of constructs in the genome that can report activity of certain genes by means of signal molecules is very important. This can only be done if the species is accessible using recombinant-DNA techniques. Foreign DNA can be introduced using transposons; for example, modified P-elements that can ‘jump’ into the DNA of Drosophila, or bacteria such as Agrobacterium
7
tumefaciens that can transfer a piece of DNA to a host plant. DNA can also be introduced by physical means, especially in cell cultures, using electroporation, microinjection, or bombardment with gold particles. Another popular approach is post-transcriptional gene silencing using RNA interference (RNAi), also called inhibitory RNA expression. The question can be asked, should the possibility for genetic manipulation be an argument for selecting model species in ecological genomics? We think that it should, knowing that the capacity to generate mutants and transgenes of ecologically relevant species is crucial for confirming the function of genes. Ecologists should also use the natural variation in ecologically relevant traits to guide their explorations of the genome (Koornneef 2004, Tonsor et al. 2005). A basic resource for genome investigation can be obtained by using natural varieties of the study species, and developing genetically defined culture stocks. Medical or agricultural significance. Many bacteria and parasitic protists were chosen because of their pathogenicity to humans (see the many parasites in Table 1.1). Other bacteria and fungi were taken as genomic models because of their potential to cause plant diseases (phytopathogenicity). Obviously, the sequencing of rice was motivated by the huge importance of this species as a staple food for the world population (Adam 2000). Some agriculturally important species have great relevance for ecological questions; for example, the bacterium Sinorhizobium meliloti, a symbiont of leguminous plants, is known for its nitrogen-fixing capacities, but it also makes an excellent model system for the analysis of ecological interactions in nutrient cycling, together with its host Medicago truncatula. Biotechnological significance. Many bacteria and fungi are important as producers of valuable products, for example antibiotics, medicines, vitamins, soy sauce, cheese, yoghurt, and other foods made from milk. There is considerable interest in analysing the genomes of these microorganisms because such knowledge is expected to benefit production processes
8
INTRODUCTION TO ECOLOGICAL GENOMICS
(Pu¨hler and Selbitschka 2003). Other bacteria are valuable genomic models because of their capacity to degrade environmental pollutants; for example, the marine bacterium Alcanivorax borkumensis is a genomic model because it produces surfactants and is associated with the biodegradation of hydrocarbons in oil spills (Ro¨ling et al. 2004). Evolutionary position. Whole-genome analysis of organisms at crucial or disputed positions in the tree of life can be expected to contribute significantly to our knowledge of evolution. The sea squirt, Ci. intestinalis, was chosen as a model because it belongs to a group, the Urochordata, with properties similar to the ancestors of vertebrates. The study of this species should provide valuable information about the early evolution of the phylum to which we belong ourselves. Me. jannaschii was chosen for more or less the same reason, because it was the first sequenced representative from the domain of the Archaea. Many other organisms, although not on the list for a genome project to date, have a strong case for being declared as model species for evolutionary arguments. These include the velvet worm, Peripatus, traditionally seen as a missing link between the arthropods and annelids, but now classified as a separate phylum in the Panarthropoda lineage (Nielsen 1995), and the springtail, Folsomia candida, formerly regarded as a primitive insect, but now suggested to have developed the hexapod bodyplan before the insects separated from the crustaceans (Nardi et al. 2003). Comparative purposes. Over the last few years, genomicists have realized that assigning functions to genes and recognizing promoter sequences in a model genome can greatly benefit from comparison with a set of carefully chosen reference organisms at defined phylogenetic distances. Comparative genomics is developing an increasing array of bioinformatics techniques, such as synteny analysis, phylogenetic footprinting, and phylogenetic shadowing (see Chapter 3), by which it is possible to understand aspects of a model genome from other genomes. One of the main reasons for sequencing the chimpanzee’s
genome was to illuminate the human genome, and a variety of fungi were sequenced to illuminate the genome of S. cerevisae. Ecological significance. It will be clear that ecological arguments have only played a minor role in the selection of species for whole-genome sequencing, but we expect them to become more important in the future. Jackson et al. (2002) have formulated arguments for the selection of ecological model species, and we present them in slightly adapted form. Biodiversity. The new range of models should embrace diverse phylogenetic lineages, varying in their physiology and life-history strategy. For example, the model plants Arabidopsis and rice both employ the C3 photosynthetic pathway. To complement our genomic knowledge of primary production, new models should be chosen among plants utilizing C4 photosynthesis or crassulacean acid metabolism (CAM). Considering the diversity of life histories, species differing in their mode of reproduction and dispersal capacity should be chosen; for example, hermaphoditism versus gonochorism, parthenogenesis versus bisexual reproduction, etc. Ecological interactions. Species that take part in critical ecological interactions (mutualisms, antagonisms) are obvious candidates for genomic analysis. One may think of mycorrhizae, nitrogen-fixing symbionts, pollinators, natural enemies of pests, parasites, etc. The most obvious strategy for analysing such interactions would be to sequence the genomes of the players involved and to try and understand interactions between them from mutualisms or antagonisms in gene expression. Suitability for field studies. The wealth of knowledge from experienced field ecologists should play a role in deciding about new ‘ecogenomic’ models. Not all species lend themselves to studies of behaviour, foraging strategy, habitat choice, population size, age structure, dispersal, or migration in the field, simply because they are too rare, not easily spotted, difficult to sample quantitatively, impossible to mark and recapture, not easy to distinguish from related
WHAT IS ECOLOGICAL GENOMICS?
species, or inaccessible to invasive techniques. Thus suitability for field research is another important criterion. Feder and Mitchell-Olds (2003) developed a similar series of criteria for an ideal model species in evolutionary and ecological functional genomics (Fig. 1.5). These authors point out that there is currently a discrepancy between classical model species and many ecologically interesting species. Models such as Drosophila and Arabidopsis are not very suitable for ecological studies, whereas many popular ecological models have a poorly characterized genome and lack a large community of investigators. In some cases a large ecological community is available, but functional genomic studies are difficult for reasons of quite another nature. For example, many ecologists favour
wild birds as a study object, but there are ethical objections to genetic manipulation of such species and laboratory experiments are restricted by law. It is not easy to foresee how the list of genomic model species will develop in the future. Obviously, ecologists taking ecological genomics seriously will need to avail themselves of genomic information on their model species, preferrably a whole-genome sequence. This is not to say however, that all questions in ecological genomics require the full-length DNA sequence of a species before they can be answered. Some issues may prove to be solvable with the use of less extensive genomic investigations, for example a gene hunt followed by multiplex quantitative PCR, rather than transcription profiling with microarrays of
Infrastructure • Large, active, and interactive community of investigators • Physical and virtual community resources • Interaction with other basic and applied communities
Gene discovery and phylogenetic data • Forward and reverse genetic tools • Capacity to detect variation, including differences in transcript and protein levels • Known phylogeny to enable, for example, historical change in traits of interest to be inferred
Molecular data • Access to genomic sequence and chromosomal maps • Upstream regulators and downstream targets identified for the gene of interest • Function of gene product known and its impact on fitness under natural conditions inferred
9
Ideal model species
Ecological context • Relatively undisturbed habitats in the native range of the species • Observable ecology and behaviour in nature • Genetic differentiation causing local adaption to a range of abiotic or biotic environments • Legally protected field sites for long-term ecological studies
Variation in sequence and phenotype • Nucleotide variants in natural populations • Abiotic and biotic environmental factors correlated with each segregating haplotype • Evolutionary forces underlying nucleotide variation inferred from molecular evolution analyses • Characterized phenotypes under natural conditions for each variant • Impact of variants on fitness, abundance, range, and persistence known • Structure and dynamics of the natural population known
Figure 1.5 Criteria in evolutionary and ecological functional genomics for a model species, according to Feder and Mitchell-Olds (2003). At present few species satisfy all criteria. Reproduced by permission of Nature Publishing Group.
10
INTRODUCTION TO ECOLOGICAL GENOMICS
the complete genome (see Section 2.3). In addition, microarray studies with part of the expressed genome are possible even in species lacking a complete DNA sequence. Microarrays can be manufactured at costs that are affordable for small research groups if they are limited to genes associated with a specific function or response pathway (Held et al. 2004; see also Section 6.4). Still, the number of species with fully characterized genomes is expected to rise dramatically in the coming years; after a while all the major ecological models will also be genomic models and the saturation point could very well be due to the limited number of molecular ecologists in the worldwide scientific community. Not all ecological models will enjoy the type of in-depth investigations now dedicated to yeast, fly, worm, and weed. Murray (2000) points out that the development of genome-based tools has a strong element of positive feedback; the rich—that is, widely studied organisms—get richer and the poor get poorer. This development has already been felt in the fields of animal and plant physiology, where many of the species traditionally investigated in comparative physiology and biochemistry have been abandoned in favour of models that can be genetically manipulated to study the function of genes. Murray (2000) predicted that ‘the larger its genome and the fewer its students, the more likely work on an organism is to die’. Crawford (2001) has argued, however, that functional genomics should resist this tendency and instead choose species best suited to addressing specific physiological or biochemical processes. For example, the Nobel Prize for Medicine was given to H.A. Krebs for his research on the citric acid cycle, which was conducted on common doves. By modern standards the dove is a nonmodel species, but it was chosen because its breast muscle is very rich in mitochondria. In animal physiology, Krogh’s principle assumes that for every physiological problem there is a species uniquely suited for its analysis (Gracey and Cossins 2003). According to this principle, genomic standard species are likely to be suboptimal for at least some problems of physiology, because no model is uniquely suited to answering all questions.
DNA microarrays, with their associated massive generation of data on expression profiles (see Section 2.3), are one of the most tangible features of modern genomics and are often seen as holding the greatest promise for solving problems in ecology. However, not all ecologists are convinced that microarray-based transcription profiling is the best way to advance the genomics revolution into ecology. Thomas and Klaper (2004), for example, argued that commercial microarrays are available only for genomic model species, whereas the interest of ecologists is with species that are important in the environment and amenable to ecological studies; these two interests do not necessarily coincide. This leaves ecologists with two options. One is to develop their own microarrays, starting with spotted cDNAs of unknown sequence, doing a lot of tedious sequencing work, and gradually finding out more about the genome of their study species. Another option is to apply transcriptome samples of non-models to microarrays of model species. In these cross-species hybridizations it is assumed that there is sufficient homology between the non-model and the model to allow differential expressions to be assessed reliably. For example, Arabidopsis may function as a model for other species of the Brassicaceae, and Drosophila as a model for other higher insects. Obviously, how useful such an approach is will depend on how far the sequences of model and non-model diverge. This will not be the same for all parts of the genome and therefore there is some doubt on the validity of cross-species hybridization, although there will certainly be situations where it works well. Other investigators are less hesitant about the prospects of microarrays in ecology. Gibson (2002) emphasized that today it is feasible to establish a 5000-clone microarray resource within 12 months of a commencing project and that neither the estimated expense nor the availability of technology need to be a major obstacle for progress. We share this optimism. Given the fact that the number of almost completely sequenced organisms is increasing month by month, we can expect that the genome of several species of great interest to ecologists may be completed within a few years.
WHAT IS ECOLOGICAL GENOMICS?
In addition, we expect that almost all ecologically relevant species will have basic genomics databases—for example, an annotated EST library—sufficient to answer a considerable number of ecological questions.
1.3
DNA
The genome
Genomics
Transcription RNA splicing RNA editing
-Omics speak
Because of the immediately attractive upswing created by the genomics revolution, and the large financial resources made available in many industrialized countries, adjacent fields of science have adopted similar terms, leading to a great proliferation of designations such as transcriptomics, proteomics, and metabolomics, such that some biologists have complained that what was molecular biology before is now named after one of the ‘-omics’ but in fact is still molecular biology. Zhou et al. (2004) proposed a classification of genomics according to three main categories: approach (structural or functional), scientific discipline (evolutionary genomics, ecological genomics, etc.), and object of study (plant genomics, microbial genomics, etc.). An Internet page maintained by Mary Chitty (Cambridge Healthtech Institute) provides a glossary containing no less than 60 single-word entries ending with -omics (www.genomicglossaries.com). The list includes obvious terms such as pharmacogenomics and cardiogenomics, and awkward ones such as saccharomics (the study of all the carbohydrates in the cell) and vaccinomics (the use of bioinformatics and genomics for vaccine development). The three most common extensions of genomics are transcriptomics, proteomics, and metabolomics, and these are introduced briefly here, with reference to Fig. 1.6. Transcriptomics is the study of all the transcripts that are present at any time in the cell. In principle the transcriptome includes messenger RNAs (mRNAs) in addition to ribosomal RNAs (rRNAs), transfer RNAs (tRNAs), and small nuclear RNAs (snRNAs), but transcriptomics is usually limited to mRNA, the template for translation into protein. The main activity in transcriptomics is to obtain a profile of global gene expression in relation to some condition of interest. Which genes are turned
11
The transcriptome
Transcriptomics rRNA mRNA tRNA Translation
The proteome
Enzymes Proteomics Structural proteins Transcription factors Ion channels Signalling proteins Receptors
Catalysis Synthesis Transport Transformation
The metabolome
Metabolomics Sugars Amino acids Lipids Secondary metabolites Hormones
Figure 1.6 The relationship between genomics, transcriptomics, proteomics, and metabolomics.
‘on’ and ‘off’ during certain phases of the cell cycle? Which genes are upregulated by certain physiological conditions? Which genes change their expression in response to adaptation to the environment? The study of transcriptomes is part of functional genomics, because it does not look at the DNA as such, but at its functions. In general, it is expected that there are more transcripts than there are protein-encoding genes in the genome, even when considering only those genes that are actually transcribed. This is due to the mechanism of alternative splicing: the generation of different mRNAs from the same
12
INTRODUCTION TO ECOLOGICAL GENOMICS
pre-mRNA during the removal of introns. RNA editing (post-transcriptional insertion or deletion of nucleotides, or conversion of one base for another) is another reason for incongruence between the genome and the transcriptome. There are more reasons why a functional analysis of the genome can provide a different picture than an inventory of genes. Obviously, all cells of an organism have the same genome, but not the same transcriptome. Even when looking at cells of the same type, the transcriptome depends on environmental conditions, physiological state, developmental state, etc. So the transcriptome allows a glimpse of the living cell much more than the genome itself. The argument also holds when making comparisons across species. Classical molecular phylogenetics (see Graur and Li 2000) is based on variation of homologous DNA sequences across species. However, the same structural DNA can be regulated in different ways in different species. We illustrate this argument with an example from Enard et al. (2002), who did one of the first studies in what may be called comparative transcriptomics. Enard et al. (2002) analysed the expression of 18 000 genes in liver, blood leucocytes, and brain tissue of humans, chimpanzee (Pan troglodytes), and rhesus monkey (Macaca mulatta). The expression patterns in human blood and liver turned out to be more similar to chimpanzees than to rhesus monkeys, which is in accordance with the phylogenetic distances between the three primate species; however, the expression profiles in the brain were more similar between chimpanzee and rhesus monkey than between either of the two monkey species and human (Fig. 1.7). So, although chimpanzees share 98.7% of their DNA with humans, the human species expresses that DNA in a different manner, especially in the brain. Gene expression in the brain has undergone accelerated evolution compared to gene expression elsewhere in the body, and evolution has resulted in a divergence of humans from chimpanzees, mostly due to regulatory change rather than structural reorganization of the DNA. Proteomics is the study of all the proteins in the cell. As with genomics, proteomics arose thanks to technological innovation, which in this case is
Brain Chimp Rhesus 5.5
Human Chimp
Blood
Rhesus
1.0 Human Chimp 1.3
Liver
Rhesus
Human
Figure 1.7 Distance trees showing the similarity of gene-expression profiles in brain, blood leucocytes, and liver of human, chimpanzee, and rhesus monkey. Numbers refer to the ratio between the rate of evolution in the human and the chimpanzee lineages, taking the rhesus monkey as an outgroup. Reprinted with permission from Enard et al. (2002). Copyright 2002 AAAS.
tandem mass spectrometry (MS/MS) and liquid chromatography coupled to tandem mass spectrometry (LC/MS/MS). The idea is to separate a mixture of soluble proteins by means of chromatography and then to estimate masses, first of the larger peptide and, after a second ionization, of fragments of the same peptide. The fragment patterns provide a fingerprint characteristic of the protein. Interpretation of proteomics data is
WHAT IS ECOLOGICAL GENOMICS?
usually supported by genomic sequence information, in such a way that an observed peptide fragment pattern may be compared to a database of proteins predicted from the genome. Mass spectrometry may also be used to determine the amino acid sequence of a protein. For this application, the protein is cleaved with a protease, for example trypsin, which generates a collection of fragments characteristic of the protein. These fragments may be compared to an in silico (computer-simulated) digestion derived from the genome and the known cleavage sites of the protease. The proteome provides a different picture of a cell’s activities to the transcriptome. Several authors have indeed wondered about the lack of correlation between mRNA and protein abundances. One of the reasons for this is the existence of control mechanisms at the ribosomes, where mRNA is translated to peptides. Translational control allows the cell to select only certain mRNAs for translation and block others. The selection is often dependent on environmental conditions, so this mechanism allows for physiological adaptation on the level of the proteome, even though the transcriptome remains the same. Another issue is post-translational modification or protein processing, processes that can greatly affect the function of a protein, for example by acetylation or ubiquitination of the N-terminal residue, hydroxylation of prolines, or cleavage of the molecule into smaller units. The proteome and the genome are linked by many feedback mechanisms, because some proteins are transcription factors necessary for gene activation, others are enzymes involved in transcription or translation, and still others are structural components of chromosomes. So, in a molecular biology context, the living cell can only be understood fully by considering genome, transcriptome, and proteome together. As an example of a study applying proteomics in an environmental context, consider the work of Shrader et al. (2003). These authors studied protein fingerprinting in embryos of zebrafish (Danio rerio) exposed to environmental endocrine disrupters. The compound p-nonylphenol is a degradation product of certain detergents and is discharged into the aquatic environment through sewage
13
effluent. Because of its structural similarity to vertebrate steroid hormones, especially oestrogens, nonylphenol has been associated with feminization of male fish. Fig. 1.8 shows a two-dimensional gel of differential protein expression of fish exposed to nonylphenol. This so-called proteinexpression profile was composed by matching the treatment profile with the control profile and subtracting them from each other. The Venn diagram in Fig. 1.8b provides a pictorial illustration of the number of proteins that are shared between treatments. It is interesting to note that nonylphenol induced several proteins that were also induced by oestradiol (23 in total), but that a (a)
(b) Control
14
Oestradiol
31
27
66 23
9 32
Nonylphenol
Figure 1.8 (a) Features on images from zebrafish embryos induced by exposure to nonylphenol. Representation of a two-dimensional electrophoresis gel, on which proteins are separated by a combination of isoelectric point and molecular mass, showing only proteins that were differential between the control and nonylphenolexposed zebrafish. (b) Venn diagram representing the number of proteins shared by two or more treatments. The diagram shows that, from the total of 202 proteins, there were 32 seen only in the nonylphenol treatment and 23 seen in both the nonylphenol treatment and a treatment with the natural hormone oestradiol. After Shrader et al. (2003) with permission from Springer.
14
INTRODUCTION TO ECOLOGICAL GENOMICS
significant number of proteins (32) were specific to nonylphenol. The study suggests that the two compounds have overlapping but otherwise dissimilar modes of action and that it may be too simple to qualify nonylphenol as only mimicking oestradiol. The functional genomics of endocrine disruption will be discussed in more detail in Chapter 6. Metabolomics is the study of all low-molecularweight cellular constituents. Usually only metabolites belonging to a limited category are included, for example all soluble carbohydrates, or all metabolites that can be measured by a certain analytical technique such as pyrolysis gas chromatography or infrared spectrometry. No single method can measure the thousands of different chemical compounds that may be present at any time in a cell, because of the greatly diverging chemical properties (hydrophilic versus hydrophobic compounds, acids versus bases, reactive versus inert compounds, etc.). The metabolome requires a diversity of analytical approaches to obtain a complete picture. There are still hardly any studies of proteomics and metabolomics that address a truly ecological question and that is why both of these -omics do not play a major role in this book. Their role could grow in the future, when ecology has absorbed the principles of genomics. In Chapter 7 we will address some aspects of metabolomics when discussing metabolic networks. Finally, Table 1.2 describes some other terms used in connection with genomics. With the further development of ecological genomics, applications will also come within
reach. One can envisage a multitude of issues where a better knowledge of genomes in the environment can support measures to improve ecosystem health, risk assessment of pollution, conservation of endangered species, etc. (Greer et al. 2001). Such applications fall outside the scope of this book; however, we mention two examples below, to sketch the range of possibilities. Purohit et al. (2003) suggested that multilocus DNA fingerprints prepared from environmental samples could act as an indicator DNA signature (IDS); for example, fingerprints of microbial soil communities could be indicative of soil pollution. Their suggestion can be extended to involve transcription profiles that are characteristic of certain environmental conditions or physiological states. Fig. 1.9 illustrates this principle. When an organism is exposed to polluted soil, this will be accompanied by gene expression that has both a general aspect due to the generality of the stress response and a specific aspect which characterizes the challenge (see also Chapter 6). When the expression profile observed for a suspect soil is compared with a database of reference profiles, the type of pollution and its biological effects may be indicated (Fig. 1.9). This may help to support decisions about the urgency of remediation measures. As a second example of a possible application consider the case of soil-borne pathogens. Many pathogens attacking economically important crops are difficult to control by conventional strategies such as the use of host resistance and synthetic pesticides. However, some soils have an inherent capacity to suppress diseases and such soils need lower rates of pesticide application to combat
Table 1.2 List of some of the more common -omics designations in addition to those discussed in the text Term
Object of study
Pathogenomics Pharmacogenomics
Genomes of human pathogens: analysis of genes involved in disease generation Genomic responses to drugs, analysis of expression profiles that indicate similarity of action across compounds, analysis of genetic polymorphisms that determine a person’s disposition to drug action Mode of action of toxic compounds, development of expression profiles that indicate similarity of toxic action across compounds Genomic responses of organisms exposed to environmental pollution All mineral nutrients and trace elements in an organism, for example using inductively coupled plasma mass spectrometry (ICP-MS)
Toxicogenomics Ecotoxicogenomics Ionomics
WHAT IS ECOLOGICAL GENOMICS?
Gene-expression profile of test organism exposed to suspect soil
Cd
CPF
PAH
Oil
N
Acid
Comparison with databank of reference expression profiles
15
Diagnosis, identification of type of pollution, risk assessment, advice on measures
Figure 1.9 Risk assessment of soil pollution can be supported by matching the gene-expression profile of an indicator organism, generated after exposure to a suspect soil, with profiles established as a reference and known to be associated with certain types of pollution. Examples are given of soils polluted by specific substances: CPF, chlorpyrifos; PAH, polycyclic aromatic hydrocarbons.
them. Disease-suppressive capacity is due to the presence of genes involved with antibiotic production by antagonistic microorganisms (Van Elsas et al. 2002; Weller et al. 2002; Garbeva et al. 2004). In several cases, specific microbial populations have been identified that contribute to disease suppressiveness; however, for most soils, we have little understanding of the consortium of microorganisms and the corresponding genes that are responsible for this critical function. Natural disease-suppressive soils can be regarded as a largely untapped resource for the discovery of new antagonistic microorganisms and antibiotics. We will see several examples of this in Chapter 4. Management strategies can be developed that involve selective stimulation and support of populations of antagonistic microorganisms in the rhizosphere. Genomic methods of soil diagnosis could be used as feedback on agricultural management decisions.
1.4 The structure of this book We have organized this book to address fundamental questions in three areas of ecology where we believe ecological genomics can make important contributions. Having given a broad introduction to genomics, and ecological genomics in particular, in this chapter, two more specific introductory chapters follow. Chapter 2 explains the most important genomic methodologies, and Chapter 3 gives a survey of what can be learnt from comparing the genomes of model organisms with each other and with those of evolutionarily related species. We also discuss the various properties of both prokaryotic and eukaryotic genomes. Chapters 2 and 3 form the methodological and evolutionary basis for the rest of the book. In the next three chapters, questions relate to different levels of integration, from community ecology down to population ecology, ending with
16
INTRODUCTION TO ECOLOGICAL GENOMICS
physiological ecology. Each of these chapters ends with an appraisal of how the genomics achievements contribute to answering the basic question of the chapter. Community structure and function. In Chapter 4 the genomics approach is used to discuss a question fundamental to community ecology, of how biodiversity supports ecosystem function. Most of the examples in this chapter are taken from microbial ecology. We review the ways in which microbiologists use genomics to estimate species diversity in the environment and how functions of uncultured species can be reconstructed from environmental genomes. Life-history patterns. Chapter 5 discusses the genomic aspects of life-history evolution, an important theme in population ecology. Questions of longevity, reproductive effort, sex, and diapause are discussed, as well as the issue of trade-offs between life-history traits. We show that progress in mechanistic studies of plasticity and optimal timing of reproduction has considerable relevance to ecology.
Stress responses. The many genomic studies of mechanisms that allow plants and animals to survive in harsh environments form the subject of Chapter 6. The way in which plants and animals transduce stress signals into gene expression shows many commonalities across species, as well as stress-specific signatures. We argue that insights in these mechanisms is needed to define the ecological niche of the species. Integrative ecological genomics. We conclude the book with a short chapter on integrative approaches, discussing some aspects of network analysis and ecological control analysis. These two approaches belong to the realm of systems biology, a new field of research, linking genomics, proteomics, and metabolomics with biochemical modelling. Chapter 7 suggests that integrative approaches are also required in ecological genomics and it discusses some examples to support this claim. Finally, a number of emerging issues are discussed in the outlook section of Chapter 7.
CHAPTER 2
Genome analysis
In this chapter we aim to acquaint the reader with the various molecular techniques that are used in genomics, with an emphasis on those that are of relevance for ecology. We also discuss the nature of the data generated by these techniques and the most common approaches to data analysis.
2.1
Gene discovery
In a fully sequenced genome, genes are found by scanning the sequence using gene-predicting computer programmes and assigning putative functions by searching for similarities in already existing databases (see Section 2.2). For many organisms under investigation in ecological genomics, no genomic database is available and genes must be identified in other ways. This section deals with some of the so-called pre-genomic molecular approaches that may be used to identify ecologically important genes in incompletely characterized genomes.
2.1.1
From gene product to gene
In some cases the primary structure of a gene product (a protein) may be the starting point of gene discovery. This holds especially for proteins that can be isolated relatively easily by some marker or bioassay, or proteins that are highly induced by some experimental treatment. As an example we discuss the isolation of the metallothionein (Mt) gene in a species of springtail, Orchesella cincta (Hensbergen et al. 1999). Attempts to pick up the gene by polymerase chain reaction (PCR) using primers from the then-known Drosophila Mt sequence were unsuccessful, which was
explained later by the lack of sufficient homology. Therefore the protein itself was isolated first, using a combination of gel-permeation chromatography and reversed-phase high-performance liquid chromatography (RP-HPLC). Protein isolation was aided greatly by the fact that metallothionein is highly inducible by exposure to cadmium and binds strongly to cadmium at neutral pH. By measuring cadmium concentrations in eluates from a chromatography, the fate of the protein could be monitored. Finally, a purified sample was obtained and a partial amino acid sequence was determined by N-terminal Edman degradation. This is a classical technique from biochemistry in which the N-terminal residue of a peptide is labelled and subsequently cleaved off without disturbing the peptide bonds between the other amino acids. The liberated amino acid is then eluted over an HPLC column, detected using the label and identified from the retention time; the cycle is repeated with the next N-terminal residue until the sequence of the peptide is known. Using a partial amino acid sequence of the purified metallothionein, Hensbergen et al. (1999) were then able to develop degenerate primers for amplifying the gene by means of the PCR. A degenerate primer is a mixture of DNA sequences all encoding the same amino acid sequence, but allowing for the fact that most amino acids are represented by more than one triplet. These primers were applied to a pool of complementary or copy DNA (cDNA), which is DNA prepared from mRNAs by reverse transcription. The reversetranscription reaction uses the activity of reverse transcriptase (RNA-dependent DNA polymerase), an enzyme originally isolated from RNA viruses, 17
18
INTRODUCTION TO ECOLOGICAL GENOMICS
which can make a complementary strand of DNA using single-stranded mRNA as a template. Reverse transcription is primed by a short oligo(dT) primer, a sequence of 2 0 -deoxythymine (dT), which anneals to the polyadenosine (poly(A)) tail present at the 3 0 -end of most eukaryotic mRNAs (Fig. 2.1). To characterize the complete cDNA Hensbergen et al. (1999) used a technique known as rapid amplification of cDNA ends (3 0 - and 5 0 -RACE). A 3 0 -RACE uses a 3 0 primer complementary to the poly(A) tail of the cDNA, in combination with a forward gene-specific primer somewhere in the middle of the cDNA (in this case degenerate) to amplify the 3 0 -end of the cDNA; a 5 0 -RACE uses a primer complementary to an ‘anchor’ oligonucleotide RNA which is ligated enzymatically to the 5 0 -end of the mRNA, in combination with a reverse gene-specific primer. Thus Hensbergen et al. (1999) were able to characterize a full-length cDNA starting with
Cap
Start codon
5⬘-UTR
Exon 1
a purified protein. Finally, using the cDNA sequence, Sterenborg and Roelofs (2003) determined the genomic sequence of the O. cincta metallothionein, and demonstrated the presence of one intron in the gene. An outline of the complete procedure is given in Fig. 2.2. Working backwards from protein structure to gene characterization is very laborious and may only be applicable in cases where ecological functions can be associated a priori with a suspected protein (as in the case of metallothionein conferring metal tolerance). The laborious Edman degradation technique has now been replaced mostly by sequencing using mass spectrometry, in which masses are estimated for peptides generated from proteolytic digests of the protein, while the fragment pattern obtained is compared with entries in a database that include sizes predicted from the genomic sequence. The example nevertheless illustrates that it is possible, in principle, to
Stop codon
Exon 2
Polyadenylation signal
3⬘-UTR
Poly(A) tail AAAAAAAAAA
Reverse transcription 5⬘ 3⬘
mRNA
AAAAAAAAAA 3⬘ TTTTTTTTTTT 5⬘
cDNA Denaturation in the first PCR cycle 3⬘ 5⬘ Anchor
TTTTTTTTTTT 5⬘ Forward GSP
Reverse GSP
3⬘ RACE
Amplification
Figure 2.1 The procedure for characterizing a full-length cDNA from partial knowledge of a protein sequence. Top: general structure of a eukaryotic mRNA with two exons, after splicing, capping and polyadenylation. Middle: mRNA–cDNA hybrid synthesized by reverse transcription. Bottom: single-stranded cDNA acting as a template for PCR amplification. Positions are indicated for primers used to amplify cDNA ends in 3 0 - and 5 0 -RACE. GSP, gene-specific primer (degenerate), developed from partial knowledge of the amino acid sequence of the protein; UTR, untranslated region.
GENOME ANALYSIS
Crude protein homogenate
Protein purification, HPLC
Mass estimation, MALDI-MS
Amino acid sequence
Gene sequence
3⬘-and 5⬘RACE, full-length cDNA
Partial cDNA
Degenerate PCR primers
19
Figure 2.2 Outline of a gene-discovery procedure in a non-model organism, commencing with protein purification and leading to gene characterization. MALDI-MS, matrix-assisted laser desorption ionization mass spectrometry.
work backwards from protein structure to gene characterization, and in some ecological applications this may be the only way to begin genomic explorations.
2.1.2
Differential screening
Liang and Pardee (1992) first proposed that genes whose expression differs between two populations of cells can be discovered by a PCR-based technique called differential display of mRNA. When animals or plants are subjected to a certain treatment, for example drought stress, their cells will have a higher or lower abundance of the mRNAs for those genes that respond to the treatment, compared with untreated controls. These differential genes can be detected and visualized by a PCR technique that amplifies complementary DNA sequences prepared by reverse transcription from the mRNA pool. The differential display PCR takes advantage of the poly(A) tail to anchor a poly(T) primer at the end of the cDNA. The other primer is a short oligonucleotide, 6 or 7 bp long, with an arbitrary sequence; this primer will anneal somewhere near the end of the cDNA strand, depending on the sequence. Because of the specific (but unknown) annealing site of the forward primer, amplified products from different cDNAs will differ in size and so can be resolved on a highresolution electrophoresis gel. The presence or absence of a band in one treatment compared to the other is evidence of a differentially expressed
Control
Drought stress
1 2 3 4 5 6 7 8 9 10
11
12 Figure 2.3 Schematic representation of an electrophosis gel displaying differential cDNAs under experimental treatment. The banding pattern indicates that genes 2 and 9 are upregulated and gene 6 is downregulated by drought stress.
gene (Fig. 2.3). Promising bands can be excised and processed for sequencing. The strength of differential display is illustrated by a study of Liao et al. (2002), who used the technique to find genes upregulated by exposure to the toxic metal cadmium in the nematode Caenorhabditis elegans. They identified 48 cadmiuminducible mRNAs in the nematode, one of which
20
INTRODUCTION TO ECOLOGICAL GENOMICS
was a novel protein, not found before in any other organism. The gene, Cdr-1 (of the cadmiumresponsive gene family), is upregulated specifically by cadmium and not, like many other cadmiuminduced genes, by general stress factors. The gene encodes a hydrophobic protein, most probably associated with the lysosomal membrane, that pumps Cd2 þ ions from the cytoplasm into lysosomal vesicles. A disadvantage of the differential display approach as described above is that most PCR products represent sequences from the 3 0 -untranslated region (3 0 -UTR) of the messenger. If the research is conducted with a model organism, as in the case of Liao et al. (2002), this presents no problem, because the UTRs located downstream of genes will easily be identified in the genomic database and so will the corresponding genes. For non-model organisms there is a problem, because the UTRs lack homology across species and so the sequence itself does not provide a clue to the function or identity of the gene. To recover the upstream part of the cDNA and characterize the gene one needs to apply 3 0 -RACE (see above). A technique that overcomes the problem of displaying too many 3 0 -UTRs is representational difference analysis (Pastorian et al. 2000). In this method a restriction is applied to the cDNAs before PCR amplification. Another differential screening strategy, which is often applied in combination with the generation of cDNA libraries and microarray transcription profiling (see below), goes under the name of suppression-subtractive hybridization (SSH). The idea is that by two subsequent hybridization templates are made for a PCR that is selective towards those cDNAs that differ in abundance between two samples (Diatchenko et al. 1996). The pool of mRNAs to which the procedure is applied should have a homogeneous genetic composition, to avoid false-positive results arising from allelic variation. Differentially expressed cDNAs are enriched by dividing one of the samples (the tester) into two subsamples, and labeling them with different adapters. The control sample (the driver) is then hybridized with each tester sample separately, and the samples are mixed in a second hybridization
with fresh driver, with the result that the mRNAs whose abundance differed between the two samples are over-represented in the population of double-stranded cDNAs with two different adapters (the subtraction effect). The PCR will amplify these cDNAs selectively, whereas the cDNAs with the same adapter will form so-called panhandle structures that are not amplified (the suppression effect). An overview of the procedure is given in Fig. 2.4. The technique is now completely protocolized and available commercially as a kit (Clontech 2002). The SSH technique enriches for differentially expressed genes, but the subtracted PCR-amplified sample will still contain cDNAs that correspond to mRNAs whose abundance did not differ between tester and driver samples. Therefore, further confirmatory steps are necessary. A recommended procedure is to conduct a differential screening in which dot-blot arrays of clones from the subtracted library are hybridized with labelled probes from either tester or driver populations. To complete the screening, the same procedure should be applied to labelled subtracted and reverse-subtracted probes, and this should confirm the result. As an example, consider the work of Rebrikov et al. (2002, 2004), who applied the dot-blot screening method as a means of confirming differential expressions between two closely related strains of the freshwater planarian, Girardia tigrina, which reproduce in different ways (Fig. 2.5). One strain of this flatworm is exclusively asexual, whereas the other reproduces both sexually and asexually. Rebrikov et al. (2002) were interested in gene-expression patterns specific to asexual reproduction. In the differential screening, clones that are recognized by the tester probe but not by the driver probe are confirmed to be differentially upregulated (Fig. 2.5, top left panel). In addition, the number of confirmed differentials should increase using the subtracted and reverse-subtracted probes, because they are normalized for lowabundance mRNAs, and their signal will not be detected by the tester and driver probes. Downregulation can be studied in the same way except that the spotted clones are the result of reverse subtraction (Fig 2.5, top right panel). The whole
GENOME ANALYSIS
Tester cDNA with adaptor 1
21
Driver cDNA (in excess) Tester cDNA with adaptor 2
First hybridization
a b c
d
{ Second hybridization: mix samples, add fresh denatured driver, and anneal a, b, c, d +
e Fill in the ends a b c
{ Add primers + Amplify by PCR
b⬘
b
a, d No amplification b⬘ No amplification c Linear amplification e Exponential amplification
Figure 2.4 Scheme of the suppression-subtractive hybridization (SSH) method for differential screening. Thick, solid lines represent tester or driver sequences, generated by digestion of cDNA with the restriction enzyme RsaI. The boxes represent adapter sequences, ligated to the cDNA digests. Letters a–e represent different configurations of DNA molecules. Type e molecules are formed only if the sequence is upregulated in the tester sample compared to the driver sample. Type b molecules are not amplified due to panhandle formation. After Diatchenko et al. (1996) by permission of the National Academy of Sciences of the United States of America.
procedure can also be done in an up-scaled manner using microarrays. Rebrikov et al. (2002) revealed a novel, extrachromosomal, virus-like element in the asexual flatworm strain.
A critical factor for the success of SSH screening lies with the expression ratio between two treatments. Ji et al. (2002) demonstrated that the enrichment effect of SSH is proportional to the
22
INTRODUCTION TO ECOLOGICAL GENOMICS
Forward subtraction (A–B) library differential screening Reverse-subtracted probe Subtracted probe 1 2 3 4 5 6 7 8 9 10 11 12 1 2 3 4 5 6 7 8 9 10 11 12 A A B B C C D D E E F F G G H H Reverse subtraction (B–A) library differential screening Reverse-subtracted probe Subtracted probe 1 2 3 4 5 6 7 8 9 10 11 12 1 2 3 4 5 6 7 8 9 10 11 12 A B C D E F G H
A B C D E F G H
Figure 2.5 Example of results from a differential screening approach applied to clones from a subtracted library (sexual versus asexual strains from the freshwater planarian G. tigrina). Clones arrayed on nylon membranes were selected randomly from the subtracted library (top panels) to study upregulation, and the reverse-subtracted library (bottom panels) to study downregulation. The dot-blots were then hybridized to labelled probes prepared from the subtracted (left-hand panels) and reverse-subtracted libraries (right-hand panels). After Rebrikov et al. (2004) by permission of Humana Press.
cube of the expression ratio. This non-linear effect implies that genes with highly differential expression (a high expression ratio) will be much more strongly enriched than genes with a lower expression ratio. For example, if genes with an expression ratio of 2 are enriched 10 times, genes with an expression ratio of 5 are enriched by a factor of 156. Theoretical and empirical arguments have demonstrated that only genes differing in expression by a factor of 5 or more will be effectively picked up in current SSH protocols. Application of SSH in an ecological context is growing rapidly, especially because it is a good preparatory method for generating enriched cDNA clone libraries for spotting microarrays (see below). To illustrate the use of SSH in ecology, a study by Pearson et al. (2001) is exemplary. These authors screened for genes differentially expressed in the brown macroalga, Fucus vesiculosus (of the
family Phaeophyceae), subjected to drought stress. Many genes were found to have differential expression that could not be identified by homology to known sequences, but those that could included partial sequences for ribulose-1,5bisphosphate carboxylase/oxygenase, chloroplastcoupling factor ATPase, and a photosystem I P700 chlorophyll a-binding protein. This study illustrates the great flexibility of genes encoding components of the photosynthetic apparatus, not only in response to light, but also to the hydration status of the tissues.
2.1.3
From marker to functional gene
Various DNA-fingerprinting methods, which are very popular in molecular ecology to elucidate population structure, geographic variation, or paternity (Beebee and Rowe 2004), can often form
GENOME ANALYSIS
the starting point of functional analysis. DNA fingerprinting in general can be done in two ways. One approach is to use identified, often noncoding, polymorphic sequences in the genome, such as microsatellites (loci with a variable number of short tandem repeats, e.g. (GA)n, where n varies from, let’s say, 5 to 9). Since these are single-locus codominant markers (the heterozygotes can be distinguished from either homozygote), they are especially suitable for population analysis (Jarne and Lagoda 1996, Sunnucks 2000). Another approach is multilocus DNA fingerprinting, where genotypes are recognized from many markers at the same time, often of unknown sequence. One such multilocus analysis, popular at the beginning of the 1990s when the molecular approach in ecology began its advance, goes under the name of randomly amplified polymorphic DNA (RAPD). Williams et al. (1990) introduced this technique, which is based on a PCR with 10- to 15-mer primers of arbitrary sequence. Due to variation between individuals in the position or sequence of primerannealing sites, each individual generates a different series of bands when PCR products are separated on an agarose gel. A large number of primers (sometimes several hundreds) is used to probe the genome, hence the designation ‘random’. When RAPD markers are found to be associated with certain environmental conditions, important ecological traits, or phenotypes of interest, they are cloned and sequenced, and new primers are developed based on the sequence, allowing a more robust PCR. The DNA segment is then designated with the awkward term sequence-characterized amplified region, SCAR, or the more general term sequence-tagged site, STS. The use of SCARs has become very popular in plant breeding and crop science, because it allows rapid screening of many individuals for certain traits of interest and it aids marker-assisted selection programmes. In such breeding programmes, SCARs are designed to link with resistance/susceptibility genes or other genes that determine the commercial value of the plant or animal. For example, Haymes et al. (1997) developed a SCAR for resistance of strawberry (Fragaria ananassa) to the fungus Phytophthora fragariae (Oomycota), which causes a form of
23
root rot. With a combination of primers, a reliable identification could be made for a resistance allele of the Rpf (regulation of pathogenicity factors) gene, which encodes a small excreted protein with a signalling function. Because the RAPD procedure produces only a limited number of bands from each primer and the banding pattern is sensitive to the amount of template DNA and PCR conditions (e.g. Mg2 þ concentration), more reliable fingerprinting techniques have been developed, one of the most popular being amplified fragment length polymorphism (AFLP; Vos et al. 1995). In this technique specific adapter sequences are ligated to DNA digests obtained with two restriction enzymes before a PCR is done. One of the restriction enzymes is a frequent cutter—it binds to a short, common sequence of nucleotides—that will ensure that sufficient fragments are obtained with a size range that allows easy separation by electrophoresis; the other is a rare cutter—it binds to a longer, lesscommon sequence—used to limit the number of fragments amplified by the PCR (only the fragments with a frequent cut on one side and a rare cut on the other side are amplified). The PCR uses primers targeted to the adapter sequences, with one, two, or three bases extending in the amplicon, to select a subpopulation of the fragments. The reaction products are resolved by electrophoresis on a polyacrylamide gel (Fig. 2.6). AFLP can also be applied to cDNAs, in which case it can be used as a differential screening method (see above) when the fingerprints from two pools of cDNA are compared for differential bands (cDNA-AFLP). In complex genomes the number of bands obtained can be very large, sometimes leading to difficulty in interpretation when AFLPs are used for resolving population structure. The number may be decreased by extending the selective bases. For example, using an overhang of four rather than three selective bases, as in Fig. 2.6, reduces the expected number of bands by a factor of 16. Another strategy is the use of three rather than two endonucleases, while retaining only two adapters. Depending on the recognition sequence of the third enzyme, this leads to a reduction of the number of amplified fragments by a factor of
24
INTRODUCTION TO ECOLOGICAL GENOMICS
Restriction fragment AATTCCAC GGTG
TCGT
AGCAAT
Adapter ligation 22 bp common sequence
22 bp common sequence
TCGTTACTCAGGACTCAT
CTCGTAGACTGCGTACCAATTCCAC CATCTGACGCATGGTTAAGGTG
AGCAATGAGTCCTGAGTAGCAG
Selective bases AFLP primer GACTGCGTACCAATTCCAC GAGCATCTGACGCATGGTTAAGGTG
Primer annealing AGCAATGAGTCCT GAGTAGCAG
CTCGTAGACTGCGTACCAATTCCAC
T CGT TACT CAGGACTCATCGTC AGCAATGAGTCCTGAGTAG Selective bases
AFLP primer
Figure 2.6 Outline of the AFLP DNA-fingerprinting method. Top: double-stranded EcoRI–MseI restriction fragment with ‘sticky ends’—that is, overhanging single-strand sequences. Centre: the same fragment after ligation of the EcoRI and MseI adapters (boxed). Bottom: both strands with AFLP primers annealed. Each primer has three parts: the 5 0 part corresponding to the adapter, the restriction site sequence, and three selective bases at the 3 0 end, which make sure that on average (1/4)3 ¼ 1.6% of the fragments generated are amplified. The number of selective bases can be adjusted to genome size. One of the primers is labelled, with either g-32P or a fluorophore, to allow detection of the bands. After Vos et al. (1995), by permission of Oxford University Press.
around 10. This variant of the technique is called three-enzyme AFLP (Van der Wurff et al. 2000). Because AFLP generates a large number of bands (50–150) for each genotype, it became the preferred method for mapping ecologically relevant traits in the 1990s. Many traits that determine the fitness of an organism in the environment are measurable in the phenotype as a quantitative score (body size, clutch size, flowering time, longevity, disease resistance, etc.). The genomic segment underlying such quantitative traits is called a quantitative trait locus (QTL). The identification of QTLs in the genome is a major area of research in ecological genetics and plant and animal breeding (Tanksley 1993, Jansen and Stam 1994). QTL mapping uses controlled crosses, preferrably starting with two inbred parents that differ in the trait of interest, to correlate the segregation of bands in AFLP (or other) fingerprints with the segregation of the trait. When the offspring from two inbred parents are sib-mated for several generations, recombination breaks up the linkage between traits in the parental chromosomes and recombinant inbred lines develop, each of which
contains a nearly homozygous segment from one of the parental chromosomes. The degree of precision that may be obtained is obviously dependent on the recombination frequency around the locus. In general it proves to be very difficult to pinpoint individual genes in this way; often a region of several thousand to some millions of base pairs remains for molecular analysis, so a QTL is not a genetic locus in the strict sense. The genomic revolution has opened up new prospects for QTL mapping by using single nucleotide polymorphisms (SNPs; Borevitz and Nordberg 2003). SNPs are positions in the genome at which at least some individuals of a species have a base pair different from the most common form (see Section 3.1). SNPs are contrasted with other types of genetic variation, such as insertions/deletions and duplications. SNPs and insertions/deletions constitute the predominant source of variation in a population. Depending on the species, there is an SNP every 50 (in Drosophila) to every 1000 (in humans) base pairs in the genome. Highthroughput genomics technology for SNP genotyping has provided a very powerful instrument
(a)
(1) 00
(6) (7) 11
25
PH YA
FH E A1 DI AX (C R RY 1 2)
C ER
1
GENOME ANALYSIS
Map position
(11)
Number of recombinants
45
kb 10
kb 50
90
kb
F19P19
(b) 4
1 0
0
3
4
EDI/CRY2
(c) Cvi: Ler: Col:
Q S Q
S L S
M V V
I T T
127
188
367
467
(d) 612
Figure 2.7 Map-based isolation of the EDI QTL in A. thaliana. (a) Linkage map of chromosome 1 showing the position of various molecular markers and the EDI QTL. F19P19 is the designation of the clone containing the locus. (b) Physical map of the F19P19 clone. The shaded boxes represent open reading frames according to the Arabidopsis genome sequence. The black markers represent seven newly developed molecular markers, used to localize the QTL further. (c) Genomic structure of the CRY2 gene, including the 5 0 - and 3 0 -UTRs and five exons (black boxes). (d) Part of the CRY2 protein sequence, showing four variable amino acids. Q, glutamine; S, serine; L, leucine; M, methionine; V, valine; I, isoleucine; T, threonine; Cvi, Cape Verde mutant (with EDI); Ler, laboratory strain (not EDI); Col, Colombia strain (not EDI). After El-Assal et al. (2001), reproduced by permission of Nature Publishing Group.
for QTL mapping. The genotyping is usually applied to a large population of unrelated individuals, taking advantage of natural genetic variation, and an analysis is made of the linkage disequilibium parameter (D) between pairs of sites in the genome. For a full treatment of the (conceptually complicated) linkage disequilibrium analysis we refer the reader to population genetics textbooks such as that by Hartl and Clark (1997). An example of successful identification of the molecular mechanism underlying a quantitative trait is provided by the case of flowering time in Arabidopsis (El-Assal et al. 2001). A. thaliana from the Cape Verde islands flower much earlier than laboratory strains from temperate regions, and are
hardly sensitive to day length. Mapping with a variety of molecular markers had located an ‘early day length insensitivity’ (EDI) QTL to a 50 kbp region at one end of chromosome 1. The genomic sequence showed that this region contained 15 open reading frames (ORFs); however, the gene cry2 (cryptochrome-2; encoding a photoreceptor protein) was considered a good candidate as the causal agent of the EDI syndrome. Sequence analysis showed that the Cape Verde mutant of this gene differed from the laboratory strain at 12 nucleotide positions: four in the promoter, one in the 3 0 -UTR, and seven in the coding region (Fig. 2.7). One of these mutations, leading to the substitution of a valine residue for a methionine
26
INTRODUCTION TO ECOLOGICAL GENOMICS
in the protein, was proven to be the cause of photoperiod insensitivity. The CRY-2 protein appears to control a signalling pathway involving genes that promote flowering (see Section 5.3.4); under short-day conditions, the amount of CRY-2 protein is greatly downregulated during the photoperiod and this suppresses early flowering in plants from temperate regions under short day length. The mutated protein is less sensitive to the light-induced downregulation and that is why the Cape Verde plants flower earlier. It is obvious that in the tropical Cape Verde islands there is less need for suppression of flowering in response to short photoperiods, so the plants with mutated CRY-2 would have increased in frequency on the Cape Verde islands and natural selection finally drove the mutation to fixation. This study is remarkable for three reasons. First, it shows how a QTL, with the aid of molecular markers and genomic sequence information, can allow a designated gene to be traced. Second, it is interesting that a very simple genetic change, such as mutation of a single base pair, can have such dramatic effects on the life cycle of a plant. Third, it is one of few examples of a molecular mechanism underlying selection in the wild being unravelled in such detail.
2.2
Sequencing genomes
All genome-sequencing projects employ the sequencing principle developed by Sanger (1977b), which makes use of the fact that in a PCR the extension by DNA polymerase is terminated if a dideoxynucleotide (ddNTP) is incorporated in the sequence, rather than a normal deoxynucleotide (dNTP). The trick is to make a reaction mix including normal nucleotides and chain-terminator nucleotides in such a way that amplicons are generated that are terminated randomly at all positions of the sequence. The result of the reaction is a collection of DNAs, each with the same sequence starting at the 5 0 -end of the template, but each differing in length so that the every nucleotide in the entire sequence is represented by a fragment that terminates at that nucleotide. Four similar reactions are conducted, each having one
of four radioactively labelled ddNTPs. Separation of the amplified fragments by electrophoresis and reading the labelled bases in four different lanes allows reconstruction of the sequence of the template. A further breakthrough came from Leroy E. Hood in 1986 with the use of fluorescent labels, allowing a single sequencing reaction containing all four ddNTPs, and detection of DNA fragments using a laser. Machines were developed that could perform DNA sequence analysis completely automatically and send the sequence to a computer (Smith et al. 1986). The principle of sequencing by dideoxy chain termination is treated in all molecular biology textbooks and so is not discussed here in any more detail. Other sequencing principles are emerging, such as sequencing by microarray hybridization, mass spectrometry, atomic force microscopy, and nanopore electrophoresis, but these are not yet applied on a large scale (Gibson and Muse 2002). In this section we will discuss the two main strategies for organizing sequencing projects and the analysis that follows from the data. Laboratories of molecular ecology usually have their own sequencing facilities, allowing sequencing operations on a limited scale; however, it is not likely that they will embark on a wholegenome sequencing project in-house. Instead, whole-genome sequencing is usually contracted out to a commercial sequencing centre or is organized in collaborative networks of many different laboratories. Because of these conditions, we restrict our discussion of genome sequencing to the main principles and avoid too much technical detail.
2.2.1
Library construction
The first, and often most crucial, step in a sequencing project is the construction of a recombinant DNA library. A genomic library is a collection of clones that together encompasses all DNA sequences in the genome of the species. The library is prepared by fragmentation of the genome and insertion of all fragments into a suitable vector. The vector is kept in a host bacterium (usually Escherichia coli) and DNA from the target species
GENOME ANALYSIS
can be cloned by growing the bacteria. The initial fragmentation can be done in two ways: restriction with endonucleases or mechanical shearing. In the case of enzymatic restriction, the cleavage sites of the endonuclease are the same as the cloning sites in the vector and this allows direct insertion in the vector. In the case of mechanical shearing additional enzymatic manipulation is necessary to ligate adapters to the fragments, which will allow insertion into the cloning site of the vector. An advantage of mechanical fragmentation is that it is essentially random and avoids the possible bias arising from the fact that some regions of the genome may be poor in the pertinent restriction sites. In general, it is difficult to make sure that all fragments from the genome have an equal representation in the library; regions of non-coding, repetitive DNA tend to be under-represented, especially if the library is prepared with enzymatic restriction. The number of clones (n) that needs to be prepared to cover the complete genome is given by the following formula (Russell 2002): n¼
lnð1 pÞ lnð1 s=GÞ
where p is the probability that at least one copy of a DNA fragment from the target organism is in the library, s is the average insert size (bp) of fragments in each clone, and G is the size of the genome (bp). For example, to sequence the genome of a bacterium with a genome size of 2 Mbp, using a vector that accepts inserts of 1.8 kbp and aiming for a 99% chance that a genomic fragment is in the library, 5115 clones need to be made. Obviously, n increases with decreasing insert size, increasing genome size, and increasing values of p. Note that this formula specifies the required number of clones in terms of probability. To minimize the chance of missing genomic fragments, most of the fragments will be present more than once in the library. In fact, the average fragment frequency may be around four or five. Many different types of cloning vector are available commercially. Traditionally, the most common vectors used in recombinant DNA technology are plasmid cloning vectors such as pUC19.
27
These vectors are derived from naturally occurring plasmids (extrachromosomal elements that replicate autonomously in bacteria; see Section 3.2), which are further manipulated to suit the purpose of cloning. The manipulated plasmid includes an antibiotic-resistance gene to allow selection of only those host cells that actually have the plasmid. It also has multiple cloning sites inserted in a copy of the lacZ gene to allow plasmids with succesful inserts to be selected on the basis of b-galactosidase activity (white/blue screening of bacterial colonies). Plasmid cloning vectors will accept foreign DNA fragments of a few kilobase pairs in size; from the formula above it can be seen that for most eukaryotic genomes (G ¼ 10–100 000 Mbp) the use of these vectors for genome sequencing would need an insuperable number of clones in many cases. Another group of vectors, called cosmids, can accept DNA fragments of around 40 kbp. Cosmids are completely artificially constructed molecules that contain a number of features (Fig. 2.8a). Like in a pUC vector, there is an origin of replication (ori) sequence, which is recognized by the DNA polymerase of E. coli and ensures efficient replication in the host. Likewise, there is an ampR gene, which confers resistance to ampicillin and allows selection of plasmid-containing hosts. Then there are several cloning sites, where foreign DNA can be inserted, as in normal plasmid cloning vectors. The most characteristic feature of a cosmid is a so-called cos site; this is a recognition site for a phage l endonuclease, which will cleave the plasmid to prepare it for assembly into a phage head. The phage can, however, only be packaged when the plasmid has a length of about 45 kbp. The cosmid itself has been made small, around 5 kbp, so is not packaged by itself; when it carries an insert of around 40 kbp it is the right size. Upon adding the appropriate proteins, phage l is assembled in vivo. Then the phages are used to infect E. coli, which transfers the foreign DNA to the final host. Cloning vectors that accept still larger DNA fragments are bacterial artificial chromosomes (BACs) and yeast artificial chromosomes (YACs). BACs are derived from an extrachromosomal plasmid
28
INTRODUCTION TO ECOLOGICAL GENOMICS
Cloning sites
(a) ampR
cos site
ori
(b)
Left arm
TEL
TRP1
ARS
Right arm
CEN
Restriction sites for cloning
URA3
TEL
Figure 2.8 Schematic representations of (a) a cosmid cloning vector and (b) a YAC. ori, origin of replication; ampR, ampicillin-resistance gene; cos, recognition site for phage l endonuclease; TEL, yeast telomere; TRP1, gene conferring tryptophan independence; ARS, autonomous replicating sequence; CEN, centromeric sequence; URA3, gene conferring uracil independence. From Russell (2002), with permission from Pearson Education Inc..
normally involved in conjugation, the F factor, or sex factor. BACs utilize the origin of replication from the F factor and have several other features such as cloning sites and selectable markers. They can accept DNA fragments of up to 200 kbp. One version of the BAC vector is termed fosmid (for F1-origin-based cosmid-sized vector), and is introduced in the host via phage particles, as for cosmids. Very large DNA fragments, up to 500 kbp, are allowed when using YACs. A YAC is a linear molecule, engineered to resemble a yeast chromosome, with a centromere in the middle and a telomere at either end. The construct includes a sequence that is recognized by the yeast DNA polymerase machinery and allows autonomous replication in yeast. There are selectable markers on each arm (to test for intact chromosomes after insertion of the foreign DNA and restriction sites for cloning; Fig. 2.8b). Obviously, the YAC is grown using budding yeast as a host, rather than E. coli. A genomic library is a valuable resource for any laboratory, because it can be used not only for sequencing but also for gene identification by
library screening. For example, when a cDNA of interest has been picked up by differential display or another gene-discovery method (see Section 2.1), a labelled probe can be made from that sequence and the library screened for any complementary sequences, which can then be picked up and characterized. To do this, the cDNA probe is labelled radioactively and hybridized to a membrane upon which a replica of the library is printed. After washing, remaining radioactivity is detected by autoradiography and one or more spots will indicate the clones in the library that have the sequence of the probe. The same technique can be used for identifying microsatellites, in which case the probe has repeat sequences typical for these loci. Finally, it is also possible to use probes from other species and detect homologous genes by cross-species hybridization. Any clones in which the probe demonstrates a gene of interest can be subcloned and sequenced. For genomic models, library screening in this way has now mostly been replaced by microarray-based techniques (see Section 2.3); however, for ecological laboratories working on non-model organisms the
GENOME ANALYSIS
importance of a good genomic library cannot be overestimated. In addition to whole-genome libraries there are also cDNA libraries and chromosome libraries. A chromosome library is a genomic library of only one chromosome, which is a valuable resource in genome-sequencing projects that use the hierarchical method (see below). A cDNA library is a collection of clones containing reverse-transcribed mRNAs, usually representing a specific physiological condition (e.g. messengers collected after exposure to drought) or a certain tissue (e.g. messengers expressed specifically in the gonads). Fragments of sequenced cDNAs are called expressed sequence tags (ESTs). ESTs are usually produced in a highthroughput, single-pass pipeline, leading to a large collection of sequence reads of 400–700 bp. Development of an EST library is often the first thing to do when commencing a genomics project on a novel organism. Even though most organisms investigated in ecological genomics lack a full genomic sequence, they usually do have an EST library.
2.2.2
Hierarchical sequencing of a genome
The principle of hierarchical sequencing is that the clones in a clone library are ordered with respect to their position in the genome before commencing sequencing. An ordered series of clones will produce a physical map of the genome. In this type of map the distance between markers is measured in physical units: nucleotides. The ultimate physical map is a complete genome sequence. A physical map contrasts with a genetic map that is developed from linkage disequilibrium data, in which distances between markers are derived from inheritance and recombination, and are measured in centiMorgans (cM). A physical map of the genome can be constructed in three ways (Gibson and Muse 2002): Restriction-fragment fingerprinting. Clones are aligned based on their restriction digest patterns. Restriction enzymes cleave DNA at well-defined recognition sites and so each digested clone will produce a characteristic fingerprint of fragment lengths upon electrophoresis; these fingerprints
29
are compared with one another. When there is a correspondence between two bands, one in fingerprint A, the other in fingerprint B, it is likely that they have the same sequence and that clones A and B overlap partly. If another band in fingerprint B is similar to a band in fingerprint C, while A has no such band, a relationship between B and C is established. When many restriction digests are generated and compared using computer programs, a physical map of clone markers results. Terminal sequencing. A further step to identify interconnections between the clones in a library, often used to span the gaps remaining after fingerprinting, is to sequence both ends of the clones. The idea is that at least one end of a clone matches an already assembled part of the sequence. The other end will then extend into the gap or will match an adjacent clone. Terminal sequencing, or end sequencing, is also done as part of the verification procedure after assembly of a genome (see below). Chromosomal walking. Starting with the sequence of one of the clones, a short labelled probe is made using the terminal sequence of that clone. The library is then screened for other clones with that sequence; from the ones that show hybridization, one clone is chosen for further sequencing. Then the terminal sequence of the new clone is used to develop a terminal probe that will pick up the next overlap. After the physical relationship between clones is established, a so-called minimal tiling path is defined. This is an alignment of minimally overlapping clones (e.g. BACs) in such a way that the complete sequence of, for instance, a chromosome is covered (Fig. 2.9). Then each BAC is fragmented by shearing and subcloned for automatic sequencing. The sequence reads obtained are ordered in a series of contiguous sequences, which results in a so-called contig, which is essentially the reconstructed sequence of a BAC. Closing the overlap between contigs allows the construction of larger pieces of the genome, so-called scaffolds. Usually the complete genome sequence cannot yet be assembled from the scaffolds because of
30
INTRODUCTION TO ECOLOGICAL GENOMICS
Chromosomes
Generate large-insert BAC library
Align clones in tiling path Fragment and sequence
Assemble to contigs Assemble to scaffolds End sequencing, gap closure
Figure 2.9 Scheme of the hierarchical approach to whole-genome sequencing.
several gaps, which have to be filled in by further sequencing. This is often done by sequencing both ends of a collection of clones (end sequencing) and looking for identity with parts already sequenced. If an end sequence happens to fall into an already sequenced contig that is adjacent to a gap, there is a good chance that the other end of the clone extends into the gap. In this way an attempt is made to fill in all gaps. Gap closure can also be supported by sequence information from other sources, such as existing cDNAs or ESTs. Finally, comparison of the sequence-based physical maps with the corresponding genetic map (if available) can also be of high value. The gene order in the genetic map should correspond to the gene order in the physical map, although the genetic map may locally expand or contract the physical map due to unequal rates of recombination across the chromosome. The final result is a sequence assembly of the entire genome. This usually still requires further editing to remove errors. For example, after publication of the draft sequence of the human genome in early 2001, it took another 3 years before the sequence (and only the euchromatin part of it)
was considered to be 99% complete, in October 2004. An interesting aspect of the hierarchical approach to genome sequencing is that the work can be distributed among laboratories, each focusing on designated parts of a chromosome or on a certain collection of BACs. Sequencing the yeast genome is the prime example of a project that was mostly completed using the hierarchical approach. Started in 1989, a group of 35 laboratories embarked on the task of sequencing chromosome III, which was completed in 1992. Then in the meantime new projects were formulated, which led to collaboration between 92 laboratories over the years, involving 600 committed scientists, until the completion of the sequence was announced in 1996 (Goffeau et al. 1996). Looking back, Dujon (1996) mentioned that two aspects are critical in a genome programme: construction of clone libraries ‘upstream’ of the sequencing and quality control of the sequence ‘downstream’ of the sequencing. The average accuracy of the yeast genome at the time was estimated as 99.9%, which seems a high figure, but Dujon (1996) noted that
GENOME ANALYSIS
even this figure allows only one-third of all protein-coding genes in the yeast genome to be completely error-free. With a sequence accuracy of 99.99% the proportion of completely error-free proteins rises to 85%.
2.2.3 Whole-genome shotgun (WGS) sequencing The principle of WGS sequencing was introduced in 1995, when the genome of the bacterium H. influenzae was published (Fleischmann et al. 1995). The term shotgun evokes the image of a cloud of shot fired at short range to hit the genome more or less at random. The strategy is to skip the ordering of clones and the construction of physical maps and to just sequence clones in random order until it may be assumed that all genomic fragments have been covered at least once (Fig. 2.10). The average number of times that a fragment is sequenced is called the depth of coverage. The idea is that the likelihood that a segment is not represented at all should be as small as possible by increasing the mean coverage. It may be assumed
that the probability of a base position being sequenced r times, P(r), follows a Poisson distribution, which is given by: mr PðrÞ ¼ m r!e where m is the mean depth of coverage. When the genome size is G and the sequencing has delivered N bases, m ¼ N/G. The probability that a base is then still not sequenced is Pð0Þ ¼ eN=G With 6-fold coverage, the expected fraction of bases not yet sequenced is 0.00248, or 0.25% of the genome. So, even with a high degree of redundancy, there will always remain gaps in the genome sequence; increasing the sequencing effort helps very little after 5-fold coverage because of the principle of diminishing returns inherent in the exponential function. The theory of WGS sequencing goes back to Lander and Waterman (1988). The principle is that the preparation of genome fragments is essentially random, which is approximated by applying shearing, rather than enzymatic digestion of DNA,
Chromosomes
Fragment entire genome Sequence random clones
Assemble to contigs Assemble to scaffolds, map to chromosome
End sequencing, gap closure Figure 2.10 Scheme of the WGS approach to sequencing genomes.
31
32
INTRODUCTION TO ECOLOGICAL GENOMICS
to construct the library. It is also assumed that the sequencing itself is random; that is, random clones are picked from the library. Non-random elements in the procedure may be due to the fact that not all segments from the genome are cloned with the same efficiency and that some parts of the genome are unstable in the cloning vector. This was recognized in the shotgun sequencing of the Drosophila and human genomes, which contain long stretches of repetitive, non-coding DNA. Around one-third (60 Mbp) of the Drosophila genome consists of simple repetitive sequences occasionally interrupted by inserted transposable elements and tandem arrays of RNA genes, with some islands of coding sequences. The long stretches of repetitive DNA are not transcribed, do not uncoil in the interphase of the cell cycle, and are microscopically recognized as heterochromatin. In Drosophila they are located mainly in the centromeric regions of the autosomes and in the entire Y chromosome. Euchromatin is defined as DNA that is found in an uncoiled stage during the interphase and contains actively transcribed genes. The sequencing of the Drosophila genome was restricted to euchromatin, whereas heterochromatin was operationally defined as that portion of the genome that could not be cloned stably in BACs (Adams et al. 2000). Another issue of non-randomness is that some clones in the library may contain deleterious genes, which are expressed when growing the host, with the result that the clone is lost. To minimize this effect, Fleischmann et al. (1995) selected a narrow range of DNA fragments, between 1.6 and 2.0 kbp in size, for inclusion in the library. By chosing a maximum of 2 kbp, the probability that a complete gene is present in a single cloned fragment is small. The WGS approach delivers an enormous number of reads, from which the sequence of the whole genome has to be assembled (Myers 1999). The assembly phase makes use of computer programmes that in principle compare every sequence read with every other read to identify overlaps. From these overlaps contigs and scaffolds can be constructed, as for hierarchical sequencing (see above). Large scaffolds of more than 100 kbp can be mapped onto a chromosomal position. This is
done by matching the scaffold sequence with previously cloned genes whose position is known from linkage maps, or by developing probes that can indicate a scaffold’s position by fluorescent in situ hybridization (FISH) in chromosome preparations. Still considerable effort has to be devoted to verification and accuracy checks, including additional end sequencing of large insert libraries to close the gaps. The WGS strategy was introduced by J.C. Venter and co-workers, then at the Institute for Genomic Research (TIGR). After the H. influenzae project had proven that the strategy was highly effective and could lead to complete genomic sequences in record time, Venter founded Celera Genomics in 1998 with the primary mission to sequence and assemble the human genome by 2001 (Weber and Myers 1997, Venter et al. 1998). As a test system and to explore the applicability of WGS sequencing to large eukaryotic genomes, Celera Genomics first sequenced the Drosophila genome, which was published in March 2000, while the completion of the human genome was announced later in the same year (see Section 1.1). Nowadays, the WGS strategy is applied by all large genomic sequencing centres. The organization of a WGS project is different from a hierarchical sequencing project; WGS sequencing is typically done in a single centre, since it relies on massive parallel sequencing and enormous computational power to assemble the genome. Goffeau et al. (1996) contrasted the two approaches by naming them the ‘factory approach’ and the ‘network approach’. Nothwithstanding this contrast, the two approaches are actually mutually supportive. Hierarchical sequencing employs a ‘shotgun’ element at the stage where large-insert libraries are fragmented and subcloned (Fig. 2.9), whereas of course the assembly of WGS-generated scaffolds can hardly be done without the information on genetic and physical maps. The finishing of the human genome sequence in 2004 showed that a hybrid strategy is necessary to prevent WGS sequences from skipping duplicated regions and so ‘simplifying’ the genome (She et al. 2004). Nowadays large genomes (>30 Mbp) are not sequenced by the WGS method alone, but by combining this with
GENOME ANALYSIS
shotgun sequencing of separate BACs (the BACby-BAC approach).
2.2.4
Gene finding and annotation
Finding genes in a fully sequenced genome would seem to be a trivial task at first sight, but is more complicated in practice. In fact, the concept of gene as a ‘complete chromosomal segment responsible for making a functional product’ emphasizes that a gene is not just a piece of DNA but a unit that must be judged by its deeds. So the concept of gene includes structural as well as regulatory elements (promoter, transcription factor-binding sites, etc.). The following five criteria may support the recognition of genes in a genomic database (modified from Snyder and Gerstein 2003). Identifying ORFs. A DNA sequence that can be read as a series of amino acid-encoding triplets bounded by a start and a stop codon is called an ORF. Computer programs have been developed to locate ORFs in a genomic sequence; however, these programs sometimes have difficulty finding genes if these are small or consist of several exons (the protein coding parts of the gene) interrupted by large introns (noncoding sequences that are spliced out of the RNA after transcription). There are exceptional cases, such as genes embedded in the intron of another gene, that can make the life of a gene hunter particularly difficult. Gene-finding programs have to be trained for every new organism. Gene identification just by scanning the sequence and establishing homologies with known sequences in a database is called ab initio gene discovery. Codon bias. Not all ORFs in the genome are actually transcribed. A pseudogene is a gene that bears resemblance to a functional gene but contains defects such as frameshift or nonsense mutations. Pseudogenes are common in large gene families, groups of genes that underwent repeated duplication leading to a collection of genes with similar but often slightly differentiated function (see Section 3.1). Most pseudogenes are not transcribed; some of them are, but
33
do not lead to functional peptides. Whether a gene is transcribed actively can sometimes be judged from codon-usage bias. This term refers to the fact that although for most amino acids two or more codons are available in the genetic code, some codons occur much more frequently than others. For example, for the amino acid leucine six different triplets are available (CUU, CUC, CUA, CUG, UUA, and UUG), but the majority of leucines are encoded by UUG (in the yeast genome it is 80%, rather than the expected 16.7%). This phenomenon is usually attributed to the fact that the UUG tRNA of leucine is more abundant than other leucine tRNAs and so translation of a messenger in which that codon is used proceeds more efficiently. Codon bias has shed a new light on the neutrality of synonymous mutations. These are mutations that change a codon into another codon for the same amino acid. Such mutations were long thought to be neutral to selection, but the phenomenon of codon bias indicates that there might be subtle preferences even in synonymous mutations. If a gene is transcribed actively there is a continuous selection pressure for the use of preferred codons. Conversely, if many uncommon codons are seen in an ORF it may indicate that the gene is not actively transcribed. Homology search. Many genes in a genome may be ‘identified’ from their similarity to known genes from other species. Using the Basic Local Alignment Search Tool (or BLAST; see Section 2.4.1) or other alignment procedures putative protein-encoding sequences may be compared with databases of sequences from other species, and if there is evidence that in the other species the same ORF encodes an active gene, the case for the new ORF being a real gene is strengthened. Of course, this will only work with genes whose sequence is relatively conserved over species, and this is not always the case. An interesting aspect of genome sequencing is that every new genome comes with 20–60% previously unknown genes. When the yeast genome was published in 1996 about one-half of the ORFs were unknown in other species. In line with molecular biology’s predilection for wordplay
34
INTRODUCTION TO ECOLOGICAL GENOMICS
in technical terms, these ORFs are called orphans. The most striking aspect was that the same orphans were not only unknown in yeast, but also in other species (Dujon 1996). Association with promoter elements. If there are characteristic sequences upstream of an ORF that match with known transcription factorbinding sites, this will increase the likelihood that the gene is functional. In addition, the nature of the transcription factor-binding sites may shed light on the physiological context in which the gene is expressed. Genome-wide discovery of transcription factor-binding sites using conserved sequences and probes from other species is known as phylogenetic footprinting (see Chapter 3). Match with transcript or protein sequences. For many model organisms there is not only a genomic database but also a large collection of cDNA sequences, ESTs, or serial analysis of gene expression (SAGE) tags (see Section 2.3.3). If the sequence of an ORF matches the sequence of a transcript of the same species, the status of the ORF as a true gene is obvious. The same holds for evidence from microarray hybridization (see Section 2.3.1) or matches with protein databases of the same species. The conclusion from these criteria is that the genome sequence itself does not allow solid enumeration of genes. Only functional studies (transcript analysis, proteins, knockout studies) can firmly qualify an ORF as a gene. There is a tendency for the number of genes to be overestimated when the genome sequence of a species
first becomes known. For instance, in the Saccharomyces cerevisiae genome, the initial estimate was 6274 possible genes, but this number has gone down over the years. Three large-scale studies (Kellis et al. 2003, Cliften et al. 2003, Brachat et al. 2003) compared the yeast genome with other fungal species for which a genomic sequence became available by the beginning of the twenty-first century. This allowed several previously unknown ORFs in yeast to be characterized and several spurious ORFs to be removed from the gene catalogue. The Saccharomyces Database (SGD) now classifies genes as verified, uncharacterized, or dubious, according to the degree of certainty that an ORF actually encodes a functional protein. Snyder and Gerstein (2003) used a more extensive classification and estimated the number of genes in the yeast genome to be 6128 (Table 2.1). After an enumeration of the genes has been made, the next most common activity in genome analysis is to name the genes and classify them according to function. This process is called annotation. Without annotation, a genomic database is useless. Annotation is based on a system of gene ontology (GO): a controlled vocabulary used to describe the molecular function and cellular location of gene products and the biological processes in which they are involved. The Gene Ontology Consortium (2000), a collaborative project between the major genomic databases, has proposed to characterize genes according to three major categories: biological process, molecular function, and cellular component. Each of these main categories has numerous denominations to qualify the gene.
Table 2.1 Classification of ORFs in the yeast genome according to Snyder and Gerstein (2003) Type of ORF
Status
Number
Essential ORFs Known ORFs, but no essential ORFs Homology ORFs Other ORFs New short ORFs Total Questionable ORFs Disabled ORFs
Well-characterized and essential metabolic function Well-characterized function, sequence longer than 100 codons Only validated by homology to genes in other organisms Includes short ORFs and ORFs identified by transposon tagging 101 Transposon-identified ORFs and 36 homology-identified ORFs, added since 1996 Protein-encoding genes (2003 estimate) No evidence for transcription, function, or sequence conservation Pseudogenes
1106 2289 2060 536 137 6128 283 221
GENOME ANALYSIS
The system ensures that homologous genes in different databases are assigned the same functional category. The GO system has now developed into an extensive hierarchical structure by which a multitude of aspects of a gene and its product can be described in a way that is valid for all biological species. Conversely, the user of the database finds significant support in the GO classification of the gene. Table 2.2 provides some examples of GO designations of a random set of genes in the database for D. melanogaster (FlyBase). When genes conduct more than one function, application of the GO system may become problematic, especially for the higher categories. This will be the case for genes that have strong pleiotropic effects on the phenotype. To meet these difficulties, Fraser and Marcotte (2004) proposed that the hierarchical GO system should be supplemented with a bottom-up network analysis, in which the function of a gene is not assigned by a human curator, but is determined by statistical analysis of expression profiles. In the system proposed by Fraser and Marcotte (2004) gene functions are defined in terms of the topological properties of the network in which the gene sits;
35
that is, the way it is linked and interacts with other genes. The naming of new genes comes with extensive guidelines that researchers have to follow before a name is accepted by the authority that supervises the genomic database. Each database has conventions for naming and annotating genes and often a nomenclature committee exists to develop internationally accepted standard genetic nomenclature for genes, as well as designations for markers, QTLs, mutations, and allelic variants of genes. There is no universal system for gene names and their abbreviations. Different traditions prevail in different databases. In the human genome gene symbols should be written in upper-case italics (e.g. PGM is the gene symbol for a gene named phosphogluconate mutase), whereas in the Drosophila genome gene symbols are written in italics, in lower case except for the first letter (e.g. Pgm); in bacterial genetics, gene symbols are written in lower case throughout (e.g. pgm). There is bewildering diversity of conventions for denoting alleles, splice variants, and mutants. Different genes of the same family are usually written with the same core symbol followed by a number or
Table 2.2 Examples of application of the GO classification, illustrated by gene annotations in the genome of D. melanogaster (www.flybase.org) Gene name (annotation)
Gene identifier
Molecular function
Biological process
Cellular component
Acetylcholinesterase
Ace
Acetylcholinesterase activity
Synapse
Aconitase ATP citrate lyase
Acon ATPCL
Aconitate hydratase activity ATP citrate synthase activity
Croquemort
Crq
Scavenger receptor ativity
Cytochrome c oxidase subunit Va Glucose dehydrogenase
CoVa
Cytochrome c oxidase activity
Neuromuscular synaptic transmission Amino acid biosynthesis Acetyl-CoA biosynthesis, tricarboxylic acid cycle Apoptosis, macrophage activation Electron transport
Gld
a-Mannosidase II
a-Man-II
Myosin heavy chain
Mhc
Rhodopsin 2
Rh2
Glucose dehydrogenase (acceptor) activity Mannosyl-oligosaccharide 1,3–1,6-a-mannosidase activity Cytoskeletal protein binding, structural constituent of muscle G-protein-coupled photoreceptor activity
Cuticle biosynthesis, glucose metabolism N-linked glycosylation Cytokinesis, striated muscle contraction Phototransduction, visual perception
Mitochondrion Cytoplasm Integral to plasma membrane Mitochondrial inner membrane Extracellular Golgi membrane Striated muscle thick filament Integral to membrane
36
INTRODUCTION TO ECOLOGICAL GENOMICS
a letter (e.g. Pgm1 and Pgm2). The protein is often written in upper-case, regular font style (e.g. PGM); however in bacterial genetics, only the first letter of a protein name is in upper case; for example, Nif is dinitrogenase, an enzyme consisting of two subunits, Nifa and Nifb, which are encoded by genes nifD and nifK, respectively, of the nif operon.
2.3
Transcription profiling
Transcription profiling has proven to be one of the genomics approaches most attractive to ecologists. The aim of transcription profiling is to develop a complete overview of all the genes in a genome that are upregulated or downregulated in response to some factor of interest, in comparison with a designated reference expression. It is important to realize that transcription profiling is essentially relative; that is, comparisons in gene expression are made between a challenged object and a reference object, for the same object at different points in time, or among a series of objects given different treatments.
2.3.1
Microarrays
To develop a genome-wide image of gene expression, all the RNAs present in the cell at a certain time point need to be assessed, as well as their relative abundance. As noted in Section 1.3, the collective pool of RNA (rRNAs, tRNAs, mRNAs, and non-coding iRNAs) in a cell is called the transcriptome. Gene expression is usually focused on mRNA, also called poly(A)-RNA, because mRNA of eukaryotes is often isolated by taking advantage of the characteristic poly(A) tail on each messenger (Fig. 2.1). The genomics way to get an overview of all transcripts is to generate two labelled samples, one from the challenged organism or cell and one from the reference, and hybridize these in competition with each other to a large number of DNA sequences, immobilized on a coated glass plate in an ordered array. Such a device, usually denoted as microarray, first described by Schena et al. (1995), is the cornerstone of transcription profiling in genomics. The term
microarray is contrasted with macroarray, which uses essentially the same technology but is conducted on a nylon membrane with fewer spots and using radioactive labels rather than fluorescence. The spots on a microarray, which are packed very close together, are called probes or sometimes features. The sample of transcripts that is interrogated by the array is called the target. Microarray hybridization is sometimes called reverse hybridization, because the probe represents the immobile phase. This contrasts with traditional Southern blotting, in which the target is immobilized (usually on a membrane) and the (labelled) probe is mobile. The hybridizations on a microarray are visualized by labelling the transcripts—the reference with a green fluorescent label and the test sample with a red label—and the array is scanned using a laser. To check on dye-specific artefacts it is necessary to include an experiment in which the two dyes are interchanged (dye-swapping). Each spot on the array that holds a DNA sequence of sufficient homology to one of the sequences in the collection of mRNAs will be labelled red or green if the abundance of that messenger was greater or less in the the tested sample compared with the reference. In this way, genes that are upregulated relative to the reference will be labelled with one colour and genes that are downregulated will be labelled with the other. For all spots that correspond to messengers whose abundance in the sample is similar to the reference, equal amounts of label will bind and the spot will be perceived as yellow. Spots for which there is no corresponding messenger will not be labelled at all. The use of a microarray for transcription profiling can be illustrated with a classical paper by DeRisi et al. (1997). These investigators were interested in the changes in physiology that occur in yeast (S. cerevisiae) when cells switch from anaerobic growth (fermentation), using glucose as a carbon source and producing ethanol, to aerobic growth, which occurs when glucose is depleted after fast growth and the cells turn to respiring ethanol. This diauxic shift is accompanied by a fundamental reorganization of the cell’s physiology, in which the expression of many genes changes. Since at
GENOME ANALYSIS
the time the microarray had just been introduced (Schena et al. 1995) and the genome sequence of yeast completed (Goffeau et al. 1996), the authors could apply one of the first genomics approaches to transcription profiling. DeRisi et al. (1997) amplified ORFs from the yeast genome using PCRs with primers specific for each gene. These DNA fragments, approximately 6400, corresponding to nearly all the genes in the yeast genome, were printed onto glass slides using a robotic device. In the experiment, cells were harvested at different stages in the growth phase and mRNA was isolated. These mRNAs were reverse-transcribed to cDNAs and labelled with a red carbocyanin (Cy5) label, and this was mixed with a green (Cy3) labelled sample prepared from cells harvested directly after the start of the experiment. After hybridization and washing the array was scanned using a fluorescent confocal microscope and images generated like the one shown in Fig. 2.11. Microarray scans are often represented in colour, where a red spot indicates upregulation, a green spot indicates downregulation, and a yellow spot constant expression; however, the fluorescence intensities of the two carbocyanine labels are not actually ‘seen’ in colour by the detector, which just records digital values for intensities at different wavelengths. Therefore a colour representation of a microarray image is also referred to as having false colours. In Fig. 2.11 and elsewhere in this book we represent microarray scans in grey tones, although the difference between upregulation and downregulation is not always discernible in this way. The reader should consult the original publications to obtain complete views of microarray images. DeRisi et al. (1997) discussed their data in terms of the biochemical pathways for carbon and energy metabolism (pentose phosphate pathway, glycolysis, Krebs cycle, glycoxylate cycle). They were able to show that the changes in mRNA abundance during diauxic shift could be mapped onto this biochemical framework and indicated that a significant redirection of metabolites was taking place. It was also apparent that groups of genes responded in a coordinated fashion and seemed to be regulated by a common factor. This
37
Figure 2.11 Scan of a microarray as used by DeRisi et al. (1997). Each spot represents one of 6500 DNA sequences from the yeast genome, printed on a glass plate of 18 18 mm. The array was used to detect gene-expression changes occurring when the cells had depleted glucose from the medium after 9.5 h and shifted to aerobic metabolism. In this negative greyscale picture, hybridization intensities are indicated by different shades of grey. In full-colour images upregulation and downregulation is indicated in red and green, resp. Some of the spots are indicated by codes designating the genes. The rectangle on the left indicates a section of the microarray singled out for further analysis (not shown). Reprinted with permission from DeRisi et al. (1997). Copyright 1997 AAAS.
observation triggered further studies into the mechanisms by which transcription factors activate sets of genes collectively. In the course of the 1990s new techniques for the fabrication of microarrays were introduced, which led to so-called high-density oligonucleotide arrays or gene chips (Lockhart et al. 1996, Lipschutz et al. 1999, Lockhart and Winzeler 2000). In the these systems, short sequences of 20–25 nucleotides are synthesized directly on the substrate using photolithography. In such arrays, all the probes are synthetic and genomic sequence information alone is sufficient to construct the array. The probes can be made in such a way that the most unique part of a transcript is represented; this does not need to be the coding part of the gene; in fact, often the 3 0 - or 5 0 -UTR of the mRNA is used, since this is more specific for a transcript
38
INTRODUCTION TO ECOLOGICAL GENOMICS
Table 2.3 Overview of features of the two most common microarray approaches in genomics Spotted cDNA microarrays
High-density oligonucleotide microarrays (GeneChips)
Probes
Known and unknown cDNAs
Probe manufacture
PCR-amplified from EST libraries or complete cDNA libraries Spotted (printed) by means of a robot Fluorescent labels attached to the cDNAs during reverse transcription
Oligonucleotides designed on the basis of genome knowledge Synthesized by photolithography
Probe deposition Labelling of target sample
Manufacture of arrays
Can be home-made in an academic research center
than the coding region. It is also common to use multiple probes designed to hybridize to different regions of the same transcript. In addition, each probe is supplemented by a control sequence that has one mismatched base in the middle of the sequence. Because the target cDNA should only bind to the perfect probe and not to the mismatch probe, an accurate measure of transcript abundance can be obtained by subtracting the match signal from the mismatch signal. Hybridization with these arrays is non-competitive; only a single sample of target is applied to each array and comparison with a reference is made across chips. In Table 2.3 a contrast is made of the characteristics of spotted cDNA microarrays and gene chips. Oligonucleotide microarrays allow a greater coverage of the genome and may be more repeatable across laboratories. The extremely large number of synthetic oligonucleotides that may be packed on an array (some technologies allow for 195 000 probes on an area of hardly more than 2 cm2) allow each gene to be represented by multiple probes (Nuwaysir et al. 2002). This is useful when aiming to detect polymorphisms and different splice variants of the same gene, and it also allows for within-array replication of gene expression. However, such arrays are obviously only possible for true model organisms, whose genome is completely known. The technology to manufacture these oligonucleotide arrays is advanced and applied only by a few specialized companies. The costs of commercially available microarrays is sometimes prohibitive to their use
Synthesized directly on the substrate Biotinylated cRNAs, produced by T7 RNA polymerase from cDNA; biotin recognized by fluorescently labelled streptavidin Manufactured by specialized companies (Affymetrix,Agilent)
in academic research laboratories. The fact that many species of interest to ecologists are not genomic models at the moment, added to the modest amount of financial resources available to ecologists in comparison with medical and agricultural research, implies that spotted cDNA microarrays will probably remain the main platform of choice for ecological genomics. Fig. 2.12 provides an overview of the two approaches to transcription profiling (Schulze and Downward 2001).
2.3.2 Microarray-based transcription profiling in ecological genomics At which stage in an ecological research project can microarray-based transcription profiling be worthwhile? There are several strategic considerations. Microarrays can be considered as an instrument of diagnosis; that is, transcription profiling can provide insights into the functional performance of an already well-known genome. For example, one might use a microarray to characterize the physiological state of an organism in the environment and use this information to draw inferences about its fitness or about certain characteristics of the environment. We call this the diagnostic use of microarrays. This type of use is expected to follow from an earlier developmental phase in which various probes are tested for their indicative value to the properties of interest, until the optimal design of the microarray is decided. Another use of microarrays in transcription
GENOME ANALYSIS
(a)
Perfect match Mismatch
Array preparation
Array preparation
cDNA collection
Insert amplification by PCR Vector-specific primers Gene-specific primers
mRNA reference sequence
AAAAAAAAA
(b)
39
Probe set
In situ synthesis by photolithography
Printing Coupling Denaturing
Array 2 Array 1
Ratio array 1/array 2 Ratio Cy5/Cy3
Hybridization mixing Cy5
Cy3 Cy3- or Cy5labelled cDNA
Total RNA
AAAAAAAA AAAAAAAA AAAAAAAA
Biotin-labelled cRNA In vitro transcription AAAAAAAA T 1
AAAAAAAA T3
Double-stranded cDNA
cDNA synthesis
First-strand cDNA synthesis AAAAAAAA
Target preparation
Target preparation
Staining hybridization
AAAAAAAA AAAAAAAA AAAAAAAA AAAAAAAA
AAAAAAAA AAAAAAAA AAAAAAAA AAAAAAAA
AAAAAAAA AAAAAAAA AAAAAAAA AAAAAAAA
Poly(A)-RNA Cells/tissue
Cells/tissue
Figure 2.12 Overview of transcription-profiling approaches applied for (a) spotted cDNA microarrays and (b) high-density oligonucleotide microarrays. In the cDNA approach (a), the microarray is printed from a cDNA library (often developed from ESTs), and the probes are isolated by PCR amplification using primers specific to the gene or the vector. PCR products are printed using a high-precision robotic device. The target sample is obtained from RNA isolated from two groups of cells or tissues. This is used for reverse transcription in the presence of nucleotides with fluorescent labels (e.g. Cy3 and Cy5). The two samples are mixed in a hybridization buffer and brought into contact with the array under competitive conditions, such that for each probe the most abundant transcript (with either a Cy3 or a Cy5 label) binds most to the array. Scanning of the array with wavelengths corresponding to the excitation spectra of the two dyes will provide a picture of the transcript abundance profile in the sample, relative to the reference. In the high-density oligonucleotide microarray approach (b), sequence information of the transcriptome of a genomic model species is used to develop probes of 25 nucleotides which provide a perfect match with a unique part of a each transcript. In addition, control probes are developed with a single base mismatch. Each transcript sequence is represented by 16–20 different probes. The probes are synthesized in situ and fixed directly to the array. The target sample is prepared from poly(A)-RNA isolated from the cells or tissues of interest, which is reverse-transcribed to generate double-stranded cDNA, using a poly(dT) with a transcriptional start site for T7 RNA polymerase; this polymerase is then used to synthesize cRNA using biotinylated nucleotides. The two pools of amplified RNAs are hybridized with two different arrays and target binding is detected by staining with a fluorescent dye coupled to streptavidin, which recognizes the biotin label. Signal intensities of probe sets of the two different arrays are used to calculate relative transcript abundance. After Schulze and Downward (2001), reproduced by permission of Nature Publishing Group.
profiling is the explorative use (see Feder and Mitchell-Olds 2003). With this term we indicate that arrays may be manufactured from genomes that are not completely sequenced; the array is
then used to discover transcripts that respond to some factor of interest, and these transcripts are only sequenced after the arraying experiment has identified them as promising or interesting.
40
INTRODUCTION TO ECOLOGICAL GENOMICS
One might also envisage a shuttle approach, for example when explorative transcription profiling in a non-model species of great ecological relevance is alternated with more detailed studies using microarrays of genomic model species, aimed to identify functions of genes in the non-model by analogy with the model. Another issue of strategic nature is the distinction between local and global transcription profiling (Schulze and Downward 2001). In the local approach, the interest is with a limited set of genes, for example in mutants with a specific overexpression or knockout, and the microarray is used to identify the collective set of genes upregulated or downregulated in association with this particular condition. The problem with this analysis is that microarray experiments can easily deliver lists of hundreds of genes whose expression is changed but who may not be all equally relevant to the phenotype of interest. In the global approach, expression profiling is used to generate a genomewide picture of co-regulated genes, signatures of certain pathways, etc. This is often followed by statistical analysis (see Section 2.4) aimed at identifying clusters of genes with similar function. Finally, we emphasize that the interpretation of data obtained from microarray transcription profiling is greatly improved when a biochemical framework or other a-priori knowledge is available for the phenomenon of interest. This was exemplified in the study discussed above where the upregulation and downregulation of genes under diauxic shift in yeast was related to the known network of carbon metabolism in the cell. Various biochemical systems for interpretation of transcription profiling are presented in Chapters 5 and 6; network analysis is discussed in Chapter 7.
2.3.3 Serial analysis of gene expression (SAGE) Microarrays are not the only approach to transcription profiling. No less than 27 different methods for transcription profiling are listed by Shimkets (2004). A technique that deserves mention here goes under the name of SAGE (Velculescu et al. 1995, 2000, Matsumura et al.
2003). The principle is that short sequences of 9–15 bp contain sufficient information to uniquely identify a transcript, provided that the sequence is isolated from a defined position in the transcript. This is obvious from the fact that the frequency of a 9 bp sequence in a genome is 49, which equals 1/262 144, a number which exceeds the number of transcripts in even large genomes. In SAGE, such short sequences (called tags) are excised from cDNAs and linked one after the other (concatenated) in a 1 kbp clone for sequencing. Then simply counting the number of tags in the sequences provides an absolute measure of the abundance of the corresponding mRNA. The experimental procedure of SAGE is a hallmark of ingenious design in molecular biology. In short, mRNA is isolated and reverse-transcribed to cDNA including a biotin label at the 3 0 -end. The cDNAs are then cleaved with a so-called anchoring enzyme and the 3 0 -ends are isolated by means of streptavidin-coated beads (biotin attaches specifically and strongly to streptavidin). Then the sample is divided into two subsamples and two different PCR primers are ligated to the sticky ends of the cDNAs. The primer sequence includes a recognition site for a type IIS restriction enzyme. The crucial element of the technique is that this type of restriction enzyme cleaves DNA 20 bp downstream from the recognition site. This enzyme is called the tagging enzyme. Consequently, when the enzyme digests the bead-attached cDNAs, it cleaves off a short sequence, which consists of the PCR primer site at the 5 0 -end, the recognition site of the tagging enzyme, the recognition site of the anchoring enzyme, and a transcript-specific short tag at the 3 0 -end (Fig. 2.13). The two samples are then mixed, the blunt ends left by the tagging enzyme are ligated to each other, and a PCR is applied using the two primer sites in the linkers. This leads to a population of so-called ditags, which are purified and concatenated (serially linked to each other) into larger clones for sequencing. The arrangement of two tags bordered by anchor enzyme restriction sites can be recognized unambigously by software and counted. Comparison to a genomic database will reveal the identity of the genes whose tags are in the sequenced pool.
GENOME ANALYSIS
41
AAAAA TTTTT AAAAA TTTTT AAAAA TTTTT
Cleave with anchoring enzyme (AE) Bind to streptavidin beads GTAC GTAC GTAC
AAAAA TTTTT AAAAA TTTTT AAAAA TTTTT
Divide in half Ligate to linkers (A+B) A CATG GTAC A CATG GTAC A CATG GTAC
B CATG GTAC CATG B GTAC B CATG GTAC
AAAAA TTTTT AAAAA TTTTT AAAAA TTTTT
AAAAA TTTTT AAAAA TTTTT AAAAA TTTTT
Cleave with tagging enzyme (TE) Blunt end GGATGCATGOOOOOOOOO
GGATGCATGXXXXXXXXX Primer B CCTACGTACOOOOOOOOO Primer A CCTACGTACXXXXXXXXX TE AE Tag TE AE Tag Ligate and amplify with primers A and B GGATGCATGXXXXXXXXXOOOOOOOOOCATGCATCC
Primer A CCTACGTACXXXXXXXXXOOOOOOOOOGTACGTAGG Primer B Ditag Cleave with anchoring enzyme Isolate ditags Concentrate and clone CATGXXXXXXXXXOOOOOOOOOCATGXXXXXXXXXOOOOOOOOOCATG GTACXXXXXXXXXOOOOOOOOOGTACXXXXXXXXXOOOOOOOOOGTAC
AE
Tag 1 Tag 2 Ditag
AE
Tag 3 Tag 4 Ditag
AE
Figure 2.13 Schematic outline of the SAGE procedure. Double-stranded cDNA is synthesized from mRNA with a biotinylated oligo(dT) primer. The cDNAs are cleaved with an anchoring enzyme (AE) and then captured on streptavidin-coated beads. The anchoring enzyme recognizes four bases (it is a four-cutter) and is expected to cleave each cDNA at least once. The sample is divided into two halves and linker sequences are ligated to each end, containing primer sites for a PCR and a recognition site for a type IIS restriction enzyme (tagging enzyme, TE). Digestion with this enzyme liberates a sequence consisting of the primer site, the two restriction sites, and a short transcript-specific tag. The two samples are then mixed again, and the tag ends ligated so as to produce a PCR template with two tandomly arranged tags (ditag). Finally the ditag sequences are purified, contatenated, cloned, and sequenced. Reprinted with permission from Velculescu et al. (1995). Copyright 1995 AAAS.
SAGE has developed into a well-established methodology with its own community that organizes workshops, exchanges experiences, and maintains a website (www.sagenet.org). The great advantage of SAGE is that it is very sensitive and performs better than microarray analysis when identifying genes with low expression levels (Gibson and Muse 2002). Applications at the moment are mostly in the medical sector (cancer research) and yeast transcriptomics; ecological applications are still rare (but see Chapter 5). A disadvantage of SAGE is that it relies on massive
sequencing, which may be prohibitive to some laboratories, and the recognition of tags requires knowledge about the genome.
2.3.4
Quantitative PCR
In a normal PCR, the amplification product is only a qualitative indicator of the template; the amount of DNA produced after a certain number of cycles, which is usually assessed on a gel, is hardly dependent on the initial amount of template. To make the PCR quantitative, systems have been
42
INTRODUCTION TO ECOLOGICAL GENOMICS
Log fluorescence
(a) –1
Fluorescence threshold
–2
–3 5
10
15
20
25
30
35
40
45
Cycle
Log template DNA
(b)
7 6 5 4 3 2 10
15
20
25
CT value Figure 2.14 (a) Time course of fluorescence during a quantitative PCR reaction monitored with Syber Green, using different amounts of template. Note that fluorescence is plotted on a logarithmic scale, so the linear increase of the lines indicates exponential amplification. The cycle number at which a pre-set fluorescence threshold is reached is designated as the cycle threshold (CT). This value is plotted in (b) as a function of the known amount of template DNA estimated by spectroscopic methods. The linear relationship indicates that CT can be used as a measure for the initial amount of DNA in the reaction vessel. After Rutledge and Coˆte´ (2003) with permission from Oxford University Press.
developed by which the build-up of product in a PCR can be monitored during the reaction (Rasmussen et al. 1998). This requires a thermocycler coupled to a device that can read optical signals coming from the reaction vessels or capillaries. Two principles are applied. One is the use of a dye, Syber Green, which becomes fluorescent when intercalated in double-stranded DNA. Since after a few cycles the bulk of DNA in a PCR mix consists of the amplified product, the increase of fluorescence is a measure of product build-up. The other principle is to use a template-specific primer that carries two fluorophores, one an emitter and the other a quencher, extinguishing the fluorescence signal by means of fluorescence resonance energy transfer (FRET). As long as the fluorophores are
close together there is no fluorescence, but when the PCR proceeds, polymerase activity destroys the primer and the loss of physical proximity between the two dyes allows the fluorescence of the emitter to become detectable. As more and more FRET primer is digested, free emitter fluorophore accumulates in the solution and the fluorescence signal increases with time. Monitoring of PCR amplification with fluorescent dyes in real time produces a sigmoidal curve (Fig. 2.14a). Usually it takes more than 10 cycles for the level of fluorescence to be detectable. Then an exponential phase is entered, in which the signal amplifies by a fixed factor with every cycle, until a plateau is reached, when the signal hardly increases with the increasing number of cycles.
GENOME ANALYSIS
Two parameters describe the essence of such a curve, cycle threshold value and PCR efficiency. The cycle threshold value is defined as the cycle number at which the curve increases above a baseline or error variance. This is a measure of the amount of template in the original mixture. Calibration curves can be made to correlate the cycle threshold value with the number of template copies and usually a linear relationship is observed (Rasmussen et al. 1998, Rutledge and Coˆte´ 2003). In mathematical terms, the relationship between the initial number of DNA molecules, N0, and the cycle threshold is described by: N0 ¼
NC ðe þ 1ÞC
where NC is the number of DNA molecules at the threshold fluorescence, e is the PCR efficiency, and C is the cycle threshold (Rutledge and Coˆte´ 2003). PCR efficiency is given here as a fraction, so if efficiency is 100%, e ¼ 1, and the products build up by a factor of two with every cycle. From this formula it can be seen that log N0 ¼ log NC C logðe þ 1Þ and because NC and e are constants, a plot of log N0 versus C should show a straight line with slope log(e þ 1). This is indeed the case, as shown in Fig. 2.14b. The amplification efficiency (e) can be estimated from this slope and e þ 1 should be around 2. When real-time PCR is applied to cDNA generated by reverse transcription, the cycle threshold value becomes a measure of the amount of mRNA upon which the reverse transcription reaction was done. In this version it is called quantitative reverse-transcription PCR. An important consideration, however, is the calibration of the reaction, especially since the amount of total RNA will not be exactly the same from one sample to another. Therefore the reactions always include expression measurements of so-called housekeeping genes, which are assumed not to vary from one sample to another and so represent an unbiased measure of the amount RNA isolated. Stu¨rzenbaum and Kille (2001) discuss the suitability of control genes for quantitative reverse-transcription PCR.
43
The most commonly used genes are 28 S rRNA, b-actin, elongation factor 1a, albumin, tubulin, and hypoxanthin phosphoribosyl transferase. Obviously, the sequences of these genes need to be known in the species of interest and reliable PCR primers developed. Stu¨rzenbaum and Kille (2001) emphasize that control genes must be checked in every new set-up and preferrably more than one control gene should be analysed. Genes that appear to have invariable expression during one stage of life (e.g. b-actin in the adult) may prove to vary in another stage (e.g. b-actin during juvenile morphogenesis). When a reliable housekeeping gene is obtained, division of the cycle threshold value of the target gene by the cycle threshold value of the housekeeping gene leads to a fold regulation (FR) value. In a multiplex set-up, FR values of many genes together constitute a transcription profile.
2.4 Data analysis in ecological genomics Data generated by genomics programmes, be it sequences or gene-expression profiles, are invariably voluminous in nature. Management and analysis of genomics, proteomics, and metabolomics data has developed into a science of its own, bioinformatics. Attwood and Parry-Smith (1999) and Lesk (2002) give a succinct overview of this field, with practical exercises focused on consulting genome databanks and conducting alignments. Since this type of bioinformatics is already covered in several textbooks, only a very short treatment will be given here, while most emphasis will be paid to data analysis associated with transcription profiling.
2.4.1
Alignment and homology search
One of the first questions that an investigator asks when a DNA sequence becomes available is whether similar sequences have been published by others. Similarity of the new sequence with already existing sequences is usually ascribed to homology. In evolutionary biology, homology is defined very strictly and reserved for those cases
44
INTRODUCTION TO ECOLOGICAL GENOMICS
where the similarity between two positions in a sequence is due to their common descent from the same ancestral sequence. In genomic analysis the term homology is often used more loosely to indicate any similarity exceeding a certain threshold. In principle, similarity may also be due to convergence: the development of the same pattern through positive selection in different lineages. Base-pair similarities that have arisen in different taxa independently through convergence or reversal are called homoplasies. Of course, computer programs cannot discriminate between the various causes of similarity; often supplemental information (not forgetting visual inspection) is needed to distinguish homology from similarity. The most important tool for answering the question of similarity is the Basic Local Alignment Search Tool, abbreviated to BLAST (Altschul et al. 1990). This computer program has become so influential that to BLAST is now a common verb among molecular biologists. One of the most important functions of the BLAST algorithm is to search a large database, such as the GenBank Nucleotide Sequence Database, using a query sequence provided by the investigator and to produce a table of sequences deposited by others, with an indicator of the similarity of the query sequence
to such sequences. There is a whole suite of different BLAST programs; BLASTP aligns a query amino acid sequence with database protein sequences, BLASTX aligns a query translated nucleotide sequence with database protein sequences, and TBLASTX aligns a query translated nucleotide sequence with database translated nucleotide sequences (Lesk 2002; see www.ncbi.nlm.nih.gov/BLAST). Table 2.4 and Fig. 2.15 give an example of a BLAST search. D. Roelofs (unpublished data), using suppression subtractive hybridization (see Section 2.1), found a partial cDNA in the springtail O. cincta (Collembola) that had a differential expression between two populations, one metaltolerant and the other not. The sequence was BLASTed to GenBank, which produced high similarities to genes annotated as ATP-binding cassette (ABC) transporters in D. melanogaster, Anopheles gambiae (mosquito, Diptera), and Apis mellifera (honey bee, Hymenoptera). The fact that the most significant hits were all insects and all hits indicated the same type of gene put great confidence in the conclusion that the unknown cDNA was a collembolan version of an ABC transporter. The ABC transporters are a large family of proteins involved in the transport of a
Table 2.4 Example of a table in a BLAST report, showing the eight most significant alignments of a query sequence of an SSH clone from O. cincta (Collembola) that was upregulated in a metal-tolerant population, compared to a reference population (D. Roelofs, unpublished data) Code
Species and gene identification
Score (bits)
E value
N
gi j 24650854 j ref j NM_170376.1 j gi j 28626479 j gb j BT004906.1 j gi j 24650852 j ref j NM_143371.1 j gi j 31208990 j ref j XM_313462.1 j gi j 48113775 j ref j XM_393164.1 j gi j 28317030 j gb j BT003531.1 j gi j 31206646 j ref j XM_312290.1 j gi j 31241126 j ref j XM_320987.1 j
Drosophila melanogaster CG9990-PB Drosophila melanogaster LD15982 Drosophila melanogaster CG9990-PA Anopheles gambiae ENSANGP00000019635 Apis mellifera, similar to ENSANGP00000019635 Drosophila melanogaster RE14039 Anopheles gambiae ENSANGP00000020975 Anopheles gambiae ENSANGP00000007803
251 251 251 245 237 230 222 217
3e-78 3e-67 3e-78 5e-78 5e-75 2e-70 4e-69 9e-67
3 3 3 3 3 2 3 3
Notes: All these hits are annotated as ATP- binding cassette (ABC) transporter complexes in three different species of insects. See text for details. Score is a measure of similarity, defined by the BLAST algorithm, expressed in bits; the higher the score, the better the alignment. E is the Expect value, a parameter describing the number of hits one expects by chance when searching a database of a particular size. It depends on the size of the database as well as on the sequence length. Expect values are given as powers of ten, so 3e-78 means 3 1078. E decreases exponentially with the bit score. The lower E, the better the alignment. N is the number of high-scoring segments pairs (separated by non-matching segments and gaps).
GENOME ANALYSIS
45
Key for alignment scores
<40
0
100
40–50
200
50–80
300
400
80–200
500
600
200
700
800
Figure 2.15 Figure in a BLAST report indicating which parts of sequences in the database have a similar score to a query sequence (top black bar, showing sequence positions 0–820). The grey tones of the bars below indicate the degree of similarity of sequences in the database. The figure shows that in this case the scores of the first 14 alignments are good, and that the optimal alignments assume a gap of around 80 bp in the region between positions 460 and 540 of the query sequence. See Table 2.4 for an explanation of the example.
wide variety of cellular compounds, such as sugars, ions, peptides, and more complex organic molecules. In this case the upregulation of an ABC transporter might indicate that the capacity for removing ions out of the cell or into lysosomal vesicles is increased constitutively in the metaltolerant population, to avoid cellular damage from free metal ions in the cytoplasm when exposed to polluted soil. One of the most important parameters in the BLAST report is the E value or Expect value, a statistical measure of the likelihood that the query sequence is found in the database by chance if there were no true match. The codes in the table link to web pages on which the gene is described, with information on the genomic position, gene classification, cellular function, and original publications. As the name of BLAST indicates, similarities between sequences are established after alignment. This extremely important procedure in bioinformatics, which underlies all genomic analysis, allows for a ‘sliding’ of one sequence relative to another until the number of corresponding bases is maximized. To maximize the correspondence it is
often necessary to assume that the two sequences differ not only by simple substitutions, but in places also by deletions and insertions, leading to gaps in the alignment. The alignment is optimized by allowing positive scores for each match and negative scores for gaps, while maximizing the final score using a computer algorithm. Gap penalties may have a large influence on the optimal alignment produced by BLAST. Aligned sequences of different species can be used further to develop a phylogeny, a hypothetical tree of evolutionary descent, for the sequence of interest. Such phylogenies can use the nucleotide sequence itself or, in the case of an ORF, the amino acid sequence implied by it. The reader is referred to Graur and Li (2000), Gibson and Muse (2002), and Lesk (2002) for a more detailed treatment of sequencealignment procedures and phylogenetic analysis.
2.4.2
Processing of microarray data
As indicated in Section 2.3, one of the most prominent types of genomics approaches, with great potential for ecological applications, is
46
INTRODUCTION TO ECOLOGICAL GENOMICS
transcription profiling using microarrays. The raw data from such experiments come in the form of 16-bit TIFF images in which each pixel is assigned an intensity score between 0 and 216 ( ¼ 65 536). These files need to be transformed into a geneexpression matrix before the true analysis can begin (Fig. 2.16). The data-processing phase is conducted by software supplied with microarray scanners, but is important to understand how the images are actually transformed into a geneexpression matrix. The reader is referred to Brazma and Voli (2000), Quackenbush (2001), Butte (2002), Causton et al. (2003), and Kim and Tidor (2003) for a detailed discussion of this matter. Image analysis. The raw data generated by a scanner consist of a picture of spatially explicit flurorescence intensities (see Fig. 2.11). The image-processing software must recognize the spots, determine their boundaries, measure the signal coming from each spot, compare it with a local background, and assign the result to the correct probe. Usually the software makes use of the fact that the elements are arranged in subgroups; in the case of spotted microarrays these are so-called pen groups, which derive from the arrangements of pens in the spotter.
The user needs to indicate where approximately these subgrids lie, and the software adjusts a grid to overlay the spots. So-called landing lights can help the correct placement of the grid over the spots. These landing lights may represent spiked controls at known positions with a strong signal. Once the grid is placed, the pixels that make up the spot have to be determined. For most scanners the pixel size is 10 mm, so that a circular spot of 200 mm in diameter contains about 314 pixels. The signal from these pixels is compared to a similar number of pixels within the same grid cell but outside the spot. A frequency distribution of these signals is made, which ideally shows two separate intensity peaks: a peak at high intensity for the spot pixels and one at low intensity for the surrounding pixels. The intensity of the lowest peak is then subtracted from that of the highest peak to arrive at a background-corrected spot intensity. In this way, each spot is corrected for its own local background; this avoids variation in the background across the array and is better than global background correction, where only a single value for the background is chosen to correct all spots on the array. If there are several probes
Gene
FR
Image analysis, normalization
Data filtering
Probe spot
Grid
Local background
Image file (TIFF) (two different ones)
Data file (Excel)
Figure 2.16 Illustrating the steps that have to be taken to transform a microarray scan into a gene-expression data matrix. FR, fold regulation.
GENOME ANALYSIS
on the array that represent the same gene (this is always the case with oligonucleotide gene chips), the corrected spot intensity is averaged over all spots for the same gene. Estimating expression ratios. As explained in Section 2.3, transcription profiling with the use of microarrays is essentially relative. In spotted cDNA arrays a query sample is compared with a reference sample by competitive hybridization and two signals, corresponding to two different fluorescent dyes, are read from each spot. When using gene chips, the reference and query samples are hybridized to different arrays, but also in this case spots corresponding to the same probe are compared. The quotient of the two signals is defined as the expression ratio Ti for each gene i: Qi Ti ¼ Ri where Qi is the signal for gene i in the query sample and Ri is the signal for the same gene in the reference sample. In spotted cDNA microarrays, Q derives from the Cy5 signal (red) and R from the Cy3 signal (green), or vice versa. The expression ratios are always logarithmically transformed and generally the logarithm to the base 2 is applied. This transformation results in a quantity known as fold change or fold regulation (FR). As a result of the transformation, FR takes a value of 0 if there is no change, a value of 1 if there is a 2-fold increase, and a value of 1 if there is a 2-fold decrease in expression. A 4-fold increase results in FR ¼ 2 and a 4-fold decrease in FR ¼ 2. So: FRi ¼2 log Ti ¼
10
log Qi 10 log Ri 10 log 2
It should be noted that the use of expression ratios has a disadvantage, namely that information about the actual signal intensity is lost. So genes that are expressed weakly in both the Q and R samples are treated similarly to genes with an overall strong expression, if the relative up- or downregulation is the same. Whereas taking relative measures is common in transcription profiling, in other microarray applications, for example the detection of microbial diversity in the environment (see Chapter 4), absolute values are taken. Kerr and Churchill (2001) took a stand against the argument
47
that transcription profiling is necessarily relative and they proposed that the two readings could be considered as two correlated measurements, as in a traditional incomplete block design, common in agricultural experimentation. Normalization. For various reasons, the FR values obtained cannot be directly compared across replicate measurements or different experiments. The most common source of variation is the use of different amounts of RNA as the starting material from which the target sample was prepared. Another important source is unequal incorporation of dyes in the cDNAs. There are various strategies for normalization (Causton et al. 2003). One approach is to calculate the mean FR value of all probes on the array and to subtract this mean value from all other values (total intensity normalization). This will make sure that the mean expression ratio over the whole array is unity. Another approach is to consider a regression of log Qi against log Ri. If the initial amount of RNA is exactly the same for the Q and R samples and if the labelling and detection efficiencies are also identical, such a plot would show a cluster of points around a straight line through the origin with slope 1 (of course, individual genes will lie apart from the line due to up- or downregulation). However, often the data do not fall exactly on such a straight line and show a curving trend (Fig. 2.17, left-hand panel). Since the interest lies in deviations from the diagonal, insight may be increased by rotating the plot by 45 and re-scaling the axes. This can be done by plotting M ¼ 2log Q 2log R over A ¼ 2log Q þ 2log R, and in such a plot M should be independent of A (Fig. 2.17, right-hand panel). If this is not the case, one can correct the data by subtracting a quantity c, which depends on A and is defined as the difference between the local deviation of the data from a horizontal line. This correction term is estimated for each value of A by means of local weighted regression (loess; Smyth et al. 2003). The third approach in data normalization is to use expression ratios of housekeeping genes as a basis for normalization. One can also use spiked controls that do not cross-hybridize with the
48
INTRODUCTION TO ECOLOGICAL GENOMICS
4
M = 2log Q – 2log R
Query signal (2log Q)
10
8
6
2
0
–2
4
4
6
8
10
Reference signal (2log R)
4
6
8
10
12
14
A = 2log Q + 2log R
Figure 2.17 (a) Scatterplot of two signal intensities, log Qi (from the query sample, e.g. fluorescence from Cy5) and log Ri (from the reference sample, e.g. Cy3) over all genes i in a microarray expression analysis. Ideally one expects that the average of the data falls along a straight line with slope 1 through the origin. The slightly curved shape indicates intensity-dependent bias. (b) When plotted as M ¼ 2log Q 2log R over A ¼ 2log Q þ 2log R, the bias is visualized more clearly. The data can be corrected by subtracting a term which depends on A and is estimated by local weighted regression (loess). From Smyth et al. (2003) by permission of Humana Press.
2.4.3 Statistical analysis of microarray experiments
very long column in which the FR values of all genes are noted. Usually one experiment involves several samples and these are taken together in one gene-expression matrix with a number of columns; for example different points in time, different physiological states of the organism, or different environments from which the RNA was isolated (Fig. 2.18). Because gene-expression matrices are valuable resources for statistical analysis and a single investigator is often not able to exploit all possible data-analysis techniques, the data are often published on the Internet. This allows other researchers to compare expression profiles across studies, in much the same way as a genomic database is consulted by different people. Brazma et al. (2001) considered the requirements that such data matrices should have in order to be valuable for the research community. They developed a standard known as minimum information about a microarray experiment (MIAME). This standard stipulates that publication of geneexpression matrices should be accompanied by details about:
The result of a single microarray experiment is a data file that can be viewed as a matrix with one
Experimental design (conditions, doses, replication, quality-control measures, etc.)
target; for example photosynthesis genes from Arabidopsis on an insect microarray. These probes are then queried with a well-known amount of added RNA and so their signals provide a stable reference. Unlike in quantitative PCR, the use of housekeeping genes is not the preferred approach in the case of microarrays, because it ignores the multitude of information on the array (expression of only a few genes is used to correct for expression of thousands of others) and microarrays do not allow very precise measurement. Data filtering. In addition to normalization it is also recommended to filter the data to remove dubious expression measurements. The most important data-filtering operation is to screen for low-intensity measurements that have a large inaccuracy. As a criterion, each fluorescence signal should be at least twice the standard deviation of the local background. Another issue in data filtering concerns the case where probes targeting the same transcript produce inconsistent results.
GENOME ANALYSIS
Samples
Sample annotation
Genes
Gene-expression matrix
Gene-expression levels
Gene annotation Figure 2.18 Conceptual view of a data matrix which forms the starting point of statistical analysis of microarray-based transcription profiling. Gene annotation is done using standard codes and links to gene sequence databases; there is no universally accepted guideline for annotation of the horizontal axis (samples). Each cell contains a (log-transformed) fold regulation value. After Brazma et al. (2001), by permission of Nature Publishing Group.
Array design (type of array, source of probes, clone identifications, etc.) Hybridization conditions (buffer, washing procedure, hybridization time, temperature, etc.) Measurements (quantification, normalization, data filtering, etc.) As part of MIAME it is required that the raw image file from the scanner, with relevant scanning parameters, is supplied with the publication. An interesting aspect of gene expression is that it often accompanied by a significant degree of noise. Gene expression is of a fundamentally quantitative nature and it depends on factors such as physiological state of the organism, developmental phase, tissue or cell population, and genetic background, factors that cannot always be controlled in an experiment. For the ecologist who is accustomed to the sometimes extremely large fluctuations in patterns and processes in nature, quantitative variation does not come as a surprise, but for molecular biologists this is a relatively new
49
phenomenon, which contrasts greatly with the deterministic nature of DNA sequences and biochemical pathways. As a consequence, we see in transcription profiling the use of statistical techniques, such as analysis of variance and cluster analysis, that are also used in ecology for analysing population fluctuations and community composition. One of the first considerations when dealing with noise is replication. There are various elements of pseudoreplication in microarray analysis; for example, several signal readings from one spot, or several probes representing one gene. Sometimes investigators replicate the cDNA synthesis but draw from the same pool of RNA, which is also to be considered pseudoreplication. True replication should come from the use of different animals and plants for RNA extraction, or, even better, from repeating the experiment in its entirety. Since labour and costs associated with microarray experimentation are factors not to be neglected, a careful consideration of the type and degree of replication is of great importance. Another issue of concern is the microarray platform itself. Tan et al. (2003) compared the performance of three different commercial microarrays (Amersham, Agilent, and Affymetrix) to profile the same cell line and noted that the majority of genes identified as differentially expressed by each technology were identified uniquely by that technology. Of 185 differentials, only four genes were identified by all three platforms. So gene-expression results may depend to a large degree upon the type of microarray used in the experiment. This could be due to differences in probe sequence, variation in labelling and hybridization conditions, and the lack of standards across multiple technologies. Obviously, significant improvements in reproducibility are still needed to remove these sources of noise (Marshall 2004). One approach to analysing microarray data is to apply an analysis of variance (ANOVA) or an equivalent linear model to each gene separately (Jin et al. 2001). For example, if two factors are considered (such as sex and age in a study of gene expression in Drosophila), the analysis takes the
INTRODUCTION TO ECOLOGICAL GENOMICS
form of a two-way analysis of variance applied to each gene, for which the model is (Sokal and Rohlf 1995): FRijk ¼ m þ ai þ bj þ ðabÞij þ eijk where FRijk is the FR value of this gene expected for replicate k of sex i at age j, m is the overall mean expression, ai is the effect of factor A (e.g. sex) at level i, bj is the effect of factor B (e.g. age) at level j, (ab)ij is the interactive effect of A and B together, and eijk is the error term. There must be at least two replicate measurements for each combination of factors for such an analysis to be useful. The ANOVAs will lead to a few thousand F tests, one for each gene, and these tests will indicate the genes that are differential between sex, that change with age, and that change with age in a sex-dependent manner. One should be careful, though, in attaching an absolute value to the outcome of a significance test. Because tests are applied to the same larger database, the P values for the F tests may not represent the true type I errors. To avoid taking too many false-positive results on board, a significance level of 104 or even smaller is chosen. New statistical methods are being developed for controlling the false-positive discovery rate (Cheng et al. 2004). In addition, the significance of the effect must be balanced against the magnitude of the effect. In judging magnitudes of effects in transcription profiling, up- or downregulation by a factor of 2 is usually chosen as a threshold (FR value of greater than 1 or smaller than 1). Not all effects exceeding this threshold will be significant and not all significant effects will exceed the criterion of 2-fold change. To illustrate this, Jin et al. (2001) developed a presentation known as a volcano plot, in which the apparent P values are plotted as a function of the FR value, both on a logarithmic scale (Fig. 2.19). Such a plot shows that some genes with a highly significant effect do not fulfil the criterion of 2-fold change, while on the other hand there are also genes that do fulfil the criterion of 2-fold change but are not significant. The plot may help to identify these different groups of genes, and focus further research on the most promising among them.
15 Significance of effect (–log P)
50
C
A
C
10
4 B
B
1,3 0 –3
–2 2
–1 –0.5
0.5 1
2
3
log fold regulation by sex
Figure 2.19 Volcano plot showing the relationship between the P values of F tests applied to gene expressions of D. melanogaster as a function of sex, and the magnitude of the effect. Each point is a separate gene. The horizontal axis gives the fold regulation value of the gene with respect to sex (genes to the left are downregulated in males compared to females, genes to the right are upregulated). The 2log value of the gene-expression change is plotted, so a value of 1 implies a 2-fold upregulation and a value of –1 a 2-fold downregulation. The vertical axis gives the 10log-transformed reciprocal P value, so the line at 1.3 corresponds to P ¼ 0.05 and the line at 4 to P ¼ 104. The latter value was taken by Jin et al. (2001) as the ‘preset experiment-wise false positive acceptance level’. There are several genes that are significant but have a fold regulation lower than a factor of 2 (region A) and there are also genes that are more than 2-fold up- or downregulated, but are not significant (regions B). Only genes in regions C are beyond doubt. After Jin et al. (2001), by permission of Nature Publishing Group.
In addition to analysis of variance, various nonparametric methods have been proposed, some of the most popular being SAM, Statistical Analysis of Microarrays (see www-stat.stanford.edu/~tibs/ SAM; Tusher et al. 2001) and RDAM, Rank Difference Analysis of Microarrays (Martin et al. 2004). In non-parametric methods the raw signals from a microarray scan are replaced by ranks and variation among replicates by rank differences. Gene-by-gene analysis of microarray data, be it parametric (ANOVA) or non-parametric (rankbased), has the disadvantage that it does not consider the correlation structure among the expressions of different genes, otherwise than by controlling the false-discovery rate. Actually, the gene-expression matrix is of a multivariate nature (see Fig. 2.18). Each gene may considered as a case
GENOME ANALYSIS
(also called an object) and the samples represent a number of measurements made on that case. Various multivariate statistical techniques can be applied to data organized in this way and one of the most common is some form of hierarchical clustering. The logic of clustering is evident from the fact that groups of genes will have similar expression patterns over samples, because they are induced by the same environmental conditions or regulated by the same transcription factors. The most common clustering algorithm to apply to microarray data comes from Eisen et al. (1998). Clustering starts by developing a matrix of pairwise distances between the genes. There are different ways to calculate distances, one of the most straightforward being Euclidean distance. Suppose we are considering genes A and B, and we have observations on gene expression of ai for gene A and bi for gene B in sample i, then the Euclidean distance DEucl between the genes is: sffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffiffi n X DEucl ðA; BÞ ¼ ðai bj Þ2 i¼1
where n is the number of samples. This distance measure is calculated for each pair of genes, resulting in a distance matrix, which is input to the clustering algorithm. To illustrate the calculation, Table 2.5 provides a hypothetical example of a very simple gene-expression matrix and the calculation of Euclidean distance between the three genes. This example suggests that the distance between genes B and C is smaller than between either A and B or A and C. The Euclidean distance is not the only way of defining distances between genes. Other measures are Minkowski distance, Manhattan distance, and
51
Hamming distance. In addition, the clustering may be based on a similarity measure, such as Pearson correlation, rather than distance. The reader is referred to Causton et al. (2003) and textbooks of multivariate statistical analysis for more information. The object of clustering analysis is to develop a dendrogram that groups together genes with similar expression patterns. There are several principles that can be applied to achieve clustering. In an influential paper on gene-expression data analysis, Eisen et al. (1998) applied the so-called average linkage method. In this method a computer algorithm screens the matrix of pairwise distances for the smallest value (in the case of the genes sampled in Table 2.5, this would be 2.53, between genes B and C; see Table 2.6). Then a node is defined between these genes and geneexpression values are calculated for the node by averaging over the two genes involved. The distance matrix is then updated and a new smallest distance is identified. The procedure is repeated until g–1 nodes have been made, where g is the number of genes. Software packages such as developed by Eisen et al. (1998) not only provide a computational procedure but also a pictorial presentation of the clustered gene-expression pattern; each gene is qualified by a colour code, where red is used for upregulated expression and green for downregulated expression. Cluster analysis is usually done in conjunction with other multivariate statistical techniques, such as principal component analysis (PCA; also known as singular-value decomposition). The aim of PCA is to find combinations of genes that jointly contribute most to the variability in the data. Technically speaking, one aims to find axes in the
Table 2.5 Hypothetical gene-expression matrix, illustrating the calculation of Euclidean distances (DEucl) between genes (see also Tables 2.6 and 2.7)
Table 2.6 Euclidean distance (DEucl) between the three genes in Table 2.5 over the three samples
Gene
Gene
Sample 1
A B C
0.2 3.6 1.2
2
3
2.3 2.1 1.3
1.9 1.2 1.1
A B C
DEucl A
B
C
1 – –
6.37 1 –
4.79 2.53 1
INTRODUCTION TO ECOLOGICAL GENOMICS
(a)
(b)
Variance (%) 0
10
20
30
40
50
60 200
1 2 CDKB1;1
CYCA2;1 CDKB2;2 CYCD1;1 CYCB1;2 CYCB2;1 CYCA1;2 CYCB2;2 CYCB1;4 CYCB3;1
100 Principal component 2
3 Principal component
52
4 5 6
H4 H1 H2B H1
H1 H2A H2B H2A
0
H2A.F/Z
7
CYCD4;1
100 8 9 –150
–100
–50
0
50
100
150
Principal component 1
(c)
(d)
Time in cell cycle (h) 0 2 4 6 8 10 1214 1619
A
c1: 25
c2: 33
c3: 31
c4: 40
c5: 35
c6: 21
c7: 27
c8: 48
c9: 25
c10: 18
c11: 21
c12: 37
c13: 44
c14: 24
c15: 21
c16: 43
B
C
D
E
F
G 0.0 0.2 0.4 0.5 0.6 1.0 Expression level (normalized)
GENOME ANALYSIS
multidimensional space of gene expressions in such a way that if the data points are considered with respect to these axes, the dispersion of points is greatest. These axes or principal components are then said to explain a particular fraction of the variation. The operation is also seen as a dimensionality reduction. A convenient way to represent the results of a PCA is a biplot (Chapman et al. 2001), a graph in which the data points are projected onto the two axes that explain the greatest amount and the second greatest amount of the variance in the data. In such a graph each gene is represented by a dot, and genes positioned close together have similar expressions over treatments. Usually an interpretation can be given to the axis, based on the treatment variable with which it is most strongly correlated, and from this interpretation a biologically meaningful summary of the effects can be made up. It turns out that for gene-expression matrices only a few principal components can actually explain the data. This is due to the fact that many gene expressions are correlated with each other, but also that the number of samples is usually much smaller than the number of genes. So the amount of information in a gene-expression matrix is not so large as would seem from the long list of genes. By plotting the data in a two-dimensional graph a lot of the information is captured already. Holter et al. (2000) express the situation by analogy with spectral analysis of music: ‘the complex ‘‘music of the genes’’ is orchestrated through a few underlying patterns’, and ‘the genes in a microarray comprise a set of identically tuned strings’. Kim et al. (2001) and Kim and Tidor (2003) showed that dimensionality reduction leads to a limited number of building blocks that can be scaled and added together in various combinations to best
53
reconstruct the data. The authors developed a system in which the genome of C. elegans is dissected into 43 expression mountains, where each mountain represents a functional group of 5–1818 genes with a high internal correlation of expression. Another popular approach to analysing geneexpression data is the technique of self-organizing maps. A self-organizing map starts with a set of nodes with a simple topology, for example in a two-dimensional grid, and continues by applying an algorithm in which the nodes are mapped onto the highly dimensional space of the data points in such a way that the distance from data points to nodes is as small as possible (Tamayo et al. 1999). The number of nodes needs to be specified beforehand, and so the procedure is equivalent to placing a fixed number of flags in a landscape in such a way that the scatter of data points is organized around the flags in an optimal way. The algorithm can dissect a complex data set in a limited number of genes clusters, where each cluster has a characteristic response over treatments. As an example of a full statistical analysis of a microarray study we discuss the analysis of genome-wide gene-expression changes during the cell cycle of A. thaliana (Menges et al. 2002, 2003). An oligonucleotide microarray of the genome of Arabidopsis (Affymetrix ATH1) was used to look at gene-expression changes during a synchronized cell culture (Fig. 2.20). Plant cells were grown in suspension under continuous agitation and were synchronized by release from a chemical inhibitor. Gene expressions were first analysed by PCA and this demonstrated that the first principal axis already explained more than 50% of the variation, while the second added another 20%. In dimensionalityreduced representation two main clusters appeared (Fig. 2.20b). Hierarchical cluster analysis (Fig. 2.20c)
Figure 2.20 Results of statistical analysis of gene expression changes during the cell cycle of a synchronized cell suspension culture of Arabidopsis. (a) PCA showing the percentage of explained variance by successive axes. (b) PCA biplot of the data in a state space reduced to two dimensions. (c) Result of hierarchical clustering, showing gene expressions as a ‘heat diagram’, where different shades of grey indicate upregulation and downregulation. Note the oblique pattern of dark fields indicating peak expressions at different times in the cell cycle. (d) Sixteen patterns of gene expression change over the cell cycle, identified by self-organizing map analysis. The number of genes involved in each pattern (numbered c1–c16) is indicated. The small pie charts show the composition of each cluster with respect to four gene classes characteristic for certain cell-cycle phases (S, M, G1, G2). After Menges et al. (2002), with permission from Springer.
INTRODUCTION TO ECOLOGICAL GENOMICS
confirmed the existence of two main clusters, each of which could be subdivided further. In total, 16 different clusters were recognized, each representing a particular pattern of expression during the cell cycle (Fig. 2.20d). For example, cluster 5 (35 genes) represents genes that increase continuously in expression during the experiment whereas cluster 16 (43 genes) represents genes with decreasing expression over time. Using different ways of synchronizing the cell culture, Menges et al. (2003) finally developed a refined list of 1082 genes (out of some 14 000 genes that could be detected under the conditions chosen) that were cell-cycle regulated, of which 371 have no known function at the moment.
2.4.4 Towards an analytical framework for ecological genomics The statistical data analysis discussed above applies equally to genomics in general as to ecological genomics in particular. One important issue arises, however, which is that ecologists may be interested in the variation across samples (the horizontal axis of a gene-expression data matrix) more than the variation across genes (the vertical axis of a gene-expression data matrix). This seems especially relevant if the samples come from diffferent habitats, different treatments, or different genetic lines of the same species. The question in ecology could be which samples have similar expression profiles over genes?, rather than which genes have similar expression profiles over samples?. Of course, it is perfectly possible to apply the same statistical techniques to sample-based profiles. The only thing that needs to be done is that distances between samples rather than between genes are calculated from the primary data. For example, the matrix of Euclidean distances between samples, calculated from Table 2.5, is given here as Table 2.7. The distances indicate that samples 2 and 3 are most similar and 1 and 3 are most different. Because a gene-expression matrix has many more genes than samples, such an analysis would enforce a much greater information reduction than is achieved by the gene-clustering approaches
outlined above. The situation in ecology may be similar to that in pharmacology and toxicology, where the aim often is to classify drugs on the basis of similarities of expression profiles across genes (Hamadeh et al. 2002, Waters and Fostel 2004). In an ecological application, the data points in a biplot of PCA would represent conditions (environments, treatments) rather than genes. The classification of ecological categories using transcription profiling may eventually lead to a genomics-based characterization of an ecological system (Fig. 2.21). Since the state of any ecological system (organism, population, community) will fluctuate in time and space without obvious adverse consequences, there is a range of operation which could be considered as ‘normal’. The 95% confidence space of such undisturbed states may Table 2.7 Euclidean distance (DEucl) between the three samples in Table 2.5 over the three genes Sample
1 2 3
DEucl 1
2
3
1 – –
2.92 1 –
3.19 1.00 1
State variable 2
54
Normal operating range (NOR)
Disturbed system State variable 1 Figure 2.21 Hypothetical picture of the states of an ecological system in two dimensions (e.g. PCA axes) resulting from dimensionality reduction of gene-expression profiles. Each point on the diagram represents a composite characterization of clustered gene expression (state) under undisturbed conditions. The state fluctuates in time and space due to the inherent noise in gene expression. The 95% confidence ellipsoid of undisturbed states is defined as the normal operating range (NOR). If a system finds itself out of this range, this is indicative of disturbance or stress.
GENOME ANALYSIS
be defined as the normal operating range (NOR) of the system. This concept, already mentioned by Odum (1979), was used by Kersting (1984) to characterize the fluctuations of Daphnia and Chlorella populations in a closed microcosm, monitored for a long time. In an ecological genomics context, it can be used to characterize the state of an organism on the basis of its geneexpression profile (Fig. 2.21). When observations are made for transcription profiles under several different undisturbed conditions, these can be used to define a reference profile and its variability defines the NOR. Then, when a new situation is
55
encountered, the distance between the new state and the border of the NOR is a measure of disturbance or stress (Fig. 2.21). A consistent data-analysis framework for ecological genomics still has to be developed. The classification of samples using transcription profiling, as suggested above, is only one possible approach. The point we want to make is that ecological genomics does not necessarily have to follow the pathway that has been laid out by genomics in medical or agricultural sciences. Ecological genomics will have to find ways of data analysis to suit its own, ecological, questions.
CHAPTER 3
Comparing genomes
In this chapter we will deal with the first step that usually follows completion of a full genome sequence, which is to inspect the genome for its general properties, such as G/C content, number of genes, gene distribution, etc., and compare it with other species, related or unrelated. Genetic model species will be the starting point for our comparisons, but we will explore, wherever possible, links with species from the same clade and highlight the ecological significance of models and their wild relatives.
3.1
Properties of genomes
Once the genome of a species is elucidated the researcher is able to analyse the properties that characterize the genome as a whole. This is usually not done in isolation, but in comparison with other species, and therefore this part of genome science is called comparative genomics. The term structural genomics—the study of genome sequences, genetic and physical maps, etc.—is also appropriate here, as a contrast with functional genomics; however, some scientists use this term for the analysis of structural, three-dimensional, properties of proteins, using X-ray diffraction and nuclear magnetic resonance. Comparative genomics draws heavily on bioinformatics and uses computer programs to find patterns in genome sequences across species, to estimate similarities that can support the assignment of gene functions, and to develop phylogenetic trees by which the evolutionary relationships among genomes are visualized (Hedges 2002). Arguments from comparative genomics have become crucial in selecting new species for wholegenome sequencing. Sequencing efforts can be 56
optimized to discover what information the new species can provide about functionalities in alreadysequenced genomes and to determine at what evolutionary distances such species should be placed to maximize that information (Eddy 2005). Comparative genomics is now a recognized subdiscipline of genome science and the first handbooks are appearing (Saccone and Pesole 2003). The field is closely related to molecular phylogenetics, for which we refer the reader to Hughes (1999) and Graur and Li (2000). Before discussing the genomes of species in more detail, in this section we provide an overview of the properties of genomes.
3.1.1
Genome size
Usually the size of a genome is known to some accuracy before its complete sequence is elucidated, because genome size is essential knowledge for optimal construction of a genomic library and the design of a genome-sequencing project. Genome size may be estimated using biochemical methods or flow cytometry, and is usually expressed in picograms of the haploid genome per cell. This is easily converted to nucleotides by the general formula G ¼ 0.987 109 C, where G is genome size in basepairs and C is genome size in pg (roughly, 1 pg is equivalent to 1000 Mbp). Genome size in pg is also known as the C value. Estimates of genome size are now available for more than 3800 species of animals (www.genomesize.com; Gregory 2005) and 3900 species of land plants (www.rbgkew.org. uk/cval). The size of a genome varies dramatically across species. Table 3.1 provides a few examples of fully sequenced genomes that illustrate this diversity.
COMPARING GENOMES
Table 3.1 Genome size and number of genes for organisms with completely sequenced genomes Species
Total size of the genome (kbp)
Estimated no. of proteinencoding genes
Bacteriophage fX174 Mycoplasma genitalium Methanococcus jannaschii Haemophilus influenzae Escherichia coli Agrobacterium tumefaciens Pseudomonas aeruginosa Saccharomyces cerevisiae Caenorhabditis elegans Drosophila melanogaster Arabidopsis thaliana Oryza sativa
5.4 580 1665 1830 4639 5670 6264 12 610 95 500 123 000 125 000 466 000
10 468 1738 1743 4288 5419 5570 6128 18 424 13 601 25 498 50 820
There is an obvious increase of genome size going from viruses to prokaryotes, and further to unicellular eukaryotes and multicellular eukaryotes. This increase can be related to the increasing complexity of the cells and tissues involved. Viruses do not need their genomes to encode all the proteins that they require for their maintenance and propagation, because they exploit the molecular machinery of the host. The minimal number of genes required for an autonomous self-replicating entity was estimated by Graur and Li (2000) as 256 (based on a comparison of prokaryotic genomes) or 254 (based on a review of knockout studies). This is about one-half of the number of genes in Mycoplasma genitalium, which has 468 genes, the lowest number of any independently living organism. Unicellular eukaryotes have a genome size one order of magnitude greater than the average prokaryote; however, the extremes meet each other; the yeast genome is only twice as large as the largest genome of a prokaryote sequenced so far (Pseudomonas aeruginosa) and even smaller than that of some Cyanobacteria. Another order of magnitude lies between unicellular and multicellular eukaryotes, but the variability among the latter group is enormous. A second trend in genome sizes across species is the reduction of the genome (genome miniaturization)
57
in endosymbiotic organisms and parasites. In the ultimate endosymbiotic entity, the mitochondrion, many genes were lost compared to its alphaproteobacterial ancestor, partly due to deleting functions that were not necessary in the symbiotic life style, and partly by migration of genes to the nuclear genome of the host. The same holds for chloroplasts; however, chloroplasts (stemming from Cyanobacteria) have retained a significantly larger genome than mitochondria. Genome size reduction is also seen in parasites, and this may explain the very small genome of M. genitalium. However, it must be pointed out that there is also an opposite tendency: parasites need to have specialized proteins for adhesion to tissues of their host and to thwart the host’s immune response, so they have larger genomes. The two trends noted above are about the only ones that can be observed when comparing genome sizes across species. In fact, there is a remarkable lack of correspondence between genome size and organism complexity, especially among eukaryotes. For example, the marbled lungfish, Protopterus aethiopicus, has more than 40 times the amount of DNA per cell than humans! Fig. 3.1 provides an overview of the ranges for the various taxonomic groups. The lack of correspondence between genome size and organism complexity has become known as the C value paradox. It is obvious that the enormous increase of genome size in some lineages is not accompanied by a proportional increase of the number of genes. This is already evident from Table 3.1, which shows that the number of genes tends to reach a plateau of some 20 000– 50 000 with increasing genome size. In fact, the non-genic fraction of the DNA is the main responsible factor for the C value paradox, such that in eukaryotes anything between 30 and 99% of the genome can consist of non-coding DNA (repetitive sequences, mobile elements, introns, intergenic spacers, etc.). Ohno (1972) introduced the term junk DNA to stress the fact that, according to him, non-coding DNA is a useless but mostly harmless part of the genome and persists because of the replicative nature of DNA and linkage with functional genes.
58
INTRODUCTION TO ECOLOGICAL GENOMICS
Mammals Birds Reptiles Frogs Salamanders Lungfishes Teleosts Chondrichthyes Agnathans Non-vertebrate chordates Crustaceans Insects Arachnids Myriapods Molluscs Annelids Echinoderms Tardigrades Flatworms Rotifers Angiosperms Gymnosperms Pteridophytes Bryophytes Nematodes Cnidarians Sponges Fungi Algae Protozoa Bacteria Archaea 10–4
10–3
10–2
10–1
1
10
102
103
C value (pg) Figure 3.1 Ranges of reported genome sizes (C value of the haploid genome, in pg per cell) for different organism groups. From Gregory (2005), with permission from Elsevier.
How does a genome enlarge itself? Polyploidization is one of the most important mechanisms. This can concern a duplication of the entire genome (global polyploidization), or parts of the genome (regional polyploidization). Many global polyploidy mutations are highly deleterious because they interfere with cell division and meiosis. In mammals, polyploidy destroys the mechanism of dosage compensation, which normally inactivates one X chromosome in the female to compensate for the lack of complementary genes on the Y chromosome in the male. Still, polyploidies that concern an even number of chromosomes, such as tetraploidy (doubling of the diploid genome), sometimes do not have adverse effects on the phenotype and may be a mechanism for
evolutionary innovation. A famous example is the tobacco species, Nicotiana digluta (2n ¼ 72), which is assumed to originate from genome doubling in a sterile hybrid (2n ¼ 36) between Nicotiana tabacum (2n ¼ 48) and Nicotiana glutinosa (2n ¼ 24). Polyploidy is especially common in angiosperms and pteridophytes, but rare in gymnosperms and bryophytes. There are also large differences in ploid levels between plant families. Polyploidy is relatively rare in animals; however, some families of fish, most notably in the Cypriniformes (carp, minnows) and several species of the amphibian order Anura (frogs and toads) are known for their relatively high occurrence of polyploid species. The only known cases of polyploidy in mammals are two species of octodontid rodent,
COMPARING GENOMES
Figure 3.2 The red viscacha rat, Tympanoctomys barrerae (Octodontidae, Rodentia), representing a rare case of tetraploidy in mammals. The animal has 100 autosomes plus two sex chromosomes (X and Y). Courtesy of M.T. Gallardo, Universidad Austral de Chile.
Tympanoctomys barrerae and Pipanacoctomys aureus, which inhabit the salt deserts of Central Argentina (Gallardo et al. 1999, 2004; Fig. 3.2). T. barrerae has a C value of 16.8 pg, which is twice the amount of its closest relatives (8.2–7.6 pg) and out of the normal range of mammals (see Fig. 3.1). Triploidy (arising from hybridization of a haploid and a diploid gamete) always leads to sterility, although it does not prevent growth and asexual reproduction in many plants, as shown by the triploid banana plant (Musa acuminata). This condition may actually be exploited by plant breeders to produce commercially attractive seedless fruits, for example of watermelon (Citrullus lanatus). The polyploid nature of many commercially interesting crops—for example, corn (Zea mays), with a genome size of 2500 Mbp, and wheat (Triticum aestivum), with a genome of 16 000 Mbp—is a serious obstacle for the commencement of genome-sequencing projects on these species. In polyploid organisms the term genome size may become ambigous. Greilhuber et al. (2005) have proposed that in addition to the C value, which denotes the haploid genome with chromosome number n, another term, Cx value, should be used to denote the chromosome base number (x) in a polyploid organism. For a tetraploid, 2n ¼ 4x, and for a triploid, 2n ¼ 3x. We should also note that when a tetraploid organism comes into existence, the C value doubles but the Cx value is not changed, because the number of different chromosomes remains the same. However, when
59
the organism evolves further, paralogous genes may differentiate in function, the two chromosomal complements undergo rearrangements and eventually the tetraploid situation will no longer be distinguishable from a normal diploid. This situation is termed cryptopolyploidy. According to several authors (e.g. Spring 1997) the vertebrates as a whole may be considered a cryptopolyploid lineage, originating from two successive rounds of duplication, one prior to the divergence of jawless fish (Cyclostomata) and one thereafter (Gnathostomata and higher vertebrates). This hypothesis, also known as the 2R hypothesis, seems to be supported by a variety of evidence, including the occurrence of several genes in 4-fold copies in vertebrate compared to invertebrate genomes. However, Hughes (1999) pointed out that under the 2R hypothesis one expects the phylogeny of duplicated genes in vertebrates to show four clusters arising from three splits, one dividing the tree in two branches, the other two splitting each branch. Hughes (1999) tested this expectation using several gene families, one of which, the Notch genes, is reproduced in Fig. 3.3. Notch genes encode transmembrane signalling proteins, and were first discovered in Drosophila where mutations in this gene are recessive and embryonic lethal due to hypertrophy of neural tissue at the expense of epidermal tissue. In the heterozygous condition these mutations cause notches at the edges of the wings, hence the name of the gene. Drosophila has only one Notch gene, but vertebrates have four. Despite the fact that the one/four comparison would support the 2R hypothesis, the phylogeny clearly does not (Fig. 3.3). In the tree, the Notch4 variant even clusters outside the insect Notch and outside vertebrate Notch1, 2, and 3. One gene duplication seems to have taken place prior to the split between vertebrates and insects, whereas two successive duplications followed in the vertebrate lineage. A similar situation holds for seven other gene families. So, there is no phylogenetic evidence for two rounds of whole-genome duplication as assumed by the 2R hypothesis. The second mechanism of genome enlargement, regional genome duplication, will lead to localized
60
INTRODUCTION TO ECOLOGICAL GENOMICS
Mouse NOTCH1
57 99 0.0
p
0.05
Rat NOTCH1
99
Human NOTCH1 Zebrafish NOTCH1 Clawed frog NOTCH1 Goldfish NOTCH3
99 95
Mouse NOTCH3
100
Human NOTCH2 Blowfly SCL
100
100
D. melanogaster NOTCH Mouse NOTCH4
100
Human NOTCH4 D. melanogaster crumbs Chicken serrate Human jagged
100 92
Rat jagged
Figure 3.3 Phylogeny of the Notch gene family in some vertebrates and insects, constructed on the basis of proportional amino acid differences (p). Serrate, Jagged, and Crumbs were used as an outgroup to root the tree. The values along the branches are percentages of support in 1000 bootstrap samples. After Hughes (1999) by permission from Oxford University Press.
repetitive sequences. This may occur through unequal crossing-over, in which case whole genes or even substantial segments of a chromosome are duplicated in one of the two gametes, while the other gamete is left without the corresponding segment, or replication slippage, which is the most common mechanism in the case of microsatellite sequences. The reader is referred to Goldstein and Schlo¨tterer (1999) for an extensive treatment of mutation mechanisms leading to the dispersion of repetitive sequences in the genome. A third mechanism by which genomes may be enlarged is duplicative transposition. Transposable elements are sequences that have an intrinsic capacity to change their genomic location, either by physically moving from one position to another, or by making a copy of themselves that ‘jumps’ to another place in the genome. The mobile element carries its own genes, necessary for catalyzing the transposition (including an enzyme
called transposase), but in addition to these it may also carry genes or non-coding DNA that have nothing to do with the transposition itself and are thus relocated in the genome. There is an enormous variety of such mobile elements in many animal genomes. In Drosophila, one of the transposable elements is the well-known P element. It is assumed that a P element was introduced into D. melanogaster from another Drosophila species by a parasitic mite feeding on the eggs (Hoy 1994). Subsequently, P elements have been exploited by fruit fly geneticists to develop engineered P-element vectors that can introduce exogenous DNA into the germline of the fruit fly. How could the increase of genome size in eukaryotes, and especially the dramatic proliferation of non-coding DNA, be maintained during evolution? Lynch and Conery (2003) have argued that genome complexity evolved mainly by neutral mechanisms, which apply to small populations
COMPARING GENOMES
61
Effective population size × Nucleotide mutation rate (Neµ) (a)
0.04
0.00
Prochlorococcus Tetrahymena thermophila Salmonella enterica Legionella pneumophila Helicobacter pylori Neisseria meningitidis Escherichia coll Vibrio cholerae Enterococcus faecium Cryptococcus neoformans Campylobacter jejuni Cryptosporidium parvum Saccharomyces cerevisiae Chlamydomonas reinhardtii Dictyostelium discoideum Neurospora crassa Streptococcus pyogenes Pseudomonas aeruginosa Giardia lamblia Toxoplasma gondii Trypanosoma cruzi Leishmania donovani Drosophila spp. Encephalitozoon cuniculi Artemia franciscana Zea mays Caenorhabditis spp. Arabidopsis thaliana Ciona intestinalis Silene spp. Crassostrea virginica Anopheles spp. Strongylocentrotus franciscanis Pinus sylvestris Fugu rubripes Hordeum vulgare Plasmodium falciparum Oryza sativa Ficedula spp. Oncorhynchus tshawytscha Pan troglodytes Homo sapiens Mus musculus
0.08
0.50
1.00
Prokaryotes
Unicellular eukaryotes
Invertebrates
Vascular plants Prokaryotes Unicellular eukaryotes Invertebrates
Vertebrates
Vascular plants Vertebrates
Figure 3.4 (a) Effective population size times mutation rate per nucleotide (Nem), plotted for various species. Note that despite the general decreasing trend from prokaryotes to vertebrates, there is some mixing of species across taxonomic categories (e.g. Tetrahymena thermophila is a ciliate but has a value of Nem comparable to bacteria). (b) Nem and gene number as a function of genome size. Note the saturation curve for gene number, which is due to the preponderance of non-genic DNA in large genomes and the very good correlation between Nem and genome size. Reprinted with permission from Lynch and Conery (2003). Copyright 2003 AAAS.
62
INTRODUCTION TO ECOLOGICAL GENOMICS
(b) 105
104
Gene number 103
10–1
Neµ
10–2 10–3 10–4 1
10
100
1000
Genome size (Mb)
composition of the parental generation. In small populations, random genetic drift is the most important factor for changes in gene frequencies. Population genetic theory shows that the effect of drift depends not only on Ne, but also on the mutation rate per nucleotide (m); this is why Lynch and Conery (2003) calculated Nem for every species and correlated this with genome size (Fig. 3.4). According to the theory of Lynch and Conery (2003) there is nothing adaptive in the increase of genome complexity; it can be considered an effect of drift governed by the laws of neutral population genetics. Although this conclusion has been challenged and examples to the contrary have been pointed out (Vinogradov 2004), convincing adaptive explanations for the increase in genome complexity have not been given; the neutralist hypothesis remains the most likely.
Figure 3.4 (Continued.)
3.1.2 more than large populations. The theory is supported by an obvious negative correlation between genome size and effective population size (Fig. 3.4). The effective population size, Ne, is defined in population genetics as the number of individuals of a species in a theoretical ideal population that would have the same magnitude of random genetic drift as an actual population has (Hartl and Clark 1997). Ne is smaller than the real population size for two reasons. First, the actual population fluctuates over time; the effective size is the harmonic mean of abundance over time and so low numbers have a disproportionally large effect on Ne. Second, not all members of the population may actually participate in reproduction and transfer their genes to the next generation. If the sex ratio of the breeding pool departs from unity, for example due to the fact that a few males sire all females and many males have no offspring, this will decrease Ne far below the census population. Population size has a pervasive influence on the genetic structure of a population because small populations are conducive to sampling errors arising from the fact that the genetic material of the offspring generation is a sample from the genetic
Gene families
Limiting the comparison to genes rather than the whole genome, we note that a large number of genes are similar to each other due to their common descent from a duplication event (like the Notch genes in Fig. 3.3). Such genes are said to be paralogous to each other. Genes in different species sharing a common ancestor are called orthologous. These two different types of homology are illustrated in Fig. 3.5. All the paralogous genes in a genome constitute a gene family. Examples of gene families are the globulins, homeobox proteins, esterases, trypsin-like peptidases, G-proteincoupled receptors, cytochrome P450s, and proteins involved in the immune response. After a duplication event, there are four possible scenarios for the fate of duplicates: 1. Both copies remain active with the same function and together produce twice the amount of mRNA that the ancestral gene did before; this situation may be maintained because of the selective advantage of a large amount of gene product. We call this superfunctionalization. 2. One of the copies is silenced by degenerative mutation and the other continues its function. This is called nonfunctionalization.
COMPARING GENOMES
Species 1 A
63
Species 2 B
A’
B’ Speciation
Duplication
Ancestor Figure 3.5 Illustrating the difference between paralogous and orthologous homologies. Genes A and B in species 1 are paralogous to each other, as are A 0 and B 0 in species 2; however, gene A in species 1 and gene A 0 in species 2 are orthologues, as are genes B and B 0 .
3. One copy acquires a new advantageous function and is preserved by natural selection while the other retains the original function (neofunctionalization). 4. Both copies continue to be active but are compromised by deleterious mutations in their regulatory regions to the effect that each gene has a lower expression than the ancestral gene and and both duplicates are required to produce the full complement of functions (subfunctionalization). This situation is also described as duplication– degeneration–complementation (the DDC model). Analysis of the genomic databases for several eukaryotic species has suggested that the vast majority of gene duplications eventually leads to nonfunctionalization; neutral evolution seems to dominate the fate of duplicated genes (Lynch and Conery 2000). Still, many duplicated genes are preserved and the most important mechanism for their survival seems to be subfunctionalization; the Hoxb1 genes in zebrafish closely approach this model (Prince and Pickett 2002). Superfunctionalization is well-known in the case of pesticide resistance in insects where tolerant strains often have duplicated or quadruplicated copies of genes encoding detoxification enzymes (Devonshire and Field 1991). It is assumed that such adaptive gene amplifications contribute significantly to the maintenance of paralogues in the early phase after a duplication (Kondrashev et al. 2002). Neofunctionalization is often considered to be a rare evolutionary pathway, but recent work
by Kellis et al. (2004) has shown that it may be more common than thought previously. Kellis et al. (2004) analyzed the genome of baker’s yeast, Saccharomyces cerevisiae, by comparison with a related fungus, Kluyveromyces waltii, and obtained proof for a whole-genome duplication in the Saccharomyces lineage. Moreover, they could track the various gene pairs and were able to show that in the majority of cases one of the paralogues retained the ancestral function, while the other underwent accelerated evolution. Interestingly, deletion mutations of the ancestral paralogue were often lethal, whereas mutations in the derived copy never were. These data support the neofunctionalization model and suggest that duplication may indeed be a mechanism for creating evolutionary novelty. With many genes present as members of a family, phylogenetic analysis becomes more complicated. Should we include all the genes of a large gene family when comparing them with a set of homologous genes in another species? One possible solution is to limit comparisons to the core proteome: the number of distinct families in each organism, counting a cluster of paralogues as one. Rubin et al. (2000) made a genome-wide comparison of gene families among the three model eukaryotic species, yeast, nematode, and fruit fly, and compared them with the bacterium, H. influenzae (Table 3.2). It is remarkable that Drosophila has a core proteome only twice that of yeast. One would not expect that just doubling the number of genes could make up for
64
INTRODUCTION TO ECOLOGICAL GENOMICS
Table 3.2 Estimated fraction of genes arising through duplication and estimates of the core proteome in three eukaryotes and one prokaryotic organism Species
Total no. of predicted genes
No. of genes duplicated
Percentage of paralogues
Total no. of distinct families
Haemophilus influenzae Saccharomyces cerevisiae Caenorhabditis elegans Drosophila melanogaster
1709 6241 18 424 13 601
284 1858 8971 5536
17 30 49 41
1425 4383 9453 8065
Reprinted with permission from Rubin et al. (2000). Copyright 2000 AAAS.
the increase in complexity associated with multicellularity, the development of a spatially differentiated body plan, the need for communication networks between organs, and the processing of sensory information and locomotion! It is also interesting to note that the core proteome of the nematode is the same size as that of the fruit fly, which again is astonishing given the large differences in development and body plan that exist between the two species. The lesson from this comparison must be that complexity in metazoans is not achieved by sheer number of genes. Instead, it is the regulation of these genes, in place and time and in response to the environment, added to the way they are organized in networks, that determines the differences between the species.
3.1.3
Skew, GC content, and codon usage
Turning our attention from genes to nucleotides, we will now explore patterns of the genomic occurrence of the four bases, adenine (A), guanine (G), thymidine (T), and cytosine (C). Obviously, A, G, T, and C are not distributed randomly in a DNA molecule. For the moment, disregarding the sequence itself, we will discuss two quantities in which deviations from random occurrence are expressed, GC skew and GC content. If there is no mutation bias between the two strands of a DNA molecule, the orientation of any base pair with respect to the leading and lagging strand is arbitrary and one expects that the number of As on a strand will be equal to the number of Ts; the same is expected for G and C. However, in practice deviations are seen, especially in bacterial
genomes. The bias is expressed in a quantity called GC skew (SGC), which is defined as: SGC ¼
fG fC fG þ fC
where fG is the frequency of G and fC the frequency of C in a certain segment (window) of DNA. SAT is defined in an analogous way. The expected value of SGC when the frequencies of G and C are the same is zero. Lobry (1996) found that GC skew showed a consistent switch across the origin of replication in three bacterial genomes, from a negative value (bias towards C) leftward of the origin of replication, to a positive value (bias towards G) rightward of the origin. This was confirmed by Blattner et al. (1997) when the genome of E. coli was completely sequenced (Fig. 3.6). The most likely explanation for skew is mutational bias associated with DNA replication; that is, in some way or another the way in which the leading and lagging strands are replicated causes the leading strand to become more rich in G. This interpretation is supported by the fact that GC skew is most prominent in intergenic positions and third codon positions (Fig. 3.6), where selective pressure is relaxed compared to the first and second codon positions. That the leading and lagging strands of prokaryotic DNA can differ in mutation rate was confirmed by Tillier and Collins (2000), who showed that sequences of the same gene can vary depending on their orientation in the genome; that is, whether they are encoded in the leading or the lagging strand. Another phenomenon that characterizes many genomes is bias in GC base pairs over AT base pairs. This bias is valid for different segments of a
COMPARING GENOMES
65
1st position 2nd position 3rd position All positions Leftward genes Intergenic Rightward genes Terminus 0
1 000 000
Origin
2 000 000 3 000 000 Position (bp)
4 000 000
Figure 3.6 GC skew over the entire genome of E. coli, expressed as (fG fC) / (fG þ fC) in 10 kbp windows of the genome, drawn in linear representation (in fact, the molecule is circular). GC skew is plotted separately for the three codon positions, for leftward genes, rightward genes, and non-protein coding regions. A negative value (below the line) indicates bias towards C, and a positive value means bias towards G. The two vertical lines indicate the origin of replication (right) and terminus of replication (left). Reprinted with permission from Blattner et al. (1997). Copyright 1997 AAAS.
chromosome, between coding and non-coding DNA, and across species. In the majority of cases, the GC content in coding regions of the DNA is higher than in flanking regions of a gene. The 5 0 flanking region tends to be more GC-rich than the 3 0 flanking region, which is due to the fact that promoter sequences tend to be relatively rich in GC. The GC content is also biased over longer stretches of DNA (around 300 kbp). Pieces of DNA with similar GC content are called isochores. This term refers to fractions of equal density obtained when DNA is subjected to CsCl gradient ultracentrifugation. When mammalian DNA is sheared mechanically it tends to fall apart into fragments belonging to five discrete families, called L1, L2, H1, H2, and H3, each with a different GC contents (PGC; Bernardi 2000). The GC-poor families L1 and L2 (PGC < 44%) are poor in genes, whereas the GC-rich families H1 (44 PGC < 47), H2 (47 PGC < 52), and H3 (PGC 52%) are increasingly rich in genes. The human genome consists of a mosaic of such isochores (Fig. 3.7) and the same holds for other mammals. The distribution of isochores is correlated with the banding pattern of metaphase chromosomes seen in microscopic preparations using fluorescent dyes. The short isochores may indicate so-called CpG islands, GC-rich stretches of DNA of at least 200 bp with
an overrepresentation of GC dinucleotide repeats (the p in CpG indicates that it is a dinucleotide, not a base pair). Such CpG islands are indicative of genes that are switched on frequently. In invertebrates and plants there is less heterogeneity of GC content in the genome; very long isochores are observed in the centre of chromosome I in Arabidopsis and in the centre of chromosome III of C. elegans (Fig. 3.7). There is no correlation between gene density and GC content in the C. elegans genome; however, in Drosophila there is such a correlation, which is consistent with the greater variability of GC content over the genome (Oliver et al. 2001). In addition to variation along the chromosome, there are also conspicious differences between species in GC content. The GC content of Bacteria and Archaea varies between 25 and 75%, depending on the species, whereas the GC content of eukaryotes varies within a much smaller range, between 40 and 55%. GC contents in coding regions of the DNA are now known for more than 20 000 species; a database, fed by GenBank sequences for full-length proteins, is maintained by Nakamura et al. (2000). Table 3.3 lists some examples of GC content taken from this database. There is no good explanation why the GC content of a genome should vary between species.
66
INTRODUCTION TO ECOLOGICAL GENOMICS
60 50 40 Human XXI 30
0.0
6.0 × 106
1.2 × 107
1.8 × 107
2.4 × 107
3.0 × 107
60 50 40 Human XXII 30
0.0
5.0 × 106
1.0 × 107
1.5 × 107
2.0 × 107
GC content (%)
60 Drosophila 3R
50 40 30
0.0
5.0 × 106
1.0 × 107
1.5 × 107
2.0 × 107
2.5 × 107
60 50 40 C.elegans III 30
0.0
3.0 × 106
6.0 × 106
9.0 × 106
1.2 × 107
60 50 40 Arabidopsis II 30
0.0
5.0 × 106
1.0 × 107
1.5 × 107
2.0 × 107
60 50 40 Yeast III 30
0.0
6.0 × 104
1.2 × 105
1.8 × 105
2.4 × 105
3.0 × 105
60 50 40 Yeast IV 30
0.0
4.0 × 105
8.0 × 105
1.2 × 105
1.6 × 105
Sequence position (bp)
Figure 3.7 Isochore maps of some eukaryotic chromosomes, calculated from the genomic databases with an improved ‘compositional segmentation’ algorithm. For human chromosomes XXI and XXII the largest available contigs were taken. Note that there is much more structure in the human and fruit fly genomes, indicating variable gene density along the chromosome, than in the C. elegans, Arabidopsis, and yeast genomes, indicating a more even spread of genes. After Oliver et al. (2001), with permission from Elsevier.
COMPARING GENOMES
67
Table 3.3 GC contents of coding regions of genomes of some selected species from the three domains of life Species
GC (%) Overall
First codon position
Second codon position
Third codon position
Archaea Methanococcus maripaludis Halobacterium salinarum Thermoplasma acidophilum Sulfolobus solfataricus Pyrococcus furiosus
34.08 64.85 47.37 36.49 31.09
44.70 68.07 49.55 43.22 49.46
32.29 43.04 37.55 33.65 34.56
25.26 83.45 55.02 32.59 39.24
Bacteria Sinorhizobium meliloti Escherichia coli Leptospira interrogans Actinomyces naeslundi Thermotoga maritima
63.14 51.39 36.42 67.51 46.40
64.88 58.27 44.70 63.74 52.24
45.23 40.84 34.62 49.50 34.40
79.30 55.06 29.94 89.27 52.55
Eukarya Saccharomyces cerevisiae (budding yeast) Caenorhabditis elegans (roundworm) Arabidopsis thaliana (thale cress) Drosophila melanogaster (fruit fly) Fundulus heteroclitus (mummichog fish) Danio rerio (zebrafish) Xenopus laevis (clawed frog) Vipera aspis (aspis viper) Anas platyrhynchos (mallard duck) Sus scrofa (wild pig)
39.76 42.93 44.60 53.97 53.93 50.94 46.97 52.20 51.27 54.44
44.60 49.95 50.90 55.87 55.10 54.50 52.75 44.05 53.89 56.26
36.61 38.93 40.52 41.51 40.89 40.82 39.94 43.17 41.16 41.81
38.09 39.90 42.37 64.52 65.81 57.52 48.22 69.38 58.78 65.25
Source: Data from www.kazusa.or.jp/codon (Nakamura et al. 2000).
One of the forces acting upon the GC content is asymmetry in substitution rates. If the rate of substitution from G/C to A/T is denoted as u and the rate of substitution from A/T to G/C as v, then the equilibrium content of GC is expected to take the value PGC, where (Graur and Li 2000) PGC ¼
v uþv
If the two rates are equal, PGC is expected to be 1/2, or 50%. A high GC ratio is evidence for v being larger than u. The asymmetry of substitutions is called GC mutational pressure. However, GC content is not only shaped by mutation, but to some extent also by selection. One of the selective constraints arises from codon usage. We know that several amino acids are encoded in the DNA by
more than one triplet, but this does not imply that all possible triplets are used in proportion. In most amino acids there is a bias towards the use of certain codons because the tRNAs of these codons are more abundant (codon usage bias, see Section 2.2). Depending on the number of Gs in the preferred codon, selection can constrain the GC content. Another source of selection is due to the superior stability of the G–C bond, which uses three hydrogen bridges, whereas the A–T bond uses two. It has been argued by several researchers that high ambient temperatures would favour high GC contents and that endothermic (‘warm blooded’) animals (birds and mammals) would have higher GC contents than ectothermic (‘cold-blooded’) animals (most reptiles, amphibians, fish, and invertebrates).
68
INTRODUCTION TO ECOLOGICAL GENOMICS
If selection is a major factor influencing the GC content and if GC mutational pressure drives the GC content upwards, one would expect that PGC is higher in the third codon positions of a proteinencoding gene, compared with the first and second positions. There is some evidence that this is indeed the case both for prokaryotes and eukaryotes (Table 3.3); however, whether this is indeed indicative of selection is questionable; bias introduced by mobile elements with a high GC content is usually ignored (Duret and Hurst 2001). The possible role of temperature stability in the evolution of GC content was critically examined by Hughes (1999) and he concluded that the hypothesis is not supported strongly by the data. Among thermophilic prokaryotes there are species with low and high GC contents and within the vertebrates the picture is also not consistent (Table 3.3). The strongest effect in the GC content seems to stem from phylogenetic constraints: taxonomically related species tend to have similar GC contents. Although purifying selection may play a modest role, the dominant factors acting upon GC content seem to be neutral processes, GC mutational pressure, and random drift.
3.1.4
Gene order
In genetics, two loci are called syntenic if they are located on the same chromosome (Russell 2002). In genomics, however, the term synteny is used to indicate a situation where a series of genes is arranged in the same order on different genomes (Gibson and Muse 2002). Passarge et al. (1999) have rightly pointed out that this new usage is incorrect and etymologically awkward. Another term that may be more appropriate is colinearity; however, in this book we will comply with the most common usage and use synteny in the genomics understanding. The presence of synteny between two genomes is somewhat dependent on the scale of analysis. On the level of the chromosomes, synteny may be demonstrated by techniques such as chromosome painting (using inter-species fluorescent in situ hybridization); however, this does not exclude the presence of extensive rearrangements on the level of individual genes. The term microsynteny
is used to indicate detailed sequence comparions between individual genes within a chromosomal segment. In any genome, genes are found to be organized in clusters and these clusters sometimes maintain the same order across species, even across groups as far apart as mammals and fish. Well-known examples of synteny are histone genes, Hox gene clusters, and the genes of the major histocompatibility complex (MHC). There are also large synteny blocks, covering hundreds of kilobase pairs, between the genomes of rice and Arabidopsis (see Section 3.2). The Hox genes are a famous example of longrange synteny. Indeed, the same order of genes can be found in the Hox clusters of nematodes, insects, and mammals. Hox genes encode transcription factors that regulate developmental patterns across the anterior-posterior axis of bilaterian animals (Carroll et al. 2005). Macro-evolutionary relationships in the animal kingdom can be partly understood as duplications followed by neo- and nonfunctionalization of essentially the same pattern of Hox genes (Amores et al. 1998; Carroll 2000). Synteny analysis is an important tool in comparative genomics. The relative order of genes in one species can provide clues about the presence or even the function of genes in another species. Similarly, by looking at the order of genes in a cluster one can discover genes by homology to another species that were missed by automatic gene-finding algorithms. Synteny analysis can also be a tool to reveal duplications across species, for example by searching two regions in one genome that have the same gene order as one region in another genome (doubly conserved synteny; Kellis et al. 2004). How could such blocks of gene order be maintained while other regions of the genome are reshuffled extensively by recombination? How can it be that some genes are free to move through the genome while others are tied, for millions of years, to the same neighbours? One of the reasons could be selective pressure acting upon the cluster as an integrated whole. This is certainly the case if genes are organized in operons, as in all prokaryotic and some eukaryotic genomes (see Sections 3.2 and 3.3).
COMPARING GENOMES
annotated, the genome of Brugia is only known incompletely; the comparison was undertaken partly to reveal more of the function of genes in Brugia from knowledge of C. elegans. Figure 3.8
Brugia malayi Scale (kb) 80
70
BMBAC01P19
Predicted genes 01P19.7
01P19.6 01P19.5 Bm-ubr-1 01P19.4 Bm-dap-1
60
01P19.2 Bm-pbr-1
Caenorhabditis elegans Per cent identity 59% 41% 29% 30%
34%
Predicted genes C36B1.12
F31C3.5 T28F4.4 T28F4.5
C26C6.1
50
40
01P19.1 Bm-mif-1
23%
F13G3.9 Ce-mif-3
30
20
01P19.3
44% 58%
F43G9.4 F43G9.3
01L03.5
86%
F43G9.5
01L03.4 10
BMBAC01L03
Another functional constraint is illustrated by the Hox genes. In most animals, the order of these genes along the chromosome is the same as the order of their expression domains along the anteriorposterior body axis. In addition, the genes at the front end of the complex are expressed earlier in development than the ones at the back end. These observations suggest that it is the requirement for coherent temporal expression that is maintaining colinearity of the Hox cluster (Patel 2004). The genetic developmental system that governs the basic positional information of tissues in all animals was called the zootype (Slack et al. 1993). Another reason for conservation of gene order, proposed more recently, is interdigitization of regulatory elements. We know that the expression of genes is controlled by regulatory elements, usually in the 5 0 region of the gene. It turns out that some regulatory elements may be physically linked to genes close by, or even be located in the introns of other genes. The fixation of regulatory elements inside the territory of neighbouring genes thus forges a physical bond resulting in close linkage between the genes. Another way in which regulatory elements may link genes together occurs when the expression of a group of genes is controlled by a single locus-control region. The principle of the locus-control region was first discovered in the b-globulin cluster of the human genome, but similar regions, presumably participating in dynamic chromatin alteration, have now been found in other gene clusters. In all these cases genes cannot move independently from each other without gaining a severe selective disadvantage. The shuffling and reorganization of the genome during evolution, as highlighted in Chapter 1 and indicated by the term turbulence, is inevitably limited to some extent by such processes. An example of synteny analysis is provided by a comparison between two distantly related species of nematode, sharing a common ancestor 300–500 million years ago (Guiliano et al. 2003). A nematode parasite of vertebrates, Brugia malayi (order Ascarida), was compared with the well-known model species C. elegans (order Rhabditida). Whereas the genome of the latter species is completely known and many genes are
69
57%
F39B2.10
01L03.3 01L03.2 01L03.1
58%
F14B4.3
Figure 3.8 Synteny between two distantly related species of nematode, Brugia malayi and Caenorhabditis elegans. An alignment is shown of two overlapping contigs from a genomic library of Brugia (BMBAC01P19 and BMBAC01L03) with the C. elegans genome. Exons of genes are indicated by boxes, with brackets between them to indicate introns. Genes are designated by code names from top to bottom (01P19.7, etc.), but have different codes in the different species. The direction of transcription is indicated for each gene by a vertical arrow. The horizontal arrows indicate matches of putative B. malayi genes in the C. elegans genome. From Guiliano et al. (2003), by permission of BioMed Central.
70
INTRODUCTION TO ECOLOGICAL GENOMICS
shows an alignment of two overlapping contigs of B. malayi with a homologous portion of the genome of C. elegans. Eleven putative Brugia genes in this region can be homologized to genes in the C. elegans genome and, except for one case, the order of the genes is the same in the two species; in two cases the direction of transcription was reversed. Although earlier comparisons between two related species, Caenorhabditis briggsae and C. elegans, had shown that nematodes have a high rate of intrachromosomal rearrangement, the present observations demonstrate that there may still be local clusters of synteny across relatively large phylogenetic distances. To explain this, Guilliano et al. (2003) could not identify a common function for the gene cluster but suggested that promoters or cis-acting regulatory elements could be embedded within other cluster members, so synteny could be maintained by interdigitization of regulatory sequences.
3.1.5 Patterns of synonymous and nonsynonymous substitutions Spontaneous mutations in the genome are the primary source of all genetic variation. This section discusses the different types of mutation that can occur in the genome and what effect they may have on adaptive evolution of the organism. We show that genomics tools have facilitated new and accurate estimations of mutation rates and their effects on phenotypic change. Basically, DNA can mutate in four ways: substitution, deletion, insertion, and inversion. Substitution is the change of a nucleotide for another and is generally caused by errors in DNA replication. Substitutions can be divided into two classes: transitions and transversions. A transition is the change of a purine into another purine (A/G) or of a pyrimidine into another pyrimidine (C/T). Change from a purine to a pyrimidine or vice versa is called a transversion. If a substitution causes a nucleotide site to become polymorphic we call this site a single nucleotide polymorphism (SNP, pronounced snip). If substitutions take place in coding regions they can either be synonymous or nonsynonymous. A synonymous substitution does
not change the amino acid sequence of the encoded protein and is called silent. Nonsynonymous substitutions do change the amino acid composition of the encoded protein. Finally, substitution can result in a stop codon, which is called a nonsense mutation. If we look closely at the properties of the genetic code we can conclude that synonymous substitutions occur at the third codon position. Most (but not all) substitutions at the first codon position cause an amino acid replacement and all nucleotide substitutions at the second codon position cause either an amino acid replacement or a nonsense mutation. Substitutions and the resulting SNPs are scattered randomly throughout the genome with a higher abundance in non-coding regions. The distribution of SNPs is a welcome source for high-density mapping studies in genomic model organisms (see the example discussed at the end of Section 2.1). Insertions and deletions (indels) involve a variable number of nucleotides ranging from one base to large blocks of DNA. They occur at quite high frequency in non-coding regions of the genome. The main source of small indels is again errors in DNA replication, whereas large indels seem to be caused by unequal crossing-over and transposition. Transposons or transposable elements cause DNA segments to change chromosomal position thereby generating indels. Unequal crossing-over is believed to be very important in the generation of multigene families such as rRNA genes. Measuring mutation rates is extremely difficult, because the frequency of mutation within each generation is very low. The traditional way to study genomic mutation rate is to perform mutation accumulation (MA) experiments. The standard way to design such an experiment is described very well by Keightley and Charlesworth (2005) and may be outlined as follows. An isogenic line from the organism of interest is taken as the inbred progenitor, and is subdivided into several MA lines. Going through several generations of inbreeding (selfing or full-sib mating) these lines accumulate mutations at random, causing divergence at the phenotypic as well as the DNA level. One or a few individuals from each generation are isolated to form the next generation so that the
COMPARING GENOMES
potential role of selection is diminished. The inbred progenitor population is considered to be mutation-free and should be preserved in that state. The mean fitness of all MA lines is estimated at generation time t. Also, the mean fitness of the mutation-free population can be inferred. The first parameter of interest is the change in mean fitness per generation that is due to MA (DM). Secondly, we can estimate the increase in genetic variance in fitness among inbred lines per generation (Vm). If we assume that the average deleterious effects of mutation (s) are equal, then DM ¼ Uds, where Ud is the genomic rate for mutations affecting fitness per generation. Furthermore, Keightley and EyreWalker (1999) showed that Vm ¼ Uds2, so that Ud can be estimated from the formula: Ud ¼ DM2/Vm. A lot of this work on MA has been performed using D. melanogaster as a model organism, but data are also available for C. elegans, E. coli, and humans. Keightley and Eyre Walker (1999) showed that Ud estimates vary greatly, ranging from 0.00017 in E. coli to 0.47 in humans. In D. melanogaster several Ud values have been estimated in different studies and these data vary over an order of magnitude (0.02–0.47), whereas the effect of deleterious mutations was estimated at 3%. We have to conclude that these figures are not very reliable and probably underestimate the actual mutation rate in a genome. The method only detects mutations of moderate effect that change phenotypic traits, whereas mutations with very small effects and mutations caused by transposon activity are not recognized. The problems associated with mutation-rate estimates based on phenotypic traits were overcome in a study on C. elegans by Denver et al. (2004). These authors applied a genomics approach that provides a direct estimate of mutation rate in DNA sequences from a set of MA lines. Some 4 Mbp of randomly selected DNA segments was sequenced directly from a set of MA lines after t ¼ 280, 353, and 396 generations. A per-nucleotide mutation rate can be determined from the sequence data, which can be used to calculate a haploid genomic mutation rate Ut per generation. Denver et al. (2004) detected 30 mutations, which translates to a mutation rate of 2.1 108
71
mutations per site per generation and a Ut value of approx. 2.1 mutations per genome per generation. Surprisingly, the direct estimates of Denver et al. (2004) are at least 10 times higher than previous estimates (Drake et al. 1998). Furthermore, 17 of the 30 observed mutations were indel mutations, and 13 of these 17 indels were insertions. How can these high mutation rates and the predominance of insertions be explained? Denver et al. (2004) suggested that their study was less biased by genetic selection than previous studies. It seems that pseudogenes, on which earlier studies were based, do not evolve neutrally but may be under selection (Hirotsune et al. 2003). Alternatively, Rosenberg and Hastings (2004) propose that phenotypes are masking molecular variation in such a way that mutation rates are higher than predicted. They also propose that accumulation of harmful mutations in MA lines can induce increased mutability. Harmful mutations will cause cellular stress, and in response to that stress mutation rates may increase. However, Keightley and Charlesworth (2005) state that this mutator state is unlikely, because such a genetically unstable state would induce a rapid decline of fitness, and this was not observed. It remains difficult to make generalizations about mutation rates in organisms. The genomic data on direct mutation-rate estimates generated by Denver et al. (2004) raise new questions, for instance on how their data on C. elegans relate to earlier estimates in Drosophila. As proposed by Keightley and Charlesworth (2005), it may be worthwhile to repeat the Denver approach in Drosophila. If DNA sequences of the same gene from two individuals or from two species are aligned, differences are often observed. As discussed above most of these differences do not result in differences in the amino acid sequence of the encoded proteins, but some do. The extent to which differences between two sequences imply differences in amino acid composition is measured by the Ka/Ks ratio, defined by Hurst (2002) as the ratio between the number of nonsynonymous substitutions per synonymous site (Ka) to the number of synonymous substitutions per synonymous site
72
INTRODUCTION TO ECOLOGICAL GENOMICS
(Ks) in a specific segment (window) of DNA sequence. This ratio is also designated the dn/ds ratio, where dn is comparable to Ka and ds comparable to Ks. The rate of synonymous substitutions (Ks) is often equated to neutral mutation rate of the gene, whereas Ka indicates the amount of protein evolution (mostly functional). The Ka/Ks ratio of a certain sequence therefore tells us something about how that sequence has evolved. Usually Ka is much smaller than Ks, because a change in the amino acid is less likely than a silent substitution. This is due to the fact that selection eliminates deleterious mutations to keep the function of a protein intact. Under purifying selection, Ka/Ks < 1, approaching 0 for complete conservation. However, sometimes Ka is greater than Ks, for instance in genes associated with the immune system that are co-evolving with parasites (Nei et al. 1997). Ka/Ks > 1 indicates selection acting positively on protein change in one sequence compared to the other. Yang and Bielawski (2000) evaluated two ways for measuring molecular adaptation. The first class is based on intuition; the method of Nei and Gojobori (1986) is best known. Synonymous and nonsynonymous sites and synonymous and nonsynonymous differences are counted between two sequences. Subsequently, the synonymous and nonsynonymous rates are corrected for multiple substitutions at the same site using simplistic assumptions to yield estimated Ka and Ks values. Nei and Gojobori (1986) assume equal rates of transition (T to C, A to G, and vice versa) and transversion (T or C to A or G and vice versa), and uniform codon usage. However, this method yields incorrect estimates of Ka and Ks because the assumptions have been proven to be unrealistic. The method tends to perform especially poorly when codon usage is biased due to differences in translation efficiency (genes that have a high transcription/translation rate are biased in their codon usage as compared to genes that are transcribed/translated at a low rate). A more reliable class of methods was developed using the principle of maximum likelihood. The codon is considered to be the unit of selection, and a model is developed for substitutions in the
codon. Parameters in the model are, for instance, sequence divergence, transition/transversion rate ratio, and Ka/Ks ratio; these parameters are estimated from sequence comparisons by applying the maximum-likelihood principle. Parameters also are corrected for biased codon usage. An important feature of these methods is that a statistical test can be applied to test whether the Ka/Ks ratio is significantly different from unity (neutral evolution). Several software packages have been developed to study molecular adaptation using the Ka/Ks ratio. As an example, we discuss a study by Talbert et al. (2005), who analysed adaptive evolution in genes encoding centromere-binding protein C (CENP-C). Centromere-binding proteins play an important role in fixing microtubules to the centromeric region of a chromosome, which is essential in the formation of spindles during mitosis and meiosis. It is remarkable that the centromere has such a conserved function, although its DNA sequence is non-coding and highly variable. The centromere-binding proteins seem to co-evolve with the rapidly changing satellite DNA sequences in the centromere. Talbert et al. (2005) screened the sequences of Cenpc genes in pairs of related species and applied a Ka/Ks analysis to locate regions of selection (Fig. 3.9). Statistically significant selection was detected in the regions encoding DNAbinding domains. Mammals showed stretches of positive selection, whereas negative selection seemed to be more pronounced in maize and sorghum in the comparable region. Why the centromere and consequently the centromere-binding proteins would evolve so rapidly is not known. Talbert et al. (2005) propose a model in which there is competition between centromere variants during female meiosis. The female meiotic spindle has an asymmetric shape, such that the ‘stronger’ centromere variants may be better captured and included in the meiotic product that becomes the egg nucleus. Such biased inheritance has also been described for other loci, especially in Drosophila, and is known among geneticists as segregation distortion or meiotic drive. According to Talbert et al. (2005) meiotic drive can explain the apparent selection on DNA-binding centromere proteins.
COMPARING GENOMES
(b)
(a) + –
6
1
2 3 4 5
78
9
10 11 + –
3.5 3
5
Ks Ka Ka/Ks
2.5
Ks Ka/Ks
4
2
3
1.5
2
1
1
0.5
0
18 62 10 6 15 0 19 4 23 8 28 2 32 6 37 0 41 4 45 8 50 2 54 7 59 1 63 5 67 9
17 79 13 4 19 1 24 6 30 5 36 0 41 5 47 0 52 5 58 4 63 9 69 4 74 9 80 4 85 9
0 Codon position (Arabidopsis. spp.)
Codon position (rat and mouse) (d)
(c) 1
2 3 4 5
6
7 8 9 10 1112 13 14
9p
+ –
17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0
10p
9q
10q
11
12
13
14
+ –
3 2.5 Ks Ka/Ks
2 Ks Ka/Ks
1.5 1 0.5
Codon position (maize and sorghum bicolor )
14 9 17 1 19 3 21 5 23 7
83 10 5 12 7
39 61
17
5 36 9 41 7 46 2 51 7 56 1 60 5 64 9
1
32
7
28
3
23
9
19
14
10
5
0 61
17
6
73
Codon position (wheat and barley)
Figure 3.9 Patterns of variation between pairs of related species across the sequence of centromere-binding protein C (Cenpc ) genes displayed using a sliding window analysis of Ka/Ks ratios. Each point represents the value of Ka/Ks for a 99-nucleotide (33-codon) window plotted against the codon position of the midpoint of the window. The aligned coding sequence is plotted at the top of each graph. On the sequences, the black rectangles indicate the locations of 24-amino acid CENP-C motifs, the defining structure of this type of protein. Exons are indicated by numbers for the plant sequences. Beneath the sequences regions of positive (black bars) and negative (grey bars) selection are indicated. (a) Rat and mouse, (b) A. thaliana and Arabidopsis arenosa, (c) maize and Sorghum bicolor, and (d) wheat and barley, exons 9p–14. From Talbert et al. (2004), by permission of BioMed Central.
Another example of the use of the Ka/Ks ratio is illustrated by Liberles et al. (2001), who studied adaptive evolution of amino acids at the genomic level. They calculated Ka/Ks values on nodes of branches within evolutionary lineages. The evolutionary lineages were taken from the Master
Catalog, a compilation of sequence alignments and evolutionary trees for all protein modules encoded by genes in Genbank, constructed by Benner et al. (2000). They focused on subtrees containing only chordates and Embryophyta (mosses, ferns, and higher plants) and could identify branches with
74
INTRODUCTION TO ECOLOGICAL GENOMICS
high Ka/Ks values. These branches may be indicative of positive selection, where the mutated protein has a higher fitness than the ancestral form, probably associated with a change in function. The gene families that display high Ka/Ks values were stored in The Adaptive Evolution Database (TAED). Currently, TAED 2.1 (www. bioinfo.no/tools/TAED) contains 6657 families that are fully processed. In 10–20% of these families positive selection was determined in at least one branch. High Ka/Ks values on branch points in evolutionary protein trees may be caused by gene amplification followed by differentiation in function of the paralogues. Orthologous genes under different selective regimes in different species may also be found. However, the database cannot distinguish between paralogues and orthologues, so the results should be interpreted cautiously. Besides gene families that were identified previously to be under positive selection, such as the MHC proteins (proteins of the adaptive immune system), quite a number of families were newly identified in TAED to have undergone change in function. The authors conclude that TAED is a useful resource for biologists searching for potential examples of molecular adaptation as a starting point for further experimental study. We can conclude that the use of Ka/Ks ratios for measuring molecular adaptation in coding sequences of the genome is a very effective approach. We expect that databases like TAED will become an important framework for ecological genomics to study adaptation at the molecular level. The challenge will be to integrate this information with gene-expression profiling and to link molecular variation to phenotypic differences between related species.
3.2
Prokaryotic genomes
The genomes of prokaryotes typically consist of one circular molecule, representing a haploid genome, characterized by an origin of replication and two semicircles of sequence that are read leftward and rightward, with the terminus of replication positioned on the opposite side of the molecule. The origin of replication is a stretch of
200–300 bp that has characteristic sequences allowing DNA unwinding and binding of the initiator protein DnaA. The genes in prokaryotic genomes are organized in operons, clusters of genes, the expressions of which are regulated jointly by interactions between operator and repressor proteins (see Fig. 4.9). The structural genes in an operon are transcribed into a single polygenic mRNA. The situation that an mRNA molecule contains protein-coding sequences from more than one gene (cistron) is called polycistronic. It was long thought that polycistronic transcription was limited to prokaryotes and that all eukaryotic mRNAs were monocistronic; however, it turned out in 1994 that the nematode C. elegans has approximately 25% of its genes organized in polycistronic units of two or more members (Hodgkin et al. 1995), so polygenic transcription is not exclusive to prokaryotes. The genes in a microbial genome are usually subdivided into two main classes: informational genes and operational genes. In the first category (also called essential genes) are genes related to information processing, such as transcription, translation, replication, etc. These genes define the ‘essence’ of the species. They are usually large, complex systems, with many interactions, located on the main chromosome of the cell and less prone to lateral gene transfer (see below). The second category includes genes that function in basic cell maintenance processes and metabolism, such as protein, energy metabolism, and phospholipid acid biosynthesis. These genes are usually members of small assemblies of a few gene products and more often found on plasmids.
3.2.1
Chromosomes and plasmids
As an example of the architecture of a prokaryote genome we reproduce in Fig. 3.10 the sequence of H. influenzae, published by Fleischmann et al. (1995). The figure summarizes some general aspects of the sequence and provides a great deal of information on restriction sites, arrangement of gene clusters, GC content, tandem repeats, etc. The relatively small prokaryotic genomes are the only ones for which this information can be reproduced
COMPARING GENOMES
SmaI 1 SmaI NotI 1800000 SmaI 1700000
75
100000 RsrII SmaI 200000 SmaI SmaI SmaI
1600000 SmaI SmaI RsrII
300000 RsrII
1500000
400000 1400000 SmaI 500000 1300000
600000 SmaI
SmaI 1200000
SmaI SmaI 700000
1100000 SmaI 1000000
RsrII
SmaI SmaI 800000 900000
Figure 3.10 Circular representation of the annotated genome of H. influenzae, as published by Fleischmann et al. (1995). Its characteristics are indicated by four concentric circles and rings. Outer perimeter, restriction sites. The NotI restriction site occurs only once and was arbitrarily chosen as the site at which to begin the clockwise numbering of base pairs (top of the figure). Outer ring, locations of genes that could be assigned a role. In the original paper genes were classified according to 16 different functions, which in this figure are represented by different grey tones. Second ring, regions of high GC content (grey) and high AT content (black). Third concentric circle, locations of six ribosomal operons (extended markers), tRNAs (short markers), and a cryptic m-like prophage (black box). Fourth (inner) circle, locations of simple tandem repeats. The origin of replication is indicated by two outward-pointing arrows near base pair no. 603 000. Two potential termination sites are indicated near the opposite midpoint of the inner circle. Reprinted with permission from Fleishmann et al. (1995). Copyright 1995 AAAS.
in a still more-or-less readable figure, using 16 different colours to indicate various functional details (colour-blind people are at a real disadvantage in genomics!). An analysis of the functional categories of these genes allows some first insight into the functions that can and cannot be performed by the organism. For example, the genome of H. influenzae has a complete metabolic machinery required for survival and reproduction as a free-living organism, but it lacks genes such as
the fimbrial gene cluster that encodes proteins allowing the bacterium to attach to host cells. This is explained by the fact that the sequenced strain is not pathogenic. The sequence also includes a cryptic m-like prophage, which is a segment resembling the DNA of bacteriophage m. We will see below that many bacterial and archaeal genomes contain genetic material from bacteriophage origin. A bacteriophage that is ‘sitting’ in its host genome, being replicated with the chromosome of
76
INTRODUCTION TO ECOLOGICAL GENOMICS
the host and waiting to become active, is called a prophage. In some cases these prophage sequences become debilitated and are no longer functional but are still recognizable in the genome. Although the single circular chromosome is the most common genome organization among prokaryotes, an increasing number of exceptions to this are being identified. In addition to circular chromosomes, many prokaryotes have smaller circular DNA molecules, called plasmids. The classical example of a bacterial plasmid is the F-plasmid of E. coli, which is transferred from a donor (F þ cell) to a recipient (F cell) during conjugation. The F-plasmid carries genes associated with the formation of F-pili, hair-like surface structures which allow the physical union between the F þ and F mating types. BACs, an extremely important class of cloning vector (see Section 2.2), were modelled after F-plasmids and use the F-plasmid’s origin of replication. Like the F-plasmid, many bacterial plasmids contain genes dedicated towards specific, so-called non-essential, functions. These functions may relate to antibiotic resistance, pathogenicity, or specialized metabolic pathways. In Agrobacterium tumefaciens (Alphaproteobacteria), one of the plasmids carries a discrete set of genes (transforming DNA, or T-DNA) that can be transferred to a plant host and, when expressed in the host, promote the synthesis of plant growth hormones that redirect the local development of plant tissue to form a gall. In the gall, the bacterium also directs the plant to produce specific amino acid derivatives (opines) that can be used as the sole carbon and nitrogen source for Agrobacterium. The transfer of the T-DNA and its integration in the chromosome of the host is supported by proteins encoded in virulence (vir) genes, which are also on the plasmid. The plasmid is thus specialized for gallformation and is therefore called a tumor-inducing plasmid or Ti plasmid. The capacity of the Ti plasmid of A. tumefaciens to introduce foreign DNA into a host has been widely exploited by plant molecular biologists to artificially transform plants. A similar specialized function located on a plasmid is present in the symbiotic nitrogen-fixing
soil bacterium Sinorhizobium meliloti. This bacterium belongs to a group of three closely related Alphaproteobacteria of the family Rhizobiaceae that now have been sequenced completely (S. meloti, Mesorhizobium loti, and A. tumefaciens; Galibert et al. 2001; Goodner et al. 2001; Wood et al. 2001). S. meloti is a symbiont of alfalfa (Medicago sativa) and because of the profound ecological importance of symbiotic nitrogen fixation in the global nitrogen cycle, genomic studies of these types of bacteria are particularly relevant for ecological genomics. Fig. 3.11 shows the position of the three Rhizobiaceae in relation to some other bacteria from the protobacterial lineages with fully sequenced genomes. The plasmid of S. meliloti which carries most of the symbiotic functions is called SymA or symbiotic plasmid. An extensive annotation of gene functions of this large plasmid (1354 kbp, comparable in size to an entire prokaryotic genome!) was published by Barnett et al. (2001). Specific nodulation (nod) genes on the plasmid encode biosynthetic enzymes for the so-called Nod factors, molecules which are active in very low concentrations (down to 1012 M) in the signalling between plants and rhizobia in the early stages of root-nodule formation. The expression of Nod genes is triggered, via a signal transduction pathway, by phenolic compounds excreted by plant roots. The plasmid also carries several genes encoding enzymes necessary for nitrogen fixation, denitrification, and opine metabolism, and many genes involved with transport and osmotic stress. It is interesting to note that no informational genes, for example relating to DNA replication or cell division, were found on pSymA, demonstrating that despite its size, it is a true plasmid. In addition to circular chromosomes and plasmids, some bacteria also have linear chromosomes. A particularly complicated situation is present in the genome of A. tumefaciens, which was published by Wood et al. (2001) and Goodner et al. (2001). It consists of one circular chromosome (2.8 Mbp), one linear chromosome (2.1 Mbp), and two plasmids, which in this case are called megaplasmids because they are relatively large (543 and 214 kbp). The smaller of the two plasmids is the Ti plasmid
COMPARING GENOMES
77
Rickettsia prowazekii-gi3861175 Caulobacter crescentus-CC1272 Mesorhizobium loti-gi13470575 Agrobacterium tumefaciens Sinorhizobium meliloti-gi15074313 Xylella fastidiosa-gi9106142 Pseudomonas aeruginosa-gi9950455 Vibrio cholerae-VC2571 Escherichia coli O157:H7-gi12517924 Escherichia coli K12-gi1789690 Haemophilus influenzae-HI0802 Pasturella haemolytica-gi12721765 Neisseria meningitidis A-gi7378875 Neisseria meningitidis B-NMB0168 Figure 3.11 Phylogeny, based on the RpoA (RNA polymerase a) gene, for 14 bacteria with fully sequenced genomes from the Alpha-, Beta-, and Gammaproteobacteria phyla. Reprinted with permission from Wood et al. (2001). Copyright 2001 AAAS.
referred to above. The linear chromosome appeared to carry 35% of the genome’s genes, including those encoding ribosomal and DNAreplication proteins, as well as 21 complete metabolic pathways. The presence of these genes confirmed the chromosome-like nature of the linear element; however, other genes on the same chromosome, especially those involved in conjugation, are reminiscent of a plasmid. Most interestingly, the sequence revealed that there was a repABC operon (a gene known to be associated with replication of circular chromosomes) near the centre of the chromosome, plus an inversion in the GC skew (see Section 3.1.3). This seems to indicate that the linear chromosome has a bidirectional, plasmid-like mode of replication. Why A. tumefaciens maintains such a complicated arrangement of its genome and the advantages of having multiple chromosomes remain a mystery. Multiple chromosomal elements are especially prominent among proteobacterial phyla and spirochaetes, and this in itself would suggest phylogenetic determination of the tendency to form extrachromosomal elements.
3.2.2
Lateral gene transfer
For many years it has been known that microorganisms can absorb DNA directly from the environment. The relative ease by which antibiotic resistance can be donated from one bacterium to another constitutes further proof that genetic information is not only transferred during cell division (vertical transmission), but also from one intact cell to another (lateral or horizontal transmission). Lateral gene transfer can occur via three mechanisms (Zhou and Thompson 2004), as follows. Transformation. This is the uptake of DNA directly from the environment. If prokaryotic cells can do this they are called competent. Very few bacteria are competent during their whole life cycle, but some are during certain physiological stages. Transduction. Bacteriophages can transfer DNA between species if two host species share similar bacteriophage receptors. Transduction may concern random pieces of the host DNA, packaged during phage assembly in the lytic cycle, or it may be limited to the sequences flanking the insertion site.
78
INTRODUCTION TO ECOLOGICAL GENOMICS
Conjugation. Lateral gene transfer can occur via specialized plasmids during physical contact between F þ and F cells, as discussed above. Lateral gene transfer is not limited to bacteria of the same species, it can also occur among species of widely different origin and even between Bacteria and Archaea. The latter phenomenon was discovered by Nelson et al. (1999), when they sequenced the genome of the thermophilic bacterium Thermotoga maritima (Fig. 3.12). Thermotoga derives its name from the sheath-like envelope that surrounds the cell (the ‘toga’) and the fact that it has a temperature optimum for growth of 80 C. It is usually placed in a completely separate lineage of the Bacteria, called Thermotogales, because of some unique characteristics, including rRNA sequences that are unusual among the Bacteria and a set of fatty acids that is only found in this group. Phylogenetic analysis, aimed at enlightening the position of T. maritima within the Bacteria, resulted in a great lack of congruence when different genes were used as a basis for the comparison. Further analysis of the ORFs in the T. maritima genome showed that no less than 24% of the predicted genes were most similar to proteins in archaeal species, rather than to Bacteria. The Archaea-like genes were found to lie in clusters (islands) in the genome of T. maritima; in several of these islands even the archaeal gene order was conserved. These
observations and those by Aravind et al. (1998) on another thermophilic bacterium, Aquifex aeolicus, provided great support to the theory that lateral gene transfer was not to be considered an oddity, but a very significant process for many microorganisms. Koonin et al. (2001) performed a quantitative analysis of the frequency of lateral gene transfer by analysing the genomes of eight archaeal and 22 bacterial species. They estimated that the percentage of new genes acquired from another domain (Bacteria, Archaea, or Eukarya) was on average 0.9% for the bacterial genomes and 3.4% for the archaeal genomes. When looking at inter-species transfers within the Bacteria, the percentages of acquisition of new genes varied considerably, from 0.4 to 19.8%, depending on the group. A particularly high frequency of foreign DNA is found in the genomes of the Spirochaetales. In general, it turned out that bacteria living at high temperatures had more archaeal genes in their genomes than mesophilic bacteria, and bacteria with a parasitic life style more often had eukaryotic genes in their genome than non-parasitic bacteria. It therefore seems that lateral gene transfer is especially common among organisms that live in close proximity to each other. Several authors have pointed out that not all evidence for lateral gene transfer is equally reliable. If lateral gene transfer is inferred only from
Figure 3.12 Electron micrograph of Thermotoga maritima, a thermophilic bacterium belonging to the group Thermotogales, which was isolated originally from a geothermal heated marine sediment at Vulcano, Italy. Courtesy of K.O. Stetter, University of Regensburg.
COMPARING GENOMES
the genome sequence, showing that certain ORFs have a BLAST match outside the group considered, this is not sufficient evidence, because alternative explanations may be given, such as the loss of genes in some lineages or widely diverging rates of evolution across the groups compared (Eisen 2000; Nesbø et al. 2001). To prove that lateral gene transfer has occurred, one needs to conduct a gene-by-gene phylogenetic analysis. As an example we discuss the work of Deppenheimer et al. (2002). Deppenheimer et al. (2002) sequenced the genome of Methanosarcina mazei (Euryarchaeota), an archaeon of great ecological importance since it derives its energy from fermenting simple organic substrates to methane. Methane production in underwater sediments and inundated land (notably rice paddies) is an important link in the global carbon cycle. The genome of M. mazei (4.1 Mbp) was more than twice as large as other methanogenic Archaea that had been sequenced completely. Of the 3371 identified ORFs, no less than 1043 (31%) had their closest homologue not in an archaeal but in a bacterial species. Unlike the situation in Thermotoga, the bacterial genes in Methanosarcina did not cluster together in islands, but were found scattered in the genome. Gene phylogenies in which the laterally transferred genes were compared with orthologues in other Bacteria and Archaea showed that the foreign genes clustered with bacterial homologues, rather than with Archaea (Fig. 3.13). Detailed analysis of the metabolic role of the bacterial genes in Methanosarca showed that the imported genes had considerably enlarged the metabolic spectrum of the archaeon. The suggestion from the data was that the metabolism of M. mazei has evolved from a simple methanogenic pathway (using hydrogen and carbon dioxide to produce methane), to a much more versatile substrate spectrum, allowing the use of acetate, methanol, and methylamine. Interestingly, most of the laterally transferred genes seemed to have been obtained from obligate and facultative anaerobic bacteria; that is, from organisms that live in the same microenvironment as the methanogenic archaeon (sediments, inundated land). This is in
79
line with observations on thermophilic communities showing that the greatest transfer is between organisms living close together. As indicated by the examples above, lateral gene transfer is an important mechanism for recruiting new microbial functions. By lateral gene transfer, microorganisms may be able to exploit new ecological niches that were inaccessible prior to the event. However, not all lateral gene transfers are necessarily to be viewed within a purely adaptive framework. The presence of foreign genes in a genome might well be a consequence, rather than a cause, of adaptation (Nesbø et al. 2001). Mira et al. (2001) viewed the bacterial genome as resulting from an evolutionary balance between ongoing recruitment and removal processes. Lateral gene transfer is the most important recruitment process. If there is no pressure from natural selection to maintain a newly recruited gene, it will quickly be removed or inactivated. Assuming that in all bacterial genomes there is a bias towards a higher rate of deletions over insertions, this explains the small and streamlined genomes of many bacteria. According to G. Gottschalk (personal communication) the large genomes of methanogens may just be a consequence of the fact that removal of laterally transferred genes has not yet occurred. This argument is similar to the neutral theory of genome evolution by Lynch and Conery (2003), discussed in Section 3.1. Are all genes equally subjected to lateral gene transfer? Jain et al. (1999) postulated the complexity hypothesis, which states that genes that have few interactions with other genes will integrate more easily into a new genomic background and are therefore more likely to be successful in lateral gene transfer, compared with genes that are part of a complicated network and dependent on many other genes. This hypothesis explains the greater tendency of operational genes to be transferred, compared to informational genes; however, there are many exceptions to the hypothesis (Zhou and Thompson 2004). Although the actual rate of lateral gene transfer is considered to be low compared to the life cycle of microorganisms, lateral gene transfer may leave a permanent trace in the genome; the presence of
80
INTRODUCTION TO ECOLOGICAL GENOMICS
Methanococcus jannaschii Methanothermobacter thermoautotrophicum
99
99
Thermoplasma volcanium Ferroplasma acidarmanus
100
Methanosarcina barkeri Methanosarcina mazei
100 100
Clostridium acetobutylicum
100
100 Salmonella 100 77 typhi
Myxococcus xanthus
90
Bacillus subtilis
Vibrio cholerae
Rhodopseudomonas palustris Haemophilus influenzae
0.1 Figure 3.13 Unrooted phylogenetic tree, constructed using the neighbour-joining principle, for ATP-dependent Lon protease, a gene suspected of lateral transfer. The tree shows two clusters of archaeal (top right) and bacterial (bottom left) genes; however, the gene from the archaeon M. mazei clusters with the bacteria, rather than with the Archaea. This greatly supports the hypothesis that ATP Lon protease was acquired by M. mazei from a bacterial donor. Scale bar indicates the proportion of amino acid difference. After Deppenheimer et al. (2002), by permission of Horizon Press.
DNA of ‘foreign’ origin dating from a transfer event millions of years ago is still visible to the present-day genome investigator. At the same time, lateral gene transfer complicates the construction of phylogenetic trees, because the phylogenetic reconstruction of one gene may be different from the reconstruction of another gene if one of them underwent lateral gene transfer. Even the classical gene used for prokaryote phylogeny, the 16 S rRNA gene, which is assumed to be less prone to lateral gene transfer than operational
genes, has caused some problems. Phylogenies based on 16 S rRNA are not always consistent with those derived from another essential gene, RNA polymerase. Consequently, the phylogenetic history of a gene is not always a correct indicator of the phylogenetic history of the organisms themselves. In a much-discussed paper, Doolittle (1999) proposed a radical way out of this dilemma, which is to abolish the whole idea of a universal phylogenetic tree of life. Instead, Doolittle (1999) argued that the accepted taxonomic categories, for
COMPARING GENOMES
example Bacteria and Archaea, may be used as convenient descriptors of shared genes, but not as diagnostic indicators of common ancestry. Doolittle (1999) presented a sketch of early evolution in which the base of life is seen as a highly reticulate structure, a network of promiscous gene exchange, from which the three main domains of life finally rise (Fig. 3.14). Despite the fact that the importance of lateral gene transfer is now well established, the argument that it is an impediment to classifying prokaryotes is not necessarily true. Snel et al. (1999) developed a genome-based phylogenetic approach that goes one step further than just comparing the sequences of genes. These authors considered the fraction of genes shared between genomes as a measure of distance between two species, as follows: nAB dAB ¼ 1 nA where dAB is the distance between genomes A and B, nAB is the number of genes shared (using an arbitrary threshold level for orthology), and nA is the number of genes in the smallest genome of the two. So in this method the phylogenetic distance between two species is characterized by a single parameter, not by as many parameters as there are shared genes. The phylogeny based on a matrix of pairwise distances calculated in this way was
Crenarchaeota
Archezoa
Euryarchaeota
Archaea
Plantae
Fungi
Animalia
Cyanobacteria
Eukarya Proteobacteria
Bacteria
Figure 3.14 The network phylogeny of life which, according to Doolittle (1999), must replace the traditional phylogenetic tree to account for lateral gene transfer. Reprinted with permission from Doolittle (1999). Copyright 1999 AAAS.
81
called a genome phylogeny. Snel et al. (1999) applied this approach to 12 fully sequenced prokaryotes and showed that the resulting tree was actually quite similar to the tree generated by the 16 S rRNA gene. The authors concluded that, despite lateral gene transfer, there is still a very strong phylogenetic signature in the gene content of prokaryotic genomes. However, we should realize that a genome phylogeny captures the central trend of evolutionary history, but does not provide the complete picture (Wolf et al. 2002).
3.2.3
From bacteria to organelles
The haploid, circular structure of prokaryotic genomes extends to the genomes of mitochondria and chloroplasts, which have a similar arrangement but are smaller due to loss of many genes. Gray et al. (1999) indicated that the most probable ancestor of the mitochondrion is to be found in the order Rickettsiales of the Alphaproteobacteria. Members of this group include various obligate intracellular parasites such as Rickettsia and Wolbachia. The species Rickettsia prowazekii, the causative agent of a form of typhus transmitted by lice, was long considered to have the most mitochondrion-like genome. However, when more members of the group were sequenced, such as Wolbachia pipientis, an obligate intracellular parasite of Diptera (Wu et al. 2004), doubt was cast on the grouping of mitochondria within the Rickettsiales. Still, evolutionary analysis supports the hypothesis that mitochondria share a common ancestor with the Alphaproteobacteria. Also, the common view remains that the collective mitochondrial genomes are monophyletic; that is, they all originate from the same ancestor. The most bacterium-like mitochondrial genome is found in the flagellate Reclinomonas americana (Sarcomastigophora, Histionida). When the mitochondrial DNA (mtDNA) of this species was sequenced (Lang et al. 1997) it was considered by some as a missing link between bacteria and mitochondria, because of its unusually large number of genes (97, including all the proteins found in other sequenced mtDNAs). The organelle genome database (GOBASE), coordinated by the
82
INTRODUCTION TO ECOLOGICAL GENOMICS
University of Montreal in Canada (http:// megasun.bch.umontreal.ca/gobase), has now collected information on some 50 000 mitochondrial sequences, including 429 complete organelle genomes. The mitochondrial genomes of protists probably hold the key to the evolution of the group, because they comprise most of the phylogenetic diversity within the eukaryotes (Gray et al. 1999). Mitochondria obey the rule that endosymbiosis is accompanied by genome miniaturization (see Section 3.1). In the course of evolution, most of the genetic information for mitochondrial biogenesis and function has moved to the nuclear genome; the proteins needed by the mitochondrion are synthesized in the cytoplasm and then transported across the mitochondrial membrane. Still, the mitochondrial genome encodes several RNAs and proteins essential for mitochondrial function, mostly respiratory complexes of the electron transport chain such as NADH ubiquinone oxidoreductase, succinate ubiquinone oxidoreductase, ubiquinol cytochrome c oxidoreductase, and cytochrome c oxidase. Comparisons among mitochondrial genomes are troubled by the fact that loss of genes has occurred many times independently. For example, genome miniaturization in the bacterial rickettsias has taken place independently of miniaturization in the mitochondrial lineages of protists. To complicate things further, some plant mitochondria contain genes that originate from chloroplasts; this holds for two tRNA genes in the mtDNA of Arabidopsis. The result is that the size and the gene content of mitochondria are remarkably divergent between the eukaryote lineages. Gray et al. (1999) pointed out that mtDNAs come in two basic types, designated as ancestral and derived. Ancestral mitochondrial genomes (for example, the one from Reclinomonas americana) have retained clear vestiges of their eubacterial ancestry, with many non-animal genes, tightly packed in a genome with no or few introns. Derived mitochondrial genomes are characterized by substantial reduction in genome size, marked divergence of rRNA genes and adoption of biased codon-usage patterns in protein genes. All metazoan and most fungal mtDNAs fall into this category.
The size of mitochondrial genomes varies between less than 6 kbp in Plasmodium falciparum (the human malaria parasite, belonging to the group Apicomplexa) to more than 200 kbp in land plants. Gene content is similarly variable across species. In angiosperms, the mitochondrial genome has evolved to become recombinationally active, which has led to extensive rearrangements of genes, breaking up bacterial gene clusters, and loss of tRNA genes. The mitochondrial genome of Arabidopsis is among the largest of the eukaryotes, but it does not encode many more genes than some of the protist mtDNAs. An overview of the diversity of mitochondrial genome size and content is given in Fig. 3.15. Interestingly, mitochondrial genomes may fragment into different molecules. This is thought to be due to recombination between repeat segments in different parts of the genome. An example is found in the potato cyst nematode, Globodera pallida (Tylenchida, Heteroderidae), which has a mitochondrial genome consisting of six different circular small chromosomes each 6.3–9.5 kbp. The 12 mitochondrial genes are scattered over the six units, but the ribosomal genes are all concentrated on one of them (Armstrong et al. 2000). Even more surprising is that the frequencies of these mitochondrial components differ between populations of the nematode. Such small mitochondrial genomes are called subgenomic-sized mtDNAs; they are also found in some green algae and higher plants. Another peculiar situation is due to the presence of plasmids inside mitochondria. Mitochondrial plasmids are especially ubiquitous among filamentous fungi and some of them cause a syndrome of growth loss and early senescence when inserted into ribosomal genes of the mitochondrial genome (Maas et al. 2005). In addition to mitochondria, the other main eukaryotic organelle of bacterial origin is the chloroplast. Comparative studies on bacterial and chloroplast genomes have now demonstrated convincingly that chloroplasts are derived from a cyanobacterium related closely to the present species Nostoc punctiforme. It is also evident that chloroplast genomes jointly are one monophyletic group; that is, they all descend from the same
COMPARING GENOMES
83
Rickettsia
(a)
Arabidopsis Plasmodium Homo C. reinhardtii S. pombe
Marchantia
C. eugametos Jakoba
Chondrus Phytophthora
Reclinomonas
Ochromonas
Allomyces
Acanthamoeba Prototheca Tetrahymena
(b) Porphyra
Acanthamoeba Marchantia
Schizosaccharomyces Plasmodium
Reclinomonas
yejW cox11 rpoA-D sdh3,4
sdh2
tatC
atp3 atp1
atp6,8,9 cox2 nad4L rnl rns nad1-6 cox 1,3 cob rps3 rpl16
rpl11,14
rrn5 yejR,U,V
rpl2,5,6
nad7,9
nad8
nad1
rps 11,12 rps2,4,7,8,13,14,19
tufA secY
rps1,10 rpl1,10,18,19,20,27,31,32,34
ancestor. This is not to imply that the symbiotic event that gave rise to the chloroplast occurred only once. In fact, it is assumed that the initial inclusion of a cyanobacterium (which led to red algae, green algae, and higher plants) was followed by a second endosymbiotic event, probably involving a red alga, which produced cells in which the chloroplast was surrounded by four, rather than two, membranes. From this type of cell
Figure 3.15 Genome size and gene content of mitochondrial DNAs across a wide range of species. (a) Circles and lines represent circular and linear chromosomes, with the ORFs of known function shown as dark lines. The major groups to which the species mentioned belong are as follows: Rickettsia (Alphaproteobacteria), Arabidopsis (angiosperm plant), Marchantia (liverwort), Jakoba, Reclinomonas (flagellates), Allomyces (fungus), Prototheca (green alga), Tetrahymena (ciliate), Acanthamoeba (amoeba), Ochromonas (golden alga), Phytophthora (oomycote), Chondrus (red alga), Chlamydomonas eugamatos, Chlamydomonas reinhardtii (green algae), Schizosaccharomyces pombe (yeast), Homo (human) and Plasmodium (malaria parasite). (b) Gene complement of mitochondrial genomes, showing the overlap between species. Each ellipse corresponds to one organism and includes all the mitochondrial genes of that organism. For example, the tiny mitochondrial genome of Plasmodium has four genes, which are also found in all other mitochondria, while all known mitochondrial genes are found in the mitochondrial genome of Reclinomonas. The genes are designated by code names. Reprinted with permission from Gray et al. (1999). Copyright 1999 AAAS.
three different evolutionary lineages are assumed to have originated (Tudge 2000; Raven and Allen 2003; Falkowksi et al. 2004): Brown algae (Phaeophyta), diatoms (Bacillariophyta), golden algae (Xanthophyta), and water molds (Oomycota), with the chloroplast secondarily lost in the Oomycota. Dinoflagellates (Dinoflagellata), Apicomplexa (Plasmodium and other parasites), and ciliates
84
INTRODUCTION TO ECOLOGICAL GENOMICS
(Ciliata), with a strong reduction of the chloroplast in apicomplexans and a complete loss of the chloroplast in ciliates. Kinetoplastids (parasites like Trypanosoma) and Euglenozoa, with secondary loss of the chloroplast in kinetoplastids and some euglenoids. So, the present-day scattered distribution of photosynthetic capacity across the eukaryotes is explained not only by gains but also by losses of chloroplasts. Losses are especially prominent in the lines that obtained the chloroplast through double symbiosis. Different degrees of chloroplast reduction can be observed in the phylum Apicomplexa. These unicellular organisms are characterized by an organelle called an apicoplast, an assumed relict of a chloroplast, with a greatly reduced genome; however, not all species have this organelle. A recent genomic survey of the human parasite, Cryptosporidium parvum, which lacks an apicoplast, demonstrated the presence of 31 genes of likely cyanobacterial and other prokaryote origin in the genome, confirming the theory that apicomplexans evolved from a plastidcontaining lineage (Huang et al. 2004). The genome of a chloroplast typically encodes 60–200 proteins, which is more than an order of magnitude less than the genome of a cyanobacterium, which encodes at least 1500 proteins. Genes in the preplastid were either lost or transferred to the nucleus. Studies on Arabidopsis nuclear and chloroplast genomes (Martin et al. 2002) have shown that thousands of genes have been transferred. Some 4500 genes in the nuclear genome of Arabidopsis, or 18% of the genes, appear to have a bacterial (chloroplast) origin. This is not to say that the products of these genes are all functional in the chloroplast; actually, more than half of the originally chloroplastic genes are now targeted to other cell compartments. To complicate things further, the protein products of many nuclear genes that were not acquired from the plastid ancestor are now targeted to the plastid! In this complicated interplay between genomes, many issues remain unresolved, including the fundamental question of why chloroplasts have a genome at all, if genes can be transferred so easily to the nucleus (Raven and Allen 2003). There must be
some crucial selective advantage in retaining some genes in chloroplasts, but not others.
3.3 3.3.1
Eukaryotic genomes Yeast and other fungi
Fungi have received a great deal of attention from genome researchers. The genomes of 14 species have been sequenced completely (Table 3.4). Our list does not include the microsporidian Encephalitozoon cuniculi, a human parasite that is mentioned as a fungus on several websites, but is not a proper fungus according to modern taxonomy (Tudge 2000). Not surprisingly, most of the sequencing effort has been directed towards fungi with nutritional or pathogenic importance and sequencing is concentrated in the ascomycete order Saccharomycetales, because the exploration of fungal genomes began in that group with the model species S. cerevisiae. The unicellular mode of life, ease of culturability, and the relatively small genome were important factors in the success of investigating baker’s yeast. Probably more is known about yeast genomics, biochemistry, and physiological responses to environmental conditions than about any other species of eukaryote. Although yeasts can be isolated from many natural habitats (fruits, leaf surfaces, decaying plants, soil), they are not common objects of study among ecologists. Spencer and Spencer (1997a, 1997b) provide a general overview of the biology of yeasts, with particular emphasis on their taxonomy and the type of natural habitat colonized by them. The designation yeast is not a proper taxon within the fungal kingdom, it just indicates that we are dealing with a unicellular fungus that can grow in colonies by budding or fission, like bacteria. Yeasts are contrasted with filamentous, mycelium-forming fungi. Although most yeasts are classified in the Ascomycota, they are also found in the Basidiomycota and Deuteromycota. S. cerevisiae is a yeast associated with bread preparation. The closely related Saccharomyces species used in beer and wine production are considered to be separate species (Spencer and Spencer 1997a). The fungal species in Table 3.4 that is of greatest interest to ecologists is Phanerochaete chrysosporium,
COMPARING GENOMES
85
Table 3.4 List of fungal species with completely sequenced genomes Species
Genome size (kbp)
Growth form, habitat, importance
Ascomycota, Saccharomycetales Ashbya ( ¼ Eremothecium) gossypii Candida glabrata Debaryomyces hansenii Kluyveromyces lactis Kluyveromyces (Lachancea) waltii Saccharomyces cerevisiae Saccharomyces paradoxus Saccharomyces mikatae Saccharomyces bayanus Schizosaccharomyces pombe Yarrowia lipolytica
8743 12 281 12 221 10 689 10 613 12 069 11 750 12 120 11 540 12 534 20 502
Filamentous, pest of cotton, used in industry to produce vitamin B2 Unicellular, causes variety of infections in humans (candidiasis) Unicellular, abundant on fish and salted dairy products (cheese) Unicellular, associated with various food items, biotechnologically important Occurrence similar to K. lactis, but evolutionarily closer to S. cerevisiae Baker’s yeast, important physiological model organism Sequenced to provide comparison with S. cerevisiae Sequenced to provide comparison with S. cerevisiae Sequenced to provide comparison with S. cerevisiae Fission yeast, used in African millet beer In various food media, can grow on alkanes, possibly important for biotechnology
Ascomycota, Sordaliales Magnaporthe grisea Neurospora crassa
40 000 43 000
Filamentous, causes blast disease in rice and other domesticated grasses Filamentous mould, important model for genetics and molecular biology
Basidiomycota, Aphyllophorales Phanerochaete chrysosporium
30 000
White rot, in fallen trees, on forest floor, degrades lignin
Sources: www.genomenewsnetwork.org, www.ebi.ac.uk/genomes/index.html, www.genomesonline.org, and Kellis et al. (2003, 2004).
or white rot fungus, which is found commonly on dead trees and wood fragments on the forest floor. To date, white rot fungus is the only basidomycete (mushroom-forming fungus) that has had its genome sequenced (Martinez et al. 2004). White rot owes its name to the fact that the fungus ‘bleaches’ wood by degrading the (brown-coloured) lignin, rendering the white cellulose visible. Lignin forms protective sheaths around cellulose fibrils in plant cell walls. The biodegradation of lignin by white rot is supported by unique extracellular oxidative enzymes (peroxidases and oxidases) that act non-specifically via the generation of free radicals attacking the lignin molecule. There are many other ecologically important fungi commonly found on dead organic material that contribute to processing of organic matter and cycling of nutrients in natural ecosystems (Aspergillus, Trichoderma, Cladosporium, Morteriella), but their genomes have yet to be sequenced. The genome sizes of fungi are between those of bacteria and higher eukaryotes. Neurospora crassa, a mycelium-forming fungus, has one of the largest
fungal genomes sequenced so far (Galagan et al. 2003). Comparing this genome with S. cerevisiae, Braun et al. (2000) suggested that the relatively small genome of baker’s yeast is due to a process of ‘streamlining’ by loss of genes. Detailed comparisons of S. cerevisiae with the filamentous fungus Ashbya gossypii (Dietrich et al. 2004) and the unicellular Kluyveromyces waltii (Kellis et al. 2004) have confirmed that the evolution of S. cerevisiae has included a whole-genome duplication, followed by extensive rearrangements and loss of genes. These conclusions are in accordance with the idea that unicellularity in fungi is an apomorphic condition and that yeasts evolved independently several times from multicellular ancestors, not the other way around. N. crassa (orange bread mould) has been a famous model organism for genetic and biochemical studies since the classical experiments of Beadle and Tatum in 1942, who proved that for every enzyme there is one gene (the one gene/one enzyme hypothesis). Although Neurospora is an ascomycete like S. cerevisiae, it is more similar to animals than
86
INTRODUCTION TO ECOLOGICAL GENOMICS
to yeast in several ways. For example, unlike yeast but like mammals, it has a clearly discernable circadian rhythm, it methylates DNA to control gene expression, and it has complex I in the respiratory chain. With all this biochemical research, Neurospora is the best-characterized of the filamentous fungi, but its ecology remains relatively
unexplored. Being moderately thermophilic, Neurospora was thought to occur mainly in moist tropical and subtropical regions, but recent surveys have also found Neurospora colonizing trees and shrubs killed by wildfires in temperate regions (Jacobson et al. 2004; Fig. 3.16). Mycological inventories showed that in North America isolates
Figure 3.16 Neurospora growing under tree bark. Courtesy of D.J. Jacobson, Stanford University.
COMPARING GENOMES
were comprised predominantly of a single species, Neurospora discreta, but in southern Europe species collected included N. crassa, N. discreta, Neurospora sitophila, and Neurospora tetrasperma. The life cycle of S. cerevisiae is of the diplobiontic type; that is, it cycles through two distinct phases, one diploid and one haploid (Fig. 3.17). The diploid stage grows vegetatively by budding off new cells and forming colonies. Under certain conditions, such as deprivation of carbon or nitrogen, it can form stress-resistant ascospores. Exactly how sporulation is triggered is currently under investigation. Ascospores are of two types, called a and a. They sit together in the ascus and upon germination produce two so-called mating types. These haploid cells can grow vegetatively by budding, a property that provides unique opportunities to geneticists, because the expression of traits in this stage is not confounded by dominance: the phenotype is a direct result of the genotype. The two haploid mating types may interact with each other by means of hormones, which induce a characteristic change in shape, leading to
Haploid ascospore, a-mating type a
87
pear-shaped cells, called shmoos after the lovable creatures in Li’l Abner’s comic strip from 1948. The process of sexual conjugation can occur only between opposite mating types. It involves a complicated series of cell-surface changes to facilitate fusion and is mediated by the hormones in a manner that is mating-type specific. The life cycle of N. crassa is similar, except that the diploid vegetative stage is suppressed and the zygote proceeds directly to form an ascus. SGDTM is the Saccharomyces Genome Database (www.yeastgenome.org) where information about the molecular biology and genetics of baker’s yeast is filed and presented to the world. The database includes a variety of search options that allow one to consult the genome sequence; analysis tools such as BLAST (see Section 2.4), programs for homology searches, and information about protein structure, as well as contact details for more than 1000 people in the yeast research community. The database also provides a list of recently published papers on all aspects of yeast molecular biology and links to databases of the other fungi listed in
Vegetative life cycle (n)
Germination
a
Bud a
a
Induction by sex factors
Ascospores (n) a
a
α
α
α /a
Meiosis
a
α
Fusion to form zygote
α /a Ascus
α
α
Vegetative life cycle (2n)
Vegetative life cycle (n) α
Germination
Haploid ascospore, α -mating type
Bud
Induction by sex factors α
Figure 3.17 Life-cycle of the yeast S. cerevisiae. After Russell (2002), with permission from Pearson Education Inc.
88
INTRODUCTION TO ECOLOGICAL GENOMICS
Table 3.4. The organizational principles of the database are discussed by Dwight et al. (2004). Over the years the SGD has seen a dramatic increase in its usage, and has served as a template for other databases. The success of SGD, as measured by the numbers of pages viewed, user responses, and number of downloads, is due in large part to the network philosophy that has guided its mission and organization since it was established in 1993. The yeast genome was the first for which microarrays were developed (see Section 2.2). An oligonucleotide microarray (Affymetrix Yeast Genome 2.0 Array) is available that contains 10 765 probes, allowing one to address almost all genes of both S. cerevisiae and Schizosaccharomyces pombe at the same time. A series of in-depth comparative genomic studies has recently been conducted in which the genome of S. cerevisiae was compared with other fungi in and outside of the order Saccharomycetales (Brachat et al. 2003; Cliften et al. 2003; Kellis et al. 2003, 2004; Dietrich et al. 2004; Dujon et al. 2004). An important argument for sequencing species that have a known phylogenetic relationship with S. cerevisiae is that it could help in the identification of genes and regulatory elements in the genome of S. cerevisiae. The idea is that orthologous sequences need to show a considerable degree of conservation before an ORF is considered a gene. True protein-encoding genes will typically be under selective pressure and show conservation, whereas ORFs that are not expressed will show mutations that are different for each species. When this approach is applied to regulatory elements it is called phylogenetic footprinting, referring to the fact that regulatory elements tend to be conserved across widely distant species and are recognizable in the genome as ‘footprints’ (Cliften et al. 2003). Comparative genomics applied to closely related rather than distant species has been called phylogenetic shadowing; this approach was first applied to sequences from 17 different primates as ‘shadows’ of the human genome (Bofelli et al. 2003). As an example of a comparative genomics study in yeast, let us consider the work by Kellis et al. (2003). This author analysed the relationship
among orthologous genes using a reading frame conservation test. This test classifies each ORF in S. cerevisiae as biologically meaningful or meaningless, depending on the proportion of the sequence over which conservation with other species is observed. Each of the other species was considered a ‘voter’, ‘approving’ or ‘rejecting’ the sequence in S. cerevisiae. Obviously, the procedure carries a risk that true genes under strong selective pressure in one of the species are rejected as biologically meaningful, but this was prevented by looking in detail at each rejection. Confidence in the method was increased when it appeared that only a few already annotated ORFs were rejected as genes. Inspection showed that in all of these possibly false-negative cases the annotated ORFs were indeed likely to be spurious. The analysis of Kellis et al. (2003) pruned the yeast gene catalogue of 503 genes, leaving only 20 ORFs in the database unresolved and decreasing the number of proteinencoding genes with more than 100 amino acids to 5538 (see also Table 2.1). Further insight into the S. cerevisae genome has recently been obtained from comparisons with more distantly related species. Dujon et al. (2004) sequenced four species from the hemiascomycete group, Candida glabrata, Kluyveromyces lactis, Debaryomyces hansenii, and Yarrowia lipolytica, and compared their genomes with that of S. cerevisae. A total of approximately 24 200 novel genes was identified, and their translation products were classified into about 4700 families. Pairwise comparisons were made between the species to establish the degree of sequence divergence between orthologous genes. It appeared that the five yeast species together spanned a genetic diversity comparable to the entire phylum Chordata. For example, the average sequence identity between orthologous genes (translated into proteins) between S. cerevisiae and C. glabrata was 65%, between S. cerevisiae and K. lactis 60%, and between S. cerevisiae and Y. lipolytica 49%. This is less than the average sequence identity of proteins between mouse and fugu fish (70%) and comparable to that found between the urochordate sea squirt, Ciona intestinalis, and the mammals! The lesson of this large-scale comparative genomics study was that
COMPARING GENOMES
the evolutionary distance between yeasts, despite their very similar morphology, is extremely large.
3.3.2
Nematodes
Although molecular biologists have developed the habit (to the amusement of zoologists) of calling the nematode C. elegans a worm, the animal has nothing to do with the true worms, the Annelida, since it is classified in a completely separate phylum, Nematoda. Phylogenomic analysis has demonstrated that this phylum is related to the arthropods and belongs to the so-called moulting animals, the Ecdysozoa (Dopazo and Dopazo 2005); the annelids are classified with the molluscs in another superphylum, Lophotrochozoa. C. elegans is one of the rhabditid nematodes, a group of tiny, free-living, bacteria-feeding animals, living in soils, dead organic material, or wherever there are bacteria. On the basis of rRNA gene sequences, 17 species are classified in the genus Caenorhabditis, including C. briggsae, the other nematode whose genome has been sequenced completely. Classification of nematodes is complicated by the fact that the external structure of the animals is not very diversified. The morphology of the most important diagnostic characters, the mouthparts, and other aspects of external morphology do not always fit with the molecular data and therefore the names assigned to higher-order categories in the classical taxonomy are sometimes illogical when arranging the species according to a molecular phylogeny. For example, the order Rhabditida does not indicate a monophyletic group, but appears to fall into at least two different phylogenetic lineages (see http://nematol.unh. edu/phylogeny.php, and Blaxter et al. 1998). Despite their morphological uniformity, the phylum Nematoda is extremely diverse from a genetic point of view. Analysing a large collection of ESTs (>250 000) from 30 different nematode species, Parkinson et al. (2004) found that 30–50% of the transcriptome of each species was unique to that species. Consequently, a single nematode like C. elegans can reveal only a small fraction of the genomic diversity of even its own phylum. A phylogeny of 53 species of nematodes, based on
89
small-subunit rRNA sequences, is given in Fig. 3.18 (Blaxter et al. 1998). The figure also provides information on feeding habits, which diverge widely within the nematodes as a whole; one can find bacteriovores (like C. elegans), fungivores, predators, omnivores, plant parasites, and animal parasites. Fig. 3.18 shows that there is no phylogenetic conservation of feeding habits; feeding modes are scattered throughout the tree. The great biodiversity of feeding habits, lifehistory patterns, and colonizing capacity makes the Nematoda a very suitable group for community bioindication. When each species is given a score on a scale of colonizers to persisters, the weighted sum of these scores for a given community (the maturity index) can be used as a indicator of habitat quality (Bongers and Ferris 1999). The phylum Nematoda includes many parasites, such as the well-known intestinal roundworm of pigs, Ascaris lumbricoides, the small human pinworm Enterobius vermicularis, which infects 30–80% of schoolchildren in western countries, and various species causing serious diseases in tropical countries, such as Onchocerca volvulus, the causative agent of river blindness (onchocerciasis), which is spread by the bite of an infected blackfly. Experiments have shown that the inflammatory response in the human eye causing blindness, which is triggered by the presence of dying nematode microfilariae, is not only due to the worm itself, but also to toxins excreted by an endosymbiotic Wolbachia bacterium (Saint Andre´ et al. 2002). The genome of this Wolbachia is currently being sequenced. So the genomic studies on C. elegans have important ramifications for parasite research (Blaxter et al. 1998) and scientific networks are currently in development that address the field of nematode parasitomics: for example, the Filarial Genome Network (www.nematodes.org/fgn/ pnb/filbio.html), named after one of the parasitic species in the onchocercid group, Filaria martis. Although the interest in parasite genomics is exclusively medical at the moment, parasites are important agents in the population dynamics of many wild species and progress in the medical sector could well have a future spin-off to ecology. There are also several nematodes that form cysts
90
INTRODUCTION TO ECOLOGICAL GENOMICS
Trophic ecology Bacteriovore Algivore–omnivore–predator Fungivore Plant parasite Entomopathogen Invertebrate parasite Vertebrate parasite
Nippostrongylus brasiliensis Ostertagia ostertagi Haemonchus contortus Syngamus trachea Heterorhabditis bacteriophora Pelliodilis typica Dolichohabditis sp CEW1 Rhabditella axei Rhabditis blumi Caenorhabditis briggsae Caenorhabditis elegans Diploscapter sp Pristionchus lheritieri Pristionchus pacificus Aduncospiculum halicti Teratorhabditis palmarum Panagrellus redivivus Panagrolaimus sp PS1159 Strongyloides stercoralis Strongyloides ratti Steinernema carpocapsae Bursaphelenchus sp
Aphelenchus avenae Globodera pallida Meloidogyne arenaria Zeldia punctata Acrobeles complexus Ascaris suum Anisakis sp Toxocara canis Brugia malayi Dirofilaria immitis Philonema sp Brumptaemilius justini Dentostomella sp Teratocephalus lirellus Plectus aquatilis Plectus acuminatus Diplolaimelloides meyli Bunonema sp Metachromadora sp Praeacanthonchus sp Paratrichodorus pachydermus Paratrichodorus anemones Trichodorus primitivus Prismatolaimus intermedius Longidorus elongatus Xiphinema rivesi Mermis nigrescens Mylonchulus arenicolus Trichinella spiralis Trichuris muris Adoncholaimus sp Priapulus caudatus Chordodes morgani
Strongylida
Rhabditida (Rhabditoidea)
Diplogasterida Rhabditida (Rhabditoidea) Rhabditida (Panagrolaimidae) Rhabditida (Strongyloididae) Rhabditida (Steinernematidae) Aphelenchida Tylenchida Rhabditida (Cephalobidae) Ascaridida
Spirurida Rhigonematida Oxyurida Chromadorida Monhysterida Rhabditida (Bunonematidae) Chromadorida Triplonchida Enoplida Dorylaimida Mermithida Mononchida Trichocephalida Enoplida
Figure 3.18 Phylogeny of 53 nematodes, based on sequences of the small-subunit rRNA gene. With each species an indication of the feeding habit is given (see key). The right-hand side indicates the orders of classical nematode taxonomy. After Blaxter et al. (1998), by permission of Nature Publishing Group.
COMPARING GENOMES
in plant roots or otherwise damage below-ground plant tissues; however, none of these plant parasites is, as far as we know, on a list for a wholegenome sequencing project. C. elegans is a 1 mm-long, transparant animal with sequential hermaphoditism and self-fertilization. Sperm cells are made first and stored in the spermathecae. Then the animal switches to the production of oocytes, which are fertilized by sperm from the same individual, mature partly while still in the body, and develop to the first larval stage, which emerges after the eggs have been laid. Around 10 eggs are in the body at any time, but the animal can produce more than 300 progeny during its adult lifetime, which depends on temperature (5.5 days at 15 C, 3.5 days at 20 C). This phenomenal reproductive capacity, within hours to days, was an important consideration when the species was chosen as a model. In addition to hermaphrodites, males sometimes occur. These males fertilize the hermaphrodites, as there are no gonochoristic females. The sex-determining system is chromosomal and the males lack one sex chromosome (hermaphrodites are XX, males are X0). The possibilities offered by this type of reproductive cycle are very convenient for genetic work, because clones can be made from hermaphroditic lines with no signs of inbreeding depression, and males can be used for cross-fertilization. The life cycle includes four larval stages, each separated by a moult (Fig. 3.19). The development of gonads and the production of sperm are already taking place during the larval stage. In addition to the four normal larvae there is a resting stage, called the dauer larva (after the German word for endure), which is actually an arrested third larval stage, in which the animal goes into a state of torpor, and does not eat, although it can move slightly and may live for several months. The dauer larval stage is induced by adverse conditions such as crowding and food scarcety. When terminated, the dauer stage proceeds to the fourth larval stage. It is assumed that the dauer larva is the nematode’s dispersal stage. Several features point towards an increased propensity to be transported, either by wind or by other animals. The dauer dries itself out, secretes an extra cucticle
91
and develops a behaviour known as nictation (winking); it tends to crawl up objects that protrude from the surface, stands on its tail and waves its head back and forth (Riddle 1988). An important aspect of the dauer is its extreme longevity, which may reach several months, rather than the normal 20 days. The dauer stage of C. elegans is an important model for investigating the genomic basis of longevity (see Chapter 5). A very peculiar property of C. elegans is that it has a completely determinate developmental pattern, which is fixed for all 959 cells of the body. This was the reason why the animal was initially chosen as a model for developmental studies by Sydney Brenner at the beginning of the 1960s (Brown 2004). Brenner was inspired by earlier German work on the nervous system of the intestinal parasitic nematode Ascaris suum, which had shown that the fate and location of each cell could be traced, and was the same in all individuals. The original C. elegans strain on which the research in Cambridge was started by Brenner came from the laboratory of Ellsworth Dougherty in Berkeley, who had cultured C. elegans for several years. It is assumed that the culture actually originated from mushroom compost collected near Bristol, UK (Fitch and Thomas 1997). C. elegans is a cosmopolitan species. More than 20 different strains have been isolated from soils of North America, Europe, and Australia (Fitch and Thomas 1997). Despite this broad distribution, the species is not a popular object of study among field ecologists, because it is very difficult to distinguish from other species in the same group and its distribution seems to be restricted to synanthropic habitats such as compost heaps and manure. For example, despite the fact that a good identification key of more than 600 species is available for the nematodes of the Netherlands, issued from an active university department specializing in nematology over many years (Bongers 1988), wild C. elegans have never been found in the Netherlands. The complete genome sequence of C. elegans was the first to be published for a multicellular organism (the C. elegans Sequencing Consortium 1998). The WormBase consortium has continued to edit the sequence, brought the estimated error rate
92
INTRODUCTION TO ECOLOGICAL GENOMICS
Fertilization Oogenesis
Embryogenesis Egg lay
0
Spermatogenesis
5
35 45
L4/adult 30 10
40
L3/L4 25
Hatch 0 15 35
20
L2/L3
5 15
Gonadogenesis
L1/L2 10
20
30 25
Figure 3.19 Life cycle (from egg to adult) of C. elegans, when cultured in the laboratory with abundant food (E. coli ) at 25 C. The outer scale is marked in hours since fertilization, the inner scale in hours since hatching. L1, L2, L3, and L4 are the first to fourth larval stages. The adult can live for several days more. After Wood et al. (1980), with permission from Elsevier.
down to 1 in 100 000, and closed the last gap in November 2002. This makes the C. elegans sequence the first and so far only metazoan genome database that has reached sequencing closure for all of the chromosomes. The interface on the World Wide Web (www.wormbase.org), described by Harris et al. (2004), offers a rich source of information, not only on the complete genome sequence but also on mutant phenotypes, genetic markers, developmental lineages of the worm, and bibliographic resources, including paper abstracts and author contact information. The genome sequence of the related species, C. briggsae, is now completely integrated into WormBase, which allows comparative analysis of orthologues
and synteny. WormBase also contains extensive information from large-scale genome analyses, microarray expression studies, and the assignment of gene ontology terms to gene products. New data releases are published regularly and from time to time a ‘freeze’ of the software and the database is deposited, which can be downloaded. For transcription profiling, commercial microarrays are available, such as the C. elegans whole-genome GeneChip1 array (Affymetrix), which targets 22 500 transcripts. The C. elegans sequence was announced in 1998 as a ‘platform for investigating biology’. The consortium realized that the importance of the genome sequence of C. elegans extended beyond
COMPARING GENOMES
93
Table 3.5 General features of the genome of C. elegans (C. elegans Sequencing Consortium 1998) Category
Features
Protein-encoding genes
Many genes (25%) organized in cistronic units (Section 3.2); three times more genes than in yeast (see Table 3.1); more genes than was estimated from genetic studies Many tRNAs on the X chromosome; several RNA genes in introns of protein-encoding genes; rRNA genes in long tandem arrays Uniform GC content (see Fig. 3.7); fairly constant gene density across chromosomes Tandem repeats account for 2.7% of the genome; inverted repeats account for 3.6% of the genome; repeat sequences overrepresented in introns; 38 different families of dispersed repetitive sequences associated with transposition; dispersed repetitive sequences abundant on the arms of the chromosomes
RNA genes Gene density Repetitive DNA
nematodes proper, and in fact could be considered the basic formula for constructing a multicellular animal, in the same way that the sequence of the S. cerevisiae genome contains all the information for making and maintaining a unicellular eukaryote. In addition, because nematodes branched off early in the evolutionary tree of life, the C. elegans sequence provides an outgroup for almost all other bilaterian animals (from Annelida to Chordata). For example, if a gene is identified in both C. elegans and a mollusc, it must also have been present in the ancestor of the Bilateria (Hodgkin et al. 1995). An overview of the specific features of the C. elegans genome is given in Table 3.5. At the time of publication of the C. elegans genome sequence, information was available on only a few other eukaryote genomes. C. elegans could be compared with yeast and bacteria such as E. coli, as well as to the then-available gene content of the human genome. It turned out that 36% of the predicted C. elegans genes had a human homologue and that no less than 74% of the human genes had a homologue in C. elegans (Fig. 3.20). The similarity of C. elegans to Homo sapiens was greater than that to yeast or bacteria. This comparison demonstrated for the first time the striking unity that underlies the genomes of organisms as different as nematode and human. This tendency was reconfirmed many times when more eukaryotic genome sequences became available.
3.3.3
Drosophila and other arthropods
In terms of numbers of species, the arthropods as a group surpass any other phylum in the animal
H. sapiens 4979 74 47
36
37
16
20
C. elegans 18 891 26 S. cerevisiae 6217
9.1
51 21 27
26 E. coli 4289
Figure 3.20 Pairwise comparison of predicted proteins in four species. The numbers adjacent to the arrows indicate the percentage of proteins in an organism that has a match in the organism indicated by the arrow. The numbers in the boxes indicate the actual number of proteins compared. Reprinted with permission from The C. elegans Sequencing Consortium (1998). Copyright 1998 AAAS.
kingdom. Of some 1.25 million known animal species, about four-fifths of these are arthropods; the class Insecta by itself represents almost three-quarters of all described animal species. Considering the small size of most members, it is probable that as many species again remain undescribed. However, the vast biodiversity of arthropods is not matched by proportional investment in genome sequencing (Heckel 2003). At the time of writing (June 2005), the genomes of just four species of arthropod have been sequenced completely; the fruit fly D. melanogaster (Adams
94
INTRODUCTION TO ECOLOGICAL GENOMICS
Table 3.6 List of arthropod species, other than D. melanogaster, An. gambiae, B. mori, and A. mellifera for which whole-genome sequencing projects have been initiated Taxonomic group Insecta, Diptera Drosophila pseudobscura and other Drosophila species Aedes aegypti (yellow fever mosquito) Culex pipiens (house mosquito) Glossina morsitans (tsetse fly)
Arguments, relevance
Comparison with D. melanogaster, mechanisms of radiative speciation, phylogenetic shadowing Disease transmission, comparative basis for haematophagy, together with An. gambiae, C. pipiens, and other mosquitoes Vector for Western Nile Virus, model for blood-feeding mosquitoes Transmitter of Trypanosoma, cause of sleeping sickness
Insecta, Hymenoptera Apis mellifera, other strains
Comparison with A. mellifera DH4, genetic basis of social behaviour
Insecta, Coleoptera Tribolium castaneum (red flour beetle)
Model organism for genetics and developmental biology
Insecta, Lepidoptera Heliothis virescens (tobacco budworm)
Larva attacks various crops such as alfalfa, clover, cotton, soybean, and tobacco
Acari, Ixodidae Amblyomma americanum (lone star tick)
Vector for transmission of bacteria causing spotted fever and rabbit fever in humans
Crustacea, Cladocera Daphnia pulex (water flea)
Important model species in aquatic ecology, widely accepted test organism in water-quality assessment
et al. 2000), the malaria mosquito An. gambiae (Holt et al. 2002), the silk worm Bombyx mori (Biology Analysis Group 2004), and the honey bee, Apis mellifera (sequence assembly Amel 2.0 released January 2005; see www.hgsc.bcm.tmc.edu/ projects/honeybee). Several other species are in the pipeline (Table 3.6). As is evident from Table 3.6, many arthropods are considered for sequencing because of their medical (disease transmission) or agronomical (pest) importance. The species that raise the greatest expectations among ecologists are the water fleas Daphnia pulex and Daphnia magna, because water fleas (Crustacea, Cladocera) are extremely important organisms in aquatic food chains. On the one hand, they have a top-down effect by grazing and controlling algal populations, and on the other hand they have a bottom-up effect as food for fish. Numerous limnologists have studied population dynamics, life history, energy metabolism, and vertical migration of daphnids for nearly three centuries. The reproductive biology of Daphnia is very suitable for genomic studies because it
can reproduce by apomictic parthenogenesis under favourable conditions but also by sexual mechanisms under unfavourable conditions. The sexually produced resting stage is a saddle-shaped structure called an ephippium, which contains diapausing eggs; indeed, centuries-old Daphnia can be resurrected from ephippia recovered from natural sediments. Due to the combination of sexual reproduction and clonal propagation in localized populations, water fleas are differentiated in many ecotypes, showing diverging rates of genetic variation, depending on the temporal stability of their habitat and the rate of outbreeding (De Meester 1996). D. magna is an internationally accepted standard test organism in ecotoxicology and water-quality assessment in general. The Daphnia Genomics Consortium (DGC) coordinates the release of the genome sequence (http://daphnia.cgb.indiana.edu) and a great variety of other genomic tools, such as nearly 2000 microsatellite markers (many linked to gene loci), a fine-scale genetic map, and no less than 50 000 cDNAs, expressed in a great variety of
COMPARING GENOMES
environments and developmental stages. A database, wFleaBase (http://wfleabase.org), provides the infrastructure to share genomics data and protocols via the World Wide Web. Techniques for cell culture and genetic transformation are in development. The genome sequencing effort is focused on D. pulex, but a considerable number of ESTs is also available for D. magna; microarrays with over 12 000 gene fragments have been developed for transcription-profiling studies in stress ecology (www.ams.rdg.ac.uk/zoology/ daphnia). It is expected that, among animal models, Daphnia is one of the most promising species for realizing a true blend of ecology and genomics. It is worthwhile probing the base of the phylum Arthropoda when evolutionary arguments are being advanced for future sequencing projects. How do insects relate to myriapods, arachnids, and crustaceans? This debate has occupied entomologists for a very long time and a convincing answer has not yet been given (Gillot 1980). Nardi et al. (2003) sequenced the mitochondrial genomes of two representatives of the class Collembola, a group of wingless hexapods, often called primitive insects and formerly classified as a subclass of the Insecta, the Apterygota. The sequences were compared with the mitochondrial genomes of a great number of insects and crustaceans and a phylogenetic tree produced (Fig. 3.21). The tree suggests strongly that the Collembola separated from the main line of the arthropods before the split between the crustaceans and insects. This would imply that the hexapod body plan, shown by insects as well as Collembola, evolved twice. Obviously, more genomic sequencing of representatives from the primitive hexapods, crustaceans, and myriapods is necessary to resolve this question. Within the Diptera (the two-winged flies), D. melanogaster belongs to the family Drosophilidae, or fruit flies, which is one of the largest families of the Acalypterae, a group of flies belonging to the suborder Cyclorapha. Almost 3000 species of drosophilids in over 60 genera are described worldwide. Members of the family are found in association with fermenting substances, most notably fruit, but also in specialized habitats such as the sap of bleeding tree wounds, slime fluxes,
95
rotting cacti, and flower heads as well as in general habitats such as on fungi and decaying leaves on forest floors. The adults (3–5 mm) are attracted by the alcoholic odours emanating from the activities of bacteria and yeasts colonizing a substrate rich in sugars. Eggs are driven into the substrate by means of the female’s ovipositor and the maggotlike larvae emerging from the eggs develop inside the substrate through three stages followed by a pupa; at 25 C new adults emerge within 10 days of hatching. D. melanogaster is believed to have evolved in Africa, but is now found worldwide in many synanthropic habitats, such as fruit markets and garbage cans. The classical booklet by Demerec and Kaufmann (1950) is still a valuable source of information about the biology of Drosophila. The publication of the sequence of the Drosophila melanogaster genome by Adams et al. (2000) was a landmark achievement because it marked the end of nine decades of Drosophila research, starting with T.H. Morgan’s discovery in 1910 of a mutant white-eyed fly and leading to major conceptual or technical breakthroughs in our understanding of animal genetics over the course of the century (Rubin and Lewis 2000). The Drosophila genome was the second and largest animal genome sequenced at the time and the short period (less than 1 year) in which the work was completed, as a combined academic and industry effort, was impressive. Interestingly, the superstar status that the fruit fly already enjoyed before the sequencing began was actually somewhat of an impediment to starting the project (Rubin and Lewis 2000). Over 1300 individual genes, nearly 10% of all the genes in Drosophila, had already been cloned and studied, and with such success a whole-genome sequence was considered unnecessary. Nevertheless, it was realized that the majority of genes eluded study by traditional methods because in Drosophila, as in C. elegans and Arabidopsis, many genes do not show obvious phenotypes when mutated. The Drosophila genome-sequencing project was the first that had to deal with a substantial amount of heterochromatin, one-third (60 Mbp) of the genome. Attention was concentrated on the 120 Mbp of euchromatin, because the heterochromatic regions were intractable to the sequencing
96
INTRODUCTION TO ECOLOGICAL GENOMICS
Insecta
Crustacea
Collembola
Myriapoda +Chelicerata +Others
Figure 3.21 Phylogenetic tree of complete mitochondrial sequences of representative arthropod species. The position of two Collembola species (Gomphiocephalus hodgsoni and Tetrodontophora bielanensis), branching off before the Crustacea, suggests that the hexapod body plan arose twice in the evolution of the arthropods. Reprinted with permission from Nardi et al. (2003). Copyright 2003 AAAS.
method. Heterochromatin was present in the centromeres of the two autosomes, one half of the X chromosome, the complete Y chromosome, and the very small fourth chromosome. The heterochromatic, gene-poor, regions consisted primarily of simple sequence satellites and transposons. Interestingly, the transition zones between heterochromatin and euchromatin
regions appeared to contain many previously unknown genes. The genome of Drosophila was found to contain around 13 600 genes; taking alternative splicing into account, 14 113 transcripts were postulated (Adams et al. 2000). Orthologues of these transcripts were sought in the databases of nematode, yeast, and mouse sequences to classify genes
COMPARING GENOMES
according to the gene ontology system. Rubin et al. (2000) compared the fruit fly genes with those of C. elegans and S. cerevisiae, the only two other eukaryote genomes sequenced at the time. A summary of these comparisons is shown in Fig. 3.22. Around 35% of the protein-encoding genes had a match in the nematode genome and 16.5% in the yeast genome. These relatively low values, which by themselves are in accordance with the phylogenetic relationships between the three species, showed that the genome of Drosophila was only remotely related to the other eukaryotes. In fact, further comparisons including a mammalian EST database demonstrated that half of the fly proteins showed similarity with mammalian proteins, which suggested that the Drosophila proteome is more similar to mammalian proteomes than are those of nematodes or yeast. The basis for comparative genomics of arthropods was strengthened considerably when the
97
genome of the malaria mosquito An. gambiae (Diptera, Nematocera, Culicidae) was published (Holt et al. 2002). This sequencing project posed another challenge that had not been encountered in any sequencing exercise so far, namely the high degree of genetic polymorphism in the clone library used. An. gambiae populations are highly structured into several genetic types, with different habitat preferences, but indistinguishable morphologies. The heterogeneous genetic background caused difficulties in genome assembly, because haplotype variation was difficult to distinguish from repeat sequences. The starting stock for the sequencing was a long-term culture maintained at the Institut Pasteur in Paris, which was established from a cross between a strain originating in Nigeria with a strain from Kenya, followed by three rounds of outbreeding. It was believed that the strain mostly represented the Savanna form of An. gambiae, presently found in
Drosophila melanogaster 35.2
29.4 25.8
16.5 11.8
Caenorhabditis elegans
Saccharomyces cerevisiae 27.0
Figure 3.22 Pairwise similarities of predicted proteins in the genomes of fruit fly, nematode, and yeast. The numbers adjacent to the arrows indicate the percentage of proteins in an organism that has a match in the organism indicated by the arrow (at a BLAST E value of 10 10 or smaller), relative to the number of proteins in the first species. Each set of pairs was analysed without consideration of the third proteome. Data from Rubin et al. (2000).
98
INTRODUCTION TO ECOLOGICAL GENOMICS
western Kenya. The great degree of polymorphism was not found in earlier projects; the genomes of Drosophila or mouse were virtually entirely homozygous. Because the whole-genome shotgun sequencing approach is based on repeatedly sampling the genome, such that on average every region is covered a number of times (see Section 2.2), estimates of polymorphism could be made from the sequencing. Single-base-pair discrepancies between sequence reads were denoted as single-nucleotide discrepancies, but in regions where the assembly was supported strongly such variation was considered to be due to SNPs. Variability was not distributed uniformly throughout the genome; it was much higher in the automosomes than in the X chromosome. It was assumed that the genome of the strain used had resulted from a complex introgression between two different chromosomal forms (cytotypes); lack of introgression in the X chromosome (as a consequence of the hemizygous condition of the male) could explain the lower degree of polymorphism in this chromosome. Compared with Drosophila, the genome of An. gambiae demonstrates several features that relate to its haematophagous mode of nutrition. Several gene families were found to be greatly expanded; that is, they appeared to consist of many more, and more diversified, members than the orthologous Drosophila family (Zdobnov et al. 2002). A prime example of gene-family expansion is in genes containing a fibrinogen domain (FBN genes; Christophides et al. 2002). The FBN genes of invertebrates are involved in the innate immune response. The innate or constitutive immune system is the system upon which all invertebrates rely and to which a newly evolved adaptive system was added later in the vertebrate lineage (see Section 6.4). FBN genes combat intruders by binding to foreign surfaces. The expansion of these genes in Anopheles might reflect selection pressure from growth of bacteria in the gut after a blood meal or from defence against Plasmodium and other parasites. Other genes of particular importance to An. gambiae are those related to antioxidant defence, which is a challenge to animals feeding on vertebrate blood, because the blood-meal-derived
haem group is a catalyst of free oxygen radicals. In summary, the genome of Anopheles is twice as large as the Drosophila genome, but this is not only due to expansion of specific gene families, but also to loss of non-coding DNA in Drosophila. The fraction of the genome which consists of introns and intergenic spacers is considerably larger in Anopheles (Table 3.7). The comparative analysis of Zdobnov et al. (2002) also showed that several genes known from yeasts, nematodes, and plants are absent from the two insect genomes. Examples are nine genes related to sterol metabolism, which is in accordance with the fact, noted by entomologists a long time ago, that insects cannot synthesize their own sterols. Table 3.7 summarizes some characteristic features of the genomes of Anopheles and Drosophila. The genome sequence of D. melanogaster is curated by the FlyBase consortium (www. flybase.org). Along with other responsibilities, FlyBase is committed to maintaining up-to-date annotations of the genome (The FlyBase Consortium 2003). Although the genome sequence of the euchromatin is now essentially complete, predictions of transcripts and proteins will be ongoing for some time. A special challenge is to connect the genome annotations to the vast amount of information on phenotypic characters available for Drosophila. Since the original release, reannotations have changed the contents of the genetic database considerably, due to division of genes into two genes, merging previously separate genes, and addition or deletion of exons. FlyBase coordinates
Table 3.7 General features of the genomes of two insects, D. melanogaster (fruit fly) and An. gambiae (malaria mosquito)
Total genome size Total coding DNA Total intron DNA Total intergenic DNA Number of genes Number of exons Genomic GC content
Anopheles
Drosophila
278 Mbp 19.3 Mbp (7%) 43.0 Mbp (15%) 216.0 Mbp (78%) 13 683 50 609 35.2%
123 Mbp 23.8 Mbp (19%) 27.6 Mbp (22%) 71.3 (58%) 13 472 54 537 41.1%
Sources: From Holt et al. (2002) and Zdobnov et al. (2002).
COMPARING GENOMES
99
not only the sequence of D. melanogaster but also that of Drosophila pseudobscura, and it will cover those of other Drosophilidae when these become available in the future. The web pages of FlyBase provide an enormous amount of information on genetic maps, cytological maps, genes, alleles, gene products, protein function, protein location, gene expression, transposons, transgene constructs, fruit fly stocks, collections, fly anatomy, literature, references, and fruit fly investigators. For transcription profiling the GeneChip1 Drosophila Genome 2.0 Array from Affymetrix is often used. This microarray provides comprehensive coverage of the transcribed Drosophila genome using 18 880 probe sets, analyzing over 18 500 transcripts. AnoBase is the An. gambiae genomic and biological database (www.anobase.org). The site also contains reference material and links to other mosquito resources, as well as current news and conference information. Anobase works in collaboration with Genoscope, the French Government’s sequencing centre, who along with Celera Genomics were involved in the initial sequencing of the mosquito genome, and several organizations that specialize in research on tropical diseases, such as The Malaria Research and Reference Reagent Resource Center (MR4). Information on the Aedes aegypti sequencing project can be found on the mosquito genomics server through http:// mosquito.colostate.edu/tikiwiki/tiki-index.php.
Network concerns tomato and potato, collaborators in TreeGenes are interested in forest genetics and the genome sequencing of forest trees, the Multinational Brassica Genome Project addresses the various Brassica species, SoyBase focuses on the soybean Glycine max, and BeanGenes addresses Phaseolus and Vigna species, among others. As noted in Section 2.2 the very large genome sizes of some agriculturally important plants are a serious obstacle for full-genome sequencing (Table 3.8). This is especially valid for species from the family Poaceae (grasses), which includes the cereals (Triticaceae). Still, it is expected that even the genomes of these plants—despite their very large size—will be sequenced eventually. For some plant species commercial microarrays for geneexpression analysis are already available, even though a complete genome assembly and annotation has not yet been conducted. In these cases the microarrays were developed from publicly accessible databases (for example GenBank) complemented by EST sequences submitted by consortium members. Examples are the Affymetrix GeneChip1 Soybean Genome Array, which can be used to study gene expression of over 37 500 soybean transcripts, and the Affymetrix GeneChip1
3.3.4
Cabbages Thale cress Oilseed rape Cereals Rice Barley Wheat Corn Legumes Garden pea Soybean Nightshades Potato Tomato
Plant genomes
The plant kingdom is a monophyletic evolutionary lineage, including green algae, mosses, ferns, and seed plants. Genome sequencing up to now has been completed for one representative from the green algae, Chlamydomonas reinhardtii, and three angiosperms, A. thaliana (thale cress), Oryza sativa (rice, two varieties), and Populus trichocarpa (black cottonwood). Many sequencing projects are being planned and genomic databases, for example collections of ESTs, are being developed worldwide. Researchers often organize themselves around a group of related plant species; for example the Legume Genomics network focuses on Medicago truncatula as a model, the Solanaceae Genomics
Table 3.8 Genome sizes of some agriculturally important crops, in comparison with Arabidopsis Species
Scientific name
Genome size (Mbp)
Arabidopsis thaliana Brassica napus
125 1200
Oryza sativa Hordeum vulgare Triticum aestivum Zea mays
420 4800 16 000 2500
Pisum sativum Glycine max
4100 1100
Solanum tuberosum Lycopersicon esculentum
1800 1000
Source: From Adam (2000). Reproduced by permission of Nature Publishing Group.
100
INTRODUCTION TO ECOLOGICAL GENOMICS
Barley Genome Array that was designed in collaboration with the international barley community. Sequencing the genome of the green alga, C. reinhardtii (Chlorophyta, Volvocales), was inspired by the fact that this small unicellular organism served as a classical model for biochemical research into photosynthesis and cell motility (Harris 2001; Grossman et al. 2003; Gutman and Niyogi 2004). A key feature of its success was the availability of a mutation in a photosynthetic regulatory mechanism called the state transition. The state transition involves allocation of light-harvesting proteins from photosystem II to photosystem I in response to the wavelength of incident light. Because this shift is larger and more easily measured in Chlamydomonas than in higher plants the alga was a preferred organism for eukaryotic photosynthesis research. Chlamydomonas is also a very suitable organism for the study of experimental evolution. It can reproduce both sexually and asexually, and this property has been exploited by Kaltz and Bell (2002) to demonstrate that sexual, genetically diverse, populations were better able to adapt to a new hostile environment than equivalent asexual lines. From a comparative genomics point of view the genome of C. reinhardtii is interesting because together with Arabidopsis it forms a pair bracketing the entire lineage of green plants. Chlamydomonas species are also studied in freshwater algology and are commonly observed in plankton samples under the microscope as tiny, rapidly swimming flagellates. Thus a connection between the growing genomics insights and ecological studies seems very well possible, although a practical difficulty is the very large diversity in the genus Chlamydomonas, which has no less than 600 species worldwide. The Chlamy Center, found at www.chlamy.org, provides entry to a genome browser, an EST database, and various microarray projects, as well as a system for ordering specific strains. Another green alga, Ostreococcus tauri (Chlorophyta, Mamiellales) is also being considered for wholegenome sequencing. This species has a very densely packed genome of only 11.5 Mbp and may provide insight into the minimal number of genes necessary for a photosynthetic eukaryote.
The legume M. truncatula will probably be the next species of higher plant with a fully sequenced genome (www.medicago.org). Medicago is seen as a model for legumes in general, a family of plants that includes well-known genera such as Lathyrus, Phaseolus, Glycine, Trifolium, Medicago, Pisum, Vicia, and Lotus, among which are many agriculturally important species that provide a major source of proteins for the human population. Under nitrogenlimiting conditions, leguminous plants are able to establish a symbiotic relationship with bacteria from the family Rhizobiaceae, including S. meliloti, in itself a genomic model species (see Section 3.2). Symbiotic nitrogen fixation is a very important link in the global nitrogen cycle and so genomic studies of the legume–rhizobium relationship have great added value in comparison to Arabidopsis, which does not offer this possibility. In addition, Medicago can also be used to study endomycorrhizal symbiosis. M. truncatula is a close relative of alfalfa (M. sativa), but unlike the latter species, it has an annual life cycle and only half the genome size of the alfalfa genome. It exhibits simple genetics and a genome highly conserved with alfalfa and pea (Phaseolus vulgaris) and moderately conserved with soybean. The progress is supported by a dense physical map of nearly 200 000 ESTs, and a growing array of functional genomic tools. A consortium of laboratories in the USA and Europe will fully sequence the gene space of M. truncatula by 2006. Populus trichocarpa (family Salicaceae) was the first tree that was considered for whole-genome sequencing. Forest biologists have developed strong justifications for why trees should be viewed as model systems in plant genomics (Bradshaw et al. 2000; Wullschleger et al. 2002). The physiology of trees includes a number of processes that cannot be understood from the model herbaceous plants, such as perennial growth, large size and complex crown structure, extensive secondary xylem, and bud dormancy (Taylor 2002; Brunner et al. 2004). Knowledge of the poplar genome will greatly contribute to the growth of a research area known as forest genomics, which focuses on questions related to mechanisms of wood formation, stress resistance, pathogen resistance, genetic
COMPARING GENOMES
diversity of trees, conservation, and tree breeding. Poplar is an important model species for forest genomics, along with spruce and to a lesser extent pine. With its genome consisting of 480 Mbp, more than four times larger than Arabidopsis, but still some 40 times smaller than pine, poplar has a relatively small genome among trees. The sequencing was done by the International Populus Genome Consortium (IPGC) in which US, Canadian, and Swedish scientists collaborated (www.ornl.gov/sci/ipgc). A recent series of papers on stress responses and developmental processes in poplar is testimony to the true beginning of genome-sequence-based poplar genomics (Strauss and Martin 2004). The importance of poplar as a genomic model extends beyond the aims of forestry; poplar is also a very suitable species for fundamental ecological genomics, as illustrated by the following example. Cottonwoods (Populus trichocarpa) are central to the structure and ecosystem functioning of riparian forests of North American rivers, whereas black poplar (Populus nigra) fulfils the same role in European riparian systems. Ecological interactions in such ecosystems involve engineering by beavers (North American Castor canadensis and European Castor fiber), herbivory by the arthropod community on the leaves (caterpillars, beetles, aphids, etc.), and decomposition of fallen leaves by a diverse community of microorganisms, invertebrate shredders, and detritivores. Interestingly, the principal steering force in these interactions appears to emanate from the genetics of the tree. A number of hybrids from the genus Populus occur naturally and hybridization is associated with marked variations in leaf form and chemical composition of the leaves. Wimp et al. (2004) showed that the genetic variation of a cottonwood stand, estimated by AFLP fingerprints (see Section 2.1) was strongly correlated with the Shannon– Weaver index of the leaf arthropod community: genetically diverse stands had the highest species richness. The effect is most probably mediated by the chemical composition of the leaves, particularly the concentration of tannins. In the same system, leaf tannin was negatively correlated with decomposition and nitrogen mineralization of
101
poplar litter (Schweitzer et al. 2004). The fact that genetic diversity of a dominant species in an ecosystem pervades into the herbivorous and decomposing communities has important implications for conservation strategies. In addition, the system offers exciting possibilities for establishing a direct relationship between ecosystem functions and gene-expression profiles in the tanninsynthesis pathway. Despite the promises of Medicago and Populus, at the moment A. thaliana is the best-characterized genomic model plant by far. Thale cress is a species of the Brassicaceae family, with a wide distribution in the morthern hemisphere (Fig. 3.23). The species is native to western Eurasia but is now found in the wild throughout Europe, the Mediterranean, the East African highlands, and eastern and central Asia (Hoffmann 2002). It has also been introduced into America and Australia (Fig. 3.23). Johannes Thal (hence, thaliana) first described Arabidopsis in the sixteenth century in the German Harz Mountains, although he called it Pilosella siliquosa at the time. The name underwent several changes before A. thaliana was settled upon in 1842. A. thaliana is a small annual plant, 5–30 cm high, growing in open areas with sandy soil, along paths, and in agricultural fields. The life cycle is that of a winter annual, which germinates and grows in autumn, survives winter as a rosette, and flowers in early spring. The developmental switch from vegetative growth to reproduction, involving erection of the flower stem (bolting) is an important issue of research in ecological genomics (see Chapter 5). In fact the life history is more flexible than a typical winter annual, because there are also variants that germinate in spring and flower in July, and others that have more or less lost their phenological tuning (see Sections 2.1 and 5.3, and Fig. 2.7). A. thaliana has a high level of selfpollination. It does not cross-hybridize with its relatives, because the number of chromosomes is reduced to five, whereas all its closest relatives have a haploid chromosome number of eight. AFLP fingerprinting has shown that the population structure of A. thaliana over its native geographical range is shaped by postglacial
102
INTRODUCTION TO ECOLOGICAL GENOMICS
Figure 3.23 Global geographical distribution of A. thaliana. Courtesy of Koeltz Scientific Books.
colonization from the Iberian peninsula and the near east, leading to a suture zone in central Europe (Sharbel et al. 2000). A. thaliana is never a dominant species in wild vegetation. Its suitability as a model for ecological field work is limited by its sparse occurrence and its narrow phenological window. Molecular ecologists have been looking for related species that lend themselves better to ecological studies (Mitchell-Olds 2001). There are 10 species of Arabidopsis among the approximately 3000 species of Brassicaceae. Arabidopsis halleri and Arabidopsis lyrata are closely related species with a perennial life cycle. Genera within the same clade are Cardamine, Rorippa, Barbarea, Arabis, and Thlaspi.
Taken together these cruciferan species comprise a wide array of life cycles and ecological niches. Several of these species seem to be suitable as ‘wild’ counterparts of A. thaliana, and four of them are pictured in Fig. 3.24. Scientific research on A. thaliana started in the beginning of the twentieth century with microscopic studies on the chromosomes, but it was not until the 1970s that molecular geneticists discovered its suitability as a model. A genetic map was developed by Maarten Koorneef and co-workers at the beginning of the 1980s and physical maps of the genome, based on RFLP and AFLP fingerprints, were developed thereafter. The possibilities of transforming Arabidopsis, first
COMPARING GENOMES
(a)
(c)
103
(b)
(d)
Figure 3.24 Wild relatives of A. thaliana: (a) Arabidopsis petraea, (b) Arabis alpina, (c) Boechera holboelii, and (d) Thlaspi caerulescens. Courtesy of T. Mitchell-Olds, Max Planck Institute, Jena and C. Lefe`bvre, Free University of Brussels.
using Agrobacterium and later more advanced genetic-engineering techniques, were also developed; extensive mutant collections were built concurrently. The Multinational Coordinated Arabidopsis thaliana Genome Research Project was launched in 1990 and the Arabidopsis Genome Initiative (AGI) started sequencing the genome in 1996 on a chromosome-by-chromosome basis. Chromosomes 2 and 4 were completed first and published in 1999. With the completion of chromosomes 1, 3, and 5 in 2000 the genome sequence was essentially complete and this was
considered a hallmark event for plant biology (Walbot 2000). The first detailed analysis of the Arabidopsis genome content provided many surprises (Arabidopsis Genome Initiative 2000). From the total genome of 125 Mbp, 115.4 Mbp had been fully sequenced. This sequence appeared to contain 25 498 predicted genes, significantly more than C. elegans and Drosophila (see Table 3.2). When the protein-coding genes were compared with the genomes of other eukaryotes and prokaryotes, many matches were found (Fig. 3.25). It even
Fraction matching
104
INTRODUCTION TO ECOLOGICAL GENOMICS
0.7
E. coli Synechocystis
0.6
S. cerevisiae
0.5
C. elegans Drosophila
0.4 0.3 0.2 0.1
C
el
M
et
ab lg ol is ro m w an th En d ,c D el erg N ld A iv y sy is Tr nth ion an e , Pr sc sis ot rip ei tio n Pr n sy ot n ei th n es Tr de is an s sp tin In at tra ort io n ce fac ilit llu a la tio C r el C lu tran n el l lu la ar b spo rc si o iog rt g m e C na m ne el l t u l r ra ni sis ceesc nsdcati C ll ue u on la d , c / ss Io eat de tion ifi ca nic h, afen tio ho ge ce , n no meo ing ty st a et cl sis ea r U nc -cut la ss ifi ed
0
Figure 3.25 Functional analysis of the Arabidopsis genes predicted from the genome sequence, showing the similarities between Arabidopsis functional gene categories and bacterial genomes (E. coli and Synechocystis, a cyanobacterium) and those of yeast, nematode, and fruit fly. The y axis indicates the fraction of Arabidopsis genes in a functional category showing a BLAST match with the respective reference genome. The right to use this figure provided courtesy of members of the Arabidopsis Genome Initiative and Nature magazine. This figure first appeared in Nature 408, 796–815 (2000).
turned out that in the Arabidopsis genome genes may be found that share clear homology with human disease genes! However, the percentage of genes matching those of other species depended greatly on the functional category. Among the genes related to transcription only a small percentage (8–23%) had a match in another species, whereas among the genes related to protein synthesis up to 60% corresponded to a gene in another species. Overall, the similarity with prokaryote genomes was significantly less than with eukaryotes, but in the functional category of energy metabolism more than 30% of the plant genes were similar to a bacterial gene. This is obviously a consequence of the transfer of chloroplast genes to the nuclear genome. Maybe less surprisingly, in the category of cellular communication and signal transduction hardly any match was found between Arabidopsis genes and those of bacteria, but the correspondence with the
(unicellular) yeast genome was also relatively low (Fig. 3.25). Why has the Arabidopsis genome 87% more genes than Drosophila melanogaster? Two explanations have been given (The Arabidopsis Genome Initiative 2000). First, individual genes have been subjected to wide-scale amplification events, generating large arrays of tandems and dispersed gene families; unequal crossing-over may be the predominant mechanism involved. Second, the genome of A. thaliana has undergone a wholegenome duplication after it diverged from most other dicotyledons (Bowers et al. 2003), classifying A. thaliana as a cryptotetraploid species (see Section 3.1). These two genome-enlargement mechanisms have led to a considerable degree of genetic redundancy in the genome; that is, more than one gene has the same function. This is consistent with observations from genetic engineering studies which show that many genes can be knocked-out
COMPARING GENOMES
in Arabidopsis without any phenoypic consequences. The Arabidopsis Genome Initiative speculated that such large-scale duplication events may be needed to generate new functions, and that creating new functions by duplication is more common in plants than in animals, where novelties are more often generated by rearrangements of promoters and alternative splicing. The possibility of ancient polyploidy in model plants was analysed in more detail by Blanc and Wolfe (2004), using whole-genome data and EST sequences for 14 different species. The authors
estimated the sequence divergence between the two genes of a paralogous pair by looking at the average number of substitutions without amino acid alteration (number of substitutions per synonymous site, Ks; see Section 3.1). The frequency distribution of Ks values over all the genes is a cue to the timing of the duplication process (Fig. 3.26). Arabidopsis obviously has a peak in the frequency distribution around a Ks value of 0.8, which is indicative of synchronized duplication of many genes together. The most likely explanation for synchrony is a polyploidization of the whole
Initial peak Gene duplication
Secondary peaks resulting from ancient bursts of gene duplications
Exponential decrease Duplicated gene losses
Frequency of pairs (%)
105
Flat tail Pairs of duplicated genes under selective constraint
20
8
Arabidopsis
Rice
16
6
12 4 8 2 0
4 0 0.4
0.8
1.2
1.6
2.0
0.4
0.8
1.2
1.6
2.0
Number of synonymous substitutions per site (Ks) Figure 3.26 Top: theoretical age distributions of pairs of duplicated genes in a genome. The general decrease of the curve indicates that fewer and fewer genes remain as recognizable duplicate pairs with increasing time since duplication (measured by the number of substitutions per synonymous site, Ks). Peaks in the curve are indicative of ‘cohorts’ of synchronous duplications. Bottom: distribution of Ks values (a measure of divergence) of paralogous gene pairs in A. thaliana (left) and O. sativa (right). Distributions are shown for genomic gene sequences and for partial, sequenced cDNAs (ESTs). These two approaches result in practically the same pattern. The peak in the Arabidopsis curve around Ks ¼ 0.7–0.8 is indicative of an ancient polyploidy event. In the rice genome the distribution conforms mostly to the theoretical prediction of the top-left panel. After Blanc and Wolfe (2004). Copyright American Society of Plant Biologists.
106
INTRODUCTION TO ECOLOGICAL GENOMICS
genome, dated around 25–26.7 million years ago. This was followed by extensive rearrangements and an accelerated loss of genes, with the consequence that the Arabidopsis genome is now relatively small among plant genomes (Table 3.8) and constitutes a complicated mosaic of duplicated genes. In rice, the distribution of Ks values is much more similar to the theoretical expection following from a continuous process of individual duplications; however, there is a small elevation in the distribution, which according to Blanc and Wolfe (2004) is indicative of a partial chromosomal duplication dated at 70 million years (Fig. 3.26). Rice was the second higher plant species with a completely sequenced genome. In fact, two different projects were conducted, one by Syngenta focusing on the japonica subspecies (Goff et al. 2002), and one by the Beijing Genomics Institute, focusing on the most widely cultivated subspecies in China, O. sativa indica (Yu et al. 2002). The indica genome was 466 Mbp in size, with the number of genes estimated to be between 46 022 and 55 615; the japonica data were similar. Again these counts show that the number of genes in plants can be much higher than in animals. Rice and Arabidopsis belong to two different lineages of angiosperm plants, the monocotyledons and dicotyledons, which diverged around 200 million years ago; however, despite this ancient evolutionary divergence, there appears to be a considerable degree of homology between individual genes. Goff et al. (2002) estimated that 85% of the Arabidopsis predicted proteins had a homologue in the rice genome and that 31% of the proteins shared between Arabidopsis and rice were not found in fruit fly, nematode, or yeast. Almost all genes related to disease resistance in Arabidopsis are also found in rice. These data show that the defence against pathogens is a very basic element of plant biology and is highly conserved between dicotyledons and monocotyledons. Despite the large number of orthologues shared between Arabidopsis and rice, the degree of synteny between these two species is very limited. There is, however, a great deal of genome synteny (colinearity) between the species of the tribus Triticaceae, which in addition to rice includes
wheat, barley, rye, and some wild plants of the genus Aegilops (goatgrass). Analysing the genetic maps of the Triticaceae, Devos and Gale (2000) showed that only two chromosomal rearrangements need to be assumed to achieve colinearity between the genome of Aegilops tauschii (Tausch’s goatgrass) and Hordeum vulgare (barley), whereas seven rearrangements can explain the relationship between Ae. tauschii and rye (Secale cereale). Similar syntenic relationships hold for the family Poaceae in general. So the sequence of the relatively small rice genome allows identification of chromosomal segments in other species. However, on a smaller scale (microsynteny), numerous discontinuities in gene order between wheat and rice were identified by Sorrells et al. (2003), so the use of rice as a model for cross-species gene isolation in other Triticaceae could prove to be limited. The website for the Arabidopsis Information Resource (TAIR; http://arabidopsis.org) allows researchers to search for genes, proteins, alleles, markers, etc., and provides various analysis tools, such as sequence viewers, map viewers, BLAST protocols, and microarray analysis. There are also a great number of links, for example to the Arabidopsis Biological Resource Center, which has thousands of stocks in the form of clones or seeds, which are shipped around the world. The website includes a search engine for publications on Arabidopsis genomics in the widest sense. A frequently used platform for transcription profiling in Arabidopsis is the Affymetrix Arabidopsis Genome Array ATH1, which has probes for 24 000 genes. Specialized software packages for surveying and mining gene-expression data generated with the Affymetrix gene chips have also been developed (Zimmerman et al. 2004).
3.3.5
The deuterostome lineage
Genomes of higher animals are discussed jointly here with reference to the subkingdom Deuterostomia, which includes the phyla Pterobranchia, Echinodermata, Hemichordata, and Chordata. Nielsen (1995) also includes Phoronida and Branchipoda in the Deuterostomia, although most zoologists rank these two phyla with the
COMPARING GENOMES
protostome Lophotrochozoa group. Within the deuterostomes, genome sequencing is greatly biased towards mammals (see Table 1.1); however, in this section we will pay most attention to the genomes of the basal members of the Chordata. Two species of echinoderm, the California purple sea urchin, Strongylocentrotus purpuratus, and the green sea urchin, Lytechinus variegatus, are presently being sequenced, but an analysis of their genomes has not yet been made, so we will limit ourselves to the chordates. An interesting view of the origin of chordates and vertebrates is obtained from the genome of a sea squirt, Ci. intestinalis (Dehal et al. 2002; Can˜estro et al. 2003). This animal belongs to the chordate subphylum Urochordata, also called the Tunicata, after the tunic, a tough fibrous cover, excreted from the skin, in which the animal is contained. The Urochordata comprise three classes, one of them being the Ascidiacea or sea squirts. As an adult, Ci. intestinalis is sessile and attached to an underwater substrate where it filters food particles by pumping water through its elaborate pharynx, a basket-like structure, which fills most of the tunic. The name squirt is due to the regular pulses of water driven out of the exhalent siphon (Fig. 3.27a). Although aside from the gill slits in the pharynx no obvious characters indicate that the animal is closely related to vertebrates, the organization of the free-swimming ascidian larvae differs greatly from the adult and reveals it chordate body plan. In fact the larva of a sea squirt looks very much like a jawless fish, and is equipped with a chorda and a dorsal nerve cord, externally resembling a tadpole (Fig. 3.27b). Ci. intestinalis is a solitary, small, and relatively short-lived marine animal that colonizes solid substrates in the sublittoral zone, such as protected rocky shores, ship wrecks, and buoys. Due to its rapid colonizing capacity, it is sometimes a conspicous and abundant representative of the ‘fouling’ community. With their large filtration capacity, the animals act as filters and so contribute to purification of coastal waters, although by the same mechanism they accumulate chemicals and are used for biomonitoring of coastal sea pollution. Ecological work on Ciona and other tunicates aims at answering questions about
107
(a)
(b)
Figure 3.27 (a) Adult sea squirts. (b) A group of larvae. David Keys (photo) and Leila Hornick (artistic rendering), courtesy of the U.S. Department of Energy Joint Genome Institute. Ó 2005 The Regents of the University of California.
settlement in relation to density and intraspecific competition. Local populations seem to be highly dynamic and are characterized by cyclic retreat and recolonization events. Because of this type of population dynamics, ecologists are interested in geographical population genetic structure; microsatellite markers have been developed to support such analyses (Procaccini et al. 2000). The recently generated genomic information on
108
INTRODUCTION TO ECOLOGICAL GENOMICS
Ciona has, however, not yet penetrated into ecological studies. The genomes of tunicates are considerably smaller than those of vertebrates, and Ciona’s genome measures about 160 Mbp (Dehal et al. 2002). The gene content represents an interesting blend between ancient protostome signatures and chordate innovations, with some tunicate autapomorphisms added. Dehal et al. (2002) found a total of 15 852 protein-encoding genes and these were compared with the gene complements of Drosophila, C. elegans, puffer fish, and mammals. It turned out that 60% of the genes shared homology with fruit flies and nematodes, so these represent the core physiological and developmental machinery that is common to all bilaterian animals. A few hundred of these genes even have a stronger similarity to fruit fly or nematode than to any vertebrate, and so these genes represent functions that were present in the invertebrates, but were lost in the vertebrate lineage. Examples are chitin synthase (there is no chitin exoskeleton in chordates), phytochelatin synthase (the role of the zinc-binding molecule phytochelatin was taken over by metallothionein), and haemocyanin (the copper-containing blood pigment of arthropods and bivalves, absent from vertebrates). Another 16% of the genes lacked a homologue in the protostome groups, but had a clear vertebrate counterpart. These genes apparently have arisen on the deuterostome branch before the split between tunicates and vertebrates. Then another 21% of the genes had no clear homologue in fruit fly, nematode, fish, or mammal and represent tunicate-specific genes. Interestingly, Ciona’s genome has genes related to the synthesis and degradation of cellulose (cellulose synthase and several endoglucanases), genes that are never found in animals, only in plants, nitrogen-fixing bacteria, and bacteria living endosymbiotically with termites and woodfeeding cockroaches. The presence of these genes is related to the composition of the tunic, which is built largely of a cellulose-like carbohydrate called tunicin. How Ciona obtained these genes (a dramatic example of lateral gene transfer?) remains a mystery, but obviously it has been a very significant event in the evolution of this
group (Matthysse et al. 2004). Ciona’s genome has all the genes related to the innate immune system, as in Anopheles and Drosophila, but genes implicated in adaptive immunity could not be found. This suggests that the adaptive immune system is an apomorphy of the vertebrates, not of the chordates as a whole. Ascidians are also known for their extremely high body concentration of vanadium, several orders of magnitude higher than any other animal. Vanadium is accumulated in specialized blood cells, vanadocytes, where it is localized in intracellular vacuoles, together with a similarly high concentration of sulphate. Three vanadium-binding proteins, vanabins, have been characterized recently in Ascidia sydneiensis samea (Ueki et al. 2003) and five vanabins are encoded in the genome of Ci. intestinalis (Trivedi et al. 2003). However, a genome-wide analysis of the peculiar vanadium metabolism of ascidians has not yet been conducted. Turning our attention from urochordates to vertebrates, we note that three species of fish presently serve as genomic models, Takifugu rubripes, Tetraodon nigroviridis (both puffer fish, family Tetraodontidae), and Danio rerio (zebrafish, family Cyprinidae). T. rubripes (also known as Fugu rubripes) was proposed in 1993 by Sydney Brenner as a genomic model because with its small genome (470 Mbp) it would allow a cost-effective way of illuminating the human genome. In the far east, the fish is not only known for its small genome, but also for containing the extremely toxic compound tetrodotoxin, which, with an oral LD50 to mammals of 15 mg per kg of body weight is one of the most potent toxins known. Japanese men practice the habit of eating ‘fugu’ fish in restaurants that have obtained a special licence allowing the cook to separate the flesh from the hypertoxic liver and ovaria. The International Fugu Genome Consortium was formed in the year 2000, coordinated by the Institute of Molecular and Cell Biology in Singapore, in collaboration with groups in the UK and the USA (www.fugu-sg.org). The sequence was released less than 2 years later (Aparicio et al. 2002). Because the Takifugu genome assembly remained highly fragmented, another team,
COMPARING GENOMES
coordinated by the French sequencing centre Genoscope, started on a related puffer fish, Te. nigroviridis. This species has an even smaller genome and it offered the additional advantage of being a popular aquarium fish, easily maintained in tap water. The name puffer is derived from the fish’s habit of inflating itself when it is threathened. The analysis of the genome, published by Jaillon et al. (2004), revealed several interesting trends about gene duplications in the actinopterygian fish lineage (ray-finned fish, as opposed to lobe-finned fish, the Sarcopterygii, such as lung fish and coelocanths). The genome of Tetraodon measured 342 Mbp and had 28 918 putative protein-encoding genes, 1.8 times more than in Ciona, but somewhat less than in Takifugu (31 059). The slightly smaller genome size was ascribed to the absence of transposable elements, which are rather abundant in fugu fish. Careful analysis of
B
C
D
E
the content of each of the 21 Tetraodon chromosomes allowed reconstruction of a duplication event in the actinopterygian lineage (Fig. 3.28). Assuming that the original number of chromosomes of the ancestral gnathostome (jawed fish) was 12, a duplication event, followed by 10 different chromosomal rearrangements (fusions and translocations), can explain the present organization of the 21 chromosomes. The duplication is assumed to have taken place later in the evolution of the Actinopterygii, close to the origin of the Teleostei (modern bony fish), because some early-branching actinopterygian fish (bichirs, Polypteriformes) do not have the duplication. Similar conclusions were reached by Christoffels et al. (2004) in an analysis of the fugu genome. The model of Jaillon et al. (2004) is consistent with an earlier analysis of the vertebrate Hox genes by Amores et al. (1998). These authors had
F
G
H
I
J
K
L
Time
A
109
4 12 18 20 17
2
3
5
13
19 16
7
1
15 10 14 9 11
8 21
6
Figure 3.28 Model, inspired by detailed genomic analysis of the puffer fish Te. nigroviridis, showing how the present 21 chromosomes of teleost fish can be derived from an ancestral gnathostome karyotype with 12 chromosomes, by assuming a whole-genome duplication event followed by 10 different rearrangements of chromosomal segments (fusions and translocations). After Jaillon et al. (2004), by permission of Nature Publishing Group.
110
INTRODUCTION TO ECOLOGICAL GENOMICS
sequenced all 50 Hox genes of zebrafish and analysed paralogous and orthologous homologies across zebrafish, fugu fish, and mouse. The pattern of Hox-gene clustering could be explained by assuming that the ancestor of the Gnathostomata lineage had four clusters of Hox genes, each cluster consisting in principle of 13 genes. This system was continued in the Tetrapoda (amphibians, reptiles, birds, and mammals), but several losses led to a total of no more than 40 genes in the mouse, still arranged in four clusters. In the Actinopterygii lineage a duplication, identical to the one discussed by Jaillon et al. (2004), was assumed to have taken place, leading to eight clusters, followed by the loss of one cluster and several individual genes, leading to 50 Hox genes in zebrafish, arranged in seven clusters. How the ancestral gnathostome acquired its complement of four clusters, through two rounds of whole genome duplication (the 2R hypothesis), or through two local duplications, is not yet resolved (see the discussion in Section 3.1). The duplications of the Hox genes, both in the early evolution of the chordates and in the actinopterygian lineage, may have spurred innovation of the body plan and subsequent radiation of the highly successful vertebrate groups (Venkatesh 2003). Although the two puffer fish had a head start as genomic models because of their unusually small genomes, the ultimate fish model is the zebrafish, D. rerio. This species has many experimental advantages, including ease of culture, a transparant embryo, and ample possibilities for manipulations such as cell labelling, transplantation, microinjection, and mutagenesis. Genome analysis of zebrafish started with the production of extensive genetic maps, to accelerate the molecular localization of mutations, and to allow comparisons of genome location with other vertebrates (Woods et al. 2000). The Zebrafish Information Network (ZFIN) now serves as the zebrafish model organism database. The design of the network (http://zfin.org) is described by Sprague et al. (2001); it aims to maintain the definitive reference data-sets of zebrafish research information, and to facilitate the use of zebrafish as a model for human biology. The zebrafish sequencing project
is conducted by the Sanger Institute and is expected to be completed by the end of 2005 (www.sanger.ac.uk). To a certain extent, genomic information on zebrafish and fugu can be extrapolated to other fish species as long as genes are conserved. This cannot be stretched too far, probably not beyond the family Cyprinidae for the zebrafish. Ecologists working on other species will need to avail themselves of genomic sequences for their own model, but the community of fish biologists is rather fragmented (Clark et al. 2003). EST databases and microarrays are being developed for a considerable number of species including carp (Cyprinus carpio), large-mouth bass (Micropterus salmoides), fathead minnow (Pimephales promelas), killifish (Fundulus heteroclitus), and long-jawed mudsucker (Gillichtys mirabilis). The three-spined stickleback, Gasterosteus aculeatus (Gasterosteiformes), seems to be the most promising ecological partner to zebrafish. The three-spined stickleback is an originally marine, anadromous fish species, but populations have permanently colonized a variety of freshwater habitats. Being reproductively isolated from each other, these populations have developed into a wide range of subspecies with different morphologies, habitat preferences, behaviours, and life cycles. For example, in lakes in British Columbia two ecotypes are present, one specializing in benthic habitats, with a larger body-size, reduced spines and armour plates, and fewer gill rakers, the other a pelagic form that is more streamlined and has larger eyes and well-developed spines, gill rakers, and armour plates. Despite reproductive isolation in the field the two forms can be crossed by artificial means in the laboratory. Peichel et al. (2001) developed a genetic map from such crosses after genotyping the animals with 438 microsatellite loci. QTLs (see Section 2.1) were identified for biometric characters of spines, armour plates, and rakers, and these loci were mapped into the linkage groups defined by the microsatellite markers (Fig. 3.29). The example shows a remarkable genetic flexibility for independent modification of the size and number of different structures related to feeding and armour. A full-length genome
COMPARING GENOMES
Spine 1
(a)
111
Spine 2
Plates 1
2
3 45 6
7
Gill rakers Pelvic spine
(c) Spine 2
Lateral plate
(b) Long gill rakers Pelvic girdle Pelvic spine Short gill rakers
(d)
6 5 4 3 2 1 0
Raker #-a
LGXI 0
10
20
30
5 4
40
50
4
Spine1-a
LOD score
10
20
30
40
40
60
80
50
Spine1-b
1
LGI 0
5
20
40
60
80 100 120
0
LGII 0
20
4
Spine2-a
4 3
100
Spine2-b
3 2
2
1
1
LGVIII 0
10
20
30
40
50
60
5 PelSpine 4 3 2 1 0
LGXVI 0
2
2 1
0
Raker #-b
3
3
0
8 7 6 5 4 3 2 1 0
LGVIII 0
10
20
30
40
50
60
0 6 5 4 3 2 1 0
LGXI 0
10
20
30
40
50
Plate-a
LGXIII 0
10
20
30
40
Position in linkage group (cM)
Figure 3.29 Mapping of morphological traits differentiating subspecies of three-spined stickleback (Gasterosteus aculeatus). (a, b, c) Schematic drawings of fish indicating the biometric characters investigated. (d) LOD (logarithm-of-the-odds, log-likelihood ratio) scores for various characters as a function of the position (in centiMorgans, cM) in the linkage group. The peaks in the LOD scores show that there are two QTLs for the number of short gill rakers, one in linkage group (LG) XI (Raker #-a) and one in linkage group XVI (Raker #-b), two QTLs for length of spine 1, two for length of spine 2, one for pelvic spine length, and one for lateral late size. From Peichel et al. (2001), by permission of Nature Publishing Group.
112
INTRODUCTION TO ECOLOGICAL GENOMICS
analysis will aid greatly in the further identification of these QTLs. The three-spined stickleback is a fascinating system for exploring the genomic basis of adaptive radiation and parallel evolution (Foster and Baker 2004). The genomes of amphibians, reptiles, and birds are hardly explored at the moment, despite the fact that these animals are among the most popular ecological study objects. A genome sequence of the frog, Xenopus tropicalis, is presently being assembled (http://genome.jgi-psf.org), and is due for completion in 2005. A gene-expression tool is available for the African clawed frog, Xenopus laevis (Affymetrix GeneChip1 Xenopus laevis Genome Array), which can be used to study gene expression of over 14 400 X. laevis transcripts. A community of Xenopus investigators has developed an information resource, Xenbase (www.xenbase. org), where data on the sequence are offered along with genomic tools, as well as an archive of basic biological information about clawed frogs, including animations showing anatomical features and developmental patterns. Sequencing Xenopus was mostly inspired by the eminent possibilities that the animal offers for studies into early embryonic development and cell biology;
however, it may also have some relevance to ecological studies in herpetology. Regarding birds, the red jungle fowl (Gallus gallus) genome was recently assembled (International Chicken Genome Sequencing Consortium 2004; www.ncbi.nlm.nih.gov/genome/guide). This species, native to southeast Asia, is the ancestor of the various domestic breeds of chicken. The chicken genome will be an important resource for poultry science and applied avian studies, but its relevance to ecological studies of other birds is doubtful. As illustrated by a recent study (Postma and Van Noordwijk 2005), a tremendously rich system for investigating questions of population structure, life history, and behaviour is offered by species such as the great tit (Parus major) and so sequencing such species would be a true breakthrough for ecological genomics of birds. This completes our overview of prokaryotic and eukaryotic model genomes and the promises that they hold for ecology. The field of comparative genomics is rapidly growing and we believe that many discoveries are still in store. Comparative genomics provides an indispensable evolutionary foundation for the still teneral state of ecological genomics.
CHAPTER 4
Structure and function in communities
In this chapter we will address one of the most fundamental issues of ecology: the relationship between ecosystem processes and species richness in communities, or as Lawton (1994) put it, ‘What do species do in ecosystems?’ Ecological genomics opens new avenues to explore this question. We will review scientific evidence concerning genome diversity in the environment and the function of genomes in nutrient cycles. Because microorganisms are in a key position at many crucial links of nutrient cycles, most of this chapter will deal with the ecological genomics of microorganisms.
4.1 The biodiversity and ecosystem functioning synthetic framework A summary of the ecological framework that forms the background to this chapter is given by Naeem et al. (2002). At the beginning of the 1990s ecologists reformulated a question that had already existed for a long time in ecology; namely, what is the relation between structure and function in ecosystems? Structure includes all quantities that can still be observed in a snapshot of the system, at a particular moment in time. This includes things like species richness, biomass, dominance structure, and feeding groups. The functional aspects include the processes that cannot be observed in a snapshot, but need to be monitored in time, such as primary production, respiration, degradation of organic matter, and nitrification. With the staggering loss of biodiversity that we observe today, the question may be asked, how will ecological functions respond? Conversely, if we are interested in
protecting functions, is it possible to achieve this aim through protecting the structure? An answer to these questions requires a scientific underpinning of the ecological importance of biodiversity. Since 1993, when a group of scientists congregated in Bayreuth and the seed for the ‘biodiversity and ecosystem functioning synthetic framework’ was planted (Schulze and Mooney 1993), the role of biodiversity in maintaining ecological functions has been subject to intense theoretical and experimental analysis. These developments were also spurred by the Rio Convention on Biological Diversity held in 1992, followed by the spreading realization that global biodiversity is under serious threat. The issues were addressed by theoretical models, foodweb analysis, microcosm experiments, and field-plot investigations. In general it is assumed that there is an asymmetrical relationship between structure and function; that is, protection of functions does not require protection of all structures, whereas on the other hand protection of structures will always guarantee protection of functions. However, it is still a matter of debate what kind of form this asymmetrical relationship should take. Several alternative hypotheses have been formulated that differ from each other in the extent to which a decrease in the number of species endangers an important function of the system. The hypotheses are discussed in terms of graphs in which some ecosystem process is plotted as a function of the number of species in the ecosystem (Fig. 4.1). The argument is, what happens to ecosystem function (plotted on the vertical axis) when biodiversity 113
Ecosystem process
114
INTRODUCTION TO ECOLOGICAL GENOMICS
Redundancy
Linear
Idiosyncratic
Keystone
Discontinuous
Rivet
0 Biodiversity Natural loss level
0 Biodiversity Natural loss level
Biodiversity Figure 4.1 Graphical representation of six different hypotheses about the relationship between biodiversity and ecological processes. The central idea is that, commencing with the natural level of biodiversity and moving in the direction of a decrease (to the left), there are different ways in which the function of a system can change; in every case it ends at a zero level when no biodiversity is left. From Naeem et al. (2002), with permission from Oxford University Press.
(plotted on the horizontal axis) decreases or increases? Although Fig. 4.1 pictures six different relationships, other authors have distinguished no less than 50 different hypotheses, which can, however, be categorized in three main classes (Lawton 1994; Naeem et al. 2002), as follows. The redundant species hypothesis. With a decrease in biodiversity, ecosystem functions are unaffected up to the point where only a small number of key species remains; if one of these species is removed, the system collapses. The idea is that many species in the ecosystem are redundant in the sense that they are at least partly substitutable while their contribution to the ecosystem process can be taken over by other, functionally similar, species The rivet hypothesis. With a decrease in biodiversity, ecosystem functions decrease proportionally
(linearly or in steps). The idea is that every species makes a (smaller or larger) contribution to the process, so if it is removed, that contribution is subtracted from the process. The idiosyncratic hypothesis. There is no universal relationship between structure and function; rather, the relationship is ecosystem-specific. In one case there may be a strong reduction of function with a loss of biodiversity, in another case there may hardly be an effect or maybe even an increase. The general feeling among ecologists is that functional redundancy indeed plays an important role in many ecosystems. The argument is supported by observations on systems in which members of the community are suppressed by toxicants. In soil ecology it is well known that respiration is considerably less sensitive to the effects of toxic substances than nitrification, which is attributed to the fact that all heterotrophic organisms contribute to respiration, while only a few bacterial genera are responsible for nitrification (Domsch 1984). In studies of heavy-metal contamination in forest ecosystems, it has been demonstrated that in a gradient of pollution around a metal-smelting works a considerable loss of species of fungi can occur, whereas soil respiration is hardly affected and decreases only at the very high levels of pollution close to the source (Nordgren et al. 1983). Still, after more than a decade of ecological research the central question of the synthetic framework cannot be answered in a simple way. It is still very difficult to refute any one of the six hypotheses of Fig. 4.1. In very general terms, one may conclude that a minimal number of species is necessary to allow a system to function, and a larger number of species is necessary to guarantee stability of the processes in a changing environment (Loreau et al. 2001). In addition, two points have emerged showing that analysis of the problem may benefit from narrowing down the scope of the question. First, it appears that the way in which biodiversity influences ecological processes depends on the way in which these processes are limited. This issue is of evident importance in aquatic
STRUCTURE AND FUNCTION IN COMMUNITIES
ecosystems, in which primary production can either be limited by the substrate (nutrient loading, such as phosphorus or carbon), or by the capacity of the organisms to process that substrate (the biomass and the number of producer species). In capacity-limited systems the substrate is supplied rapidly enough so that every functional unit is saturated and the rate of throughput is insensitive to changes in the rate of substrate supply. An example is nitrogen fixation in cyanobacteria, which is usually not limited by the availability of nitrogen gas but by the biomass of fixating organisms, which in turn are limited by other factors (e.g. zooplankton grazing, phosphate). A capacity-limited process is sensitive to a loss of biodiversity, because any reduction in the number of functional units will decrease the process rate. In a substrate-limited system, the capacities of the functional units are not fully deployed and if such a system loses biodiversity the overall throughput may remain unchanged because each functional unit can easily increase its share in the process (Levine 1989; Van Straalen 2002). Substrate limitation may be less important in terrestrial ecosystems and even less in below-ground systems, because of the abundance of dead organic matter as a food source for the decomposer community. However, even soil communities may be limited, for example by nutrient imbalance (Pokarzhevskii et al. 2003) and by microhabitat heterogeneity causing spatial dislocation between the food and the hungry. Second, there is an increasing awareness that biodiversity as such is not as important as biodiversity in relation to the properties of the species. That is, to evaluate the effects of diminishing species richness on ecosystem processes we must look at the biodiversity of species attributes in a community, not only at species numbers. As an example, consider the work by Walker et al. (1999), who investigated vegetation structure in Australian savannahs. The authors noted that dominant plant species in the same community tend to be positioned apart from each other when classified according to species-specific attributes, such as height, biomass, specific leaf area, longevity, and leaf-litter quality. Rare species may contribute
115
to resilience of the vegetation because they often have attributes similar to the dominant species and may act as a functional substitute. Another way to phrase the issue is the principle of complementarity: the stability of the system benefits if species complement each other in their function. The argument extends to communities of decomposer invertebrates. In microcosm experiments with earthworms, isopods, and millipedes Heemsbergen et al. (2004) demonstrated that the effect of detritivore invertebrates on soil respiration and litter breakdown depended not on the species composition per se, but on the functional dissimilarity within that community. The suggestion was that positive interactions in the community cause a functionally dissimilar assembly to have a larger effect on soil processes than a functionally similar assembly, independent of the number of species. The biodiversity and ecosystem functioning synthetic framework has not yet been probed using the genomics approach. Yet there is a lot of mechanistic knowledge, especially in microbiology, about the actors behind biogeochemical cycles. This knowledge has increased tremendously with the large-scale sequencing and transcription profiling of microbial genomes. In the sections below we explore a possible link between the two fields of investigation; community ecology and microbial functional genomics.
4.2 Measurement of microbial biodiversity To estimate the number of species that are present in a specific habitat is more difficult than it may seem. The situation is aptly described by the following phrase from the classical book by Charles Elton (Elton 1927), the founder of animal ecology: Two boys of rather good powers of observation were sent into a wood in summer to discover as many animals as they could, returned after half an hour and reported that they had seen two birds, several spiders, and some flies— that was all. When asked how many species of all kinds of animals they thought there might be in the wood one replied after a little hesitation ‘a hundred’, while the other said ‘twenty’. Actually there were probably over ten thousand.
116
INTRODUCTION TO ECOLOGICAL GENOMICS
Now it is obvious that if Elton’s boys had been asked to include microorganisms, their estimate would have been even more inaccurate. For obvious reasons, estimating the biodiversity of microorganisms is more difficult than estimating species richness of plants or animals. In addition, microbiologists struggle with an even more fundamental question; that is, it is often not clear what constitutes a microbial species. According to classical bacteriological taxonomy, an isolate is recognized as a proper species if its morphology is described plus some key aspects of its metabolism (trophic system, substrate use, etc.). Two isolates are considered to belong to the same species if their DNAs are similar by more than 70% or if there is less than a 5 C difference in the melting temperature of a DNA–DNA hybridization (Wayne et al. 1987). Obviously, species that cannot be put into pure culture cannot be characterized in this way. It is estimated that anything between 50 and 99% of microorganisms may belong to this group of unculturables and these remain undescribed as species, although parts of their genome may be sequenced from the environment. Why so many organisms cannot be cultured in the laboratory is unclear and probably there are many reasons, including specific growth conditions, unknown nutrient requirements, very slow growth, and special surfaces to which cells must attach. Recently, microbiologists have discovered that some ‘uncultivable’ bacteria can be brought into culture when placed in close proximity to other species, from which they are separated only by a membrane; apparently, chemical signals from other members of the community are sometimes crucial to induce growth (Kaeberlein et al. 2002). We will see later in this chapter that genomics approaches provide another solution to the problem: the DNA of species in the environment can be assembled and its functions characterized without even attempting to put them into a culture tube. Microorganisms have been given little attention in ecological studies until recently. The last decade has produced a new awareness of microbial diversity and the suitability of microorganisms to address questions of fundamental ecological
importance (Øvrea˚s 2000; Horner-Devine et al. 2004; Kassen and Rainey 2004; Jessup et al. 2004). Microorganisms have been reported from extreme habitats in which they are the only type of organism surviving, such as hot springs, deep ocean vents, volcanic crater lakes, and sediments under permanent ice cover. Such extreme habitats hold many surprises in store. For example, a completely new phylum of Archaea, the Nanoarchaeota, was discovered in a hot submarine vent north of Iceland and a new division of Euryarchaeota was found in a hypersaline anoxic basin in the Mediterranean Sea (Huber et al. 2002; Van der Wielen et al. 2005). The development of universal phylogenetic trees on the basis of genes that are common to all life forms has demonstrated that the biodiversity of the Bacteria and Archaea is at least as large as that of the whole domain of the Eukarya (Fig. 4.2).
4.2.1
Diversity of small-subunit rRNA genes
In the so-called polyphasic taxonomy of current microbiology a species is differentiated on both genetic and phenotypic grounds. The genetic characterization is derived from the sequence of the small-subunit rRNA gene. From basic biochemistry we know that the size of ribosomes may be characterized by Svedberg units (S), a measure of sedimentation velocity during ultracentrifugation (1 S corresponds to 1013 s). The prokaryotic ribosome measures 70 S and is made up of a small subunit (SSU) of 30 S, consisting of 21 proteins and an RNA molecule of 16 S, and a large subunit (LSU), measuring 50 S, consisting of 34 proteins and two RNA molecules, one 23 S and the other 5 S. In the prokaryotic genome, the genes encoding these RNAs are organized in an rRNA transcription unit (rrn region), with the 16, 23, and 5 S rRNA genes lying behind each other, separated by spacers and being transcribed as one unit. The 16 S rRNA gene (also called the SSU rRNA gene) has been chosen as the basic diagnostic instrument of prokaryote phylogeny and classification. The gene is assumed to fall into the category of essential genes, which are not, or at least infrequently, subjected to lateral transfer (see Section 3.2).
117
ha
no
th
Me
tha
er m us no py rus
Methanococcus
et
ccus moco r ium cte
M
Th Marine lo w tem er mo p pla s Ar ma ch ae og lo bu s
um act er i Fla vob
ter ibac Flex
Ther
oba
llum Methanospiri
78 P PJ 27 PJP
Marine Gp. 1 low temp G Gp. p. 1 low te 2 m p pSt. St. 12 low tem p 2 p Gp. 2 3 lo w PyroSulfolo temp b d ic Th tium us er mo Archaea pr ote us
m iu ob m er . 50 Th pSt
t
Aq
x
era lof
Ha
roo
PO P uif S8 6 e EM17 x
lam yd
Gl
n tha
ch
oc oc oe cus o ba ia cte Chloro r bium Leptonem a Clostridium Bacillus m cteriu er a b o t Heli bac o r 9 Ar th S1 P PO s us ga u rm to lex rof The rmo o l h e C Th Ch
Me
ndrion Mitocho io clus docy ichia vibr Rh o r lfo che esu st Es D pla ro
ne
lo Ch
Sy
Agrobacteriu m
Bacteria
Planctom yces
STRUCTURE AND FUNCTION IN COMMUNITIES
us prin
Co Ho mo
0.1 changes per site
Gi
na
mo s
Naegleria
ho
Enc
um
Entamoeba
telium
dia
c Tri
sar
ha
zoon
orp
om
ri Va
alito
eph
ma
noso Trypa Euglena
Eukarya
ar
Phy
Dictyos
Pa ra
me c Babesium ia
Zea Cryptomonas a Achlyria sta yra o C ph r Po
Figure 4.2 The universal phylogenetic tree of life, based on small-subunit rRNA gene sequences. Reprinted with permission from Pace (1997). Copyright 1997 AAAS.
The size of ribosomal components is slightly different in eukaryotes (Table 4.1). The SSU rRNA is 17–18 S in eukaryotes (18 S in vertebrates) and the LSU rRNA molecule, which is 23 S in prokaryotes, is enlarged to 28 S. In addition, eukaryotes have the prokaryote rRNA genes in their mitochondria and chloroplasts. The fact that all life forms have the same basic organization of rRNA
genes allows comparison across domains and the development of phylogenies such as that shown in Fig. 4.2. The reason why the 16 S rRNA is particularly suitable as an anchor for prokaryote classification is that it shows a mosaic of conserved and variable regions. The molecule is shown in Fig. 4.3. A characteristic feature is that the RNA molecule
118
INTRODUCTION TO ECOLOGICAL GENOMICS
Table 4.1 Composition of ribosomes of prokaryotes and eukaryotes Prokaryotes Overall size Size of SSU Proteins in SSU RNA in SSU Size of LSU Proteins in LSU RNAs in LSU
70 S 30 S 21 16 S, 1500 bp 50 S 34 23 S, 2900 bp 5 S, 120 bp
Eukaryotes 80 S 40 S 30 18 S, 2300 bp 60 S 50 28 S, 4200 bp 5.8 S, 160 bp 5 S, 120 bp
LSU, large subunit; SSU, small subunit. Source: From Madigan et al. (2003).
folds into a determinate structure with many short duplex regions as well as hairpin loops. The secondary structure of the molecule is crucial to its function in translation of mRNA to peptides, and so the nucleotide sequences of the duplex regions are highly conserved. Other parts of the molecule can undergo substitutions without change of function and so these parts provide an apomorphic signature, characterizing a certain prokaryotic lineage. There are nine variable regions in the molecule, numbered V1–V9 (Fig. 4.3). Microbiologists have agreed that a 3% difference in the overall 16 S rRNA sequence is to be considered as the species boundary. Justification for this is obtained from the fact that if the genomic DNA of two bacteria hybridizes by more than 70% (see above), the 16 S rRNA always differs by less than 3% (Madigan et al. 2003). Since the genomic hybridization threshold is considered a valid species boundary, two organisms differing in their 16 S rRNA by more than 3% can always be considered different species. However, the converse is not true; there are many valid species differing by less than 3% in their 16 S rRNA. For example, in the genus Bacillus there is a high degree of similarity among species and some species (Bacillus cereus and Bacillus anthracis) even have completely identical 16 S rRNA sequences. Because of the diagnostic value of the 16 S rRNA gene, an enormous number of sequences has accumulated in the international nucleotide
sequence databases (GenBank, EMBL). There is an internationally accepted system for numbering the base-pair positions, modelled on E. coli. The Ribosomal Database Project (RDP-II; http:// rdp.cme.msu.edu) provides alignment and annotation of a large number of rRNA sequences to serve microbial taxonomy and biodiversity research. In the 9.0 release of RDP-II, an alignment is provided of 50 000 SSU rRNA sequences, prepared using a program that incorporates constraints from rRNA secondary structure (Cole et al. 2003). An annotated collection of more than 700 oligonucleotide probe sequences targeting rRNAs is available from probeBase (www.microbial-ecology.de/probebase; Loy et al. 2003). The use of databases for optimal probe design has become a crucial element in the development of oligonucleotide (synthetic) microarrays (DeSantis et al. 2003). The 16 S rRNA gene is the basis for a popular method of community profiling called denaturatinggradient gel electrophoresis (DGGE). The principle of this method was borrowed from medical research, where it was applied for the detection of mutations. Muyzer et al. (1993) suggested that the same method could be applied to PCR-amplified 16 S rRNA genes. A PCR was designed that amplifies a segment of the gene, using primers targeting sites of the molecule in which the sequence is conserved across all bacteria (universal bacterial 16 S primers). The amplicon, however, is chosen to span a variable region, so that when the PCR is applied to an environmental sample containing a community of microorganisms, a mixture of fragments is produced with identical lengths but different sequences. These fragments are separated on the basis of differential sensitivity to denaturation in a gradient of urea (DGGE) or temperature (temperature-gradient gel electrophoresis, TGGE). The sensitivity to denaturation is determined mainly by the GC content of the sequence. Sequences with higher GC content will denature later and run further on the gel. To prevent complete separation of the two DNA strands, a so-called GC clamp is included in the amplicon by extension of the 5 0 primer with 40 bp of a GC-rich sequence; this ensures that the sequence is halted in the gel as a stable partially melted molecule. Preferably the profile is
STRUCTURE AND FUNCTION IN COMMUNITIES
39
119
43
42
41
V7 40 P37 -2
25
44
38
P37 -1 26
V6
27
37 46
36
29
45
V5
24
V8
28
35
34
30
V4
33
31
23
22
47
32 1
21
2 20
P23 -1
3
48
49
51
V9
19 4
18
50
V3 17 16
31
5
15
6
14
V1
7 13
8 12 11 9
V2 10
Figure 4.3 Model of a 16 S rRNA molecule, showing nine variable regions numbered V1–V9. Each dot represents a nucleotide and its variability across species is indicated by the size of the dot (in five classes). From Neefs et al. (1993) with permission from Oxford University Press.
120
INTRODUCTION TO ECOLOGICAL GENOMICS
calibrated by marker samples that contain a mixture of known sequences isolated from a clone library from the same environment. The 16 S rRNA-targeted DGGE approach has become one of the most popular methods with which to profile microbial communities in the
environment. An example of such a study is the work by Ro¨ling et al. (2001). These authors were interested in microbial communities of groundwater and their potential to degrade aromatic compounds (benzene, toluene, xylene), leaching from a landfill. Groundwater samples
Similarity (%) 30
40
50
60
70
80
90 100
Pollution
Redox
P1 P1 P2 P2 C P1 P1 P1 P1 P1 P1 C P1 P1 P1 C C C C C C C C C C C C C C
Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) Fe(III) NO – 3
Fe(III) NO3– NO – 3
Fe(III) Fe(III) NO3– NO3– NO3– NO3– NO3–
Figure 4.4 DGGE profiles of bacterial communities in an aquifer polluted by landfill leachate. Profiles are shown for samples at different distances and depths; for each lane the level of pollution is indicated (P, in the plume; C, outside the plume, below, above or remote). The right-hand column identifies the dominant redox process of the sample: Fe(III), iron reduction; NO 3 , denitrification. The profiles were clustered on the basis of similarity measured by Pearson’s correlation coefficient, using the unweighted pair-group method using an arithmetic average (UPGMA). There is a clear separation between clean samples and polluted samples, although the latter group comprises three clean samples (which were actually suspected of being influenced by the plume as well). Degradation of contaminants is taking place under iron-reducing conditions. From Ro¨ling et al. (2001) by permission of the American Society for Microbiology.
STRUCTURE AND FUNCTION IN COMMUNITIES
were taken from bore holes at different distances and microbial communities were profiled using DGGE. Profiles from samples taken in the plume were clearly different from those outside the plume (Fig. 4.4). Sequencing of cloned 16 S rRNA gene fragments confirmed the trend. In the uncontaminated area upstream of the landfill the community was dominated by Betaproteobacteria, but directly beneath the landfill Gram-positive bacteria dominated. At the end of the gradient the community was dominated by Deltaproteobacteria whereas Betaproteobacteria reappeared. The main determinant of community structure was the redox potential; under iron-reducing conditions in the plume the community was dominated by Geobacter species, which are known to be able to degrade organic compounds. In addition to DGGE, variation in 16 S ribosomal genes can also be visualized by restriction polymorphisms. Amplified ribosomal DNA restriction analysis (ARDRA) applies a restriction to rRNA genes amplified by PCR using universal bacterial primers. Restriction of the PCR products will lead to a collection of differently sized DNA fragments and when these fragments are separated by electrophoresis a profile is seen that is characteristic of a community, due to differences between species in the restriction sites. A further development in this direction is fluorescently tagged ARDRA (FT-ARDRA), in which the terminal fragment of the restriction is marked by labelling one of the two PCR primers, thereby producing only one band per species. Following separation of the fluorescently labelled fragments in an automatic sequencer with laser detection, a species-composition profile of the community is obtained. FT-ARDRA is a form of terminal restriction fragment length polymorphism (T-RFLP); however, this more general term is often used interchangeably with FT-ARDRA.
4.2.2 Microarray-based biodiversity assessment Because gel-based approaches such as DGGE have the disadvantage that only a limited number of species can be resolved, more sophisticated methods using genomics technology have been
121
developed for profiling complex communities. ‘A ray of hope’ is expected to come from microarray-based hybridization approaches (Polz et al. 2003; Zhou 2003). In Section 2.3 microarrays were introduced as tools for transcription profiling and this is their most common use in ecological genomics studies of plants and animals. In microbial ecology, however, microarrays are mainly used for identification (detection) purposes. The principle is that DNAs from a microbial community, or PCR-amplified fragments of environmental DNA, are hybridized to a microarray which contains probes from a series of known species. Those species in the community whose probes are on the microarray will show their presence by hybridization. Unlike in the case of transcription profiling, hybridizations are usually not conducted with two pools of DNA in competition, unless two communities are being compared directly. Using microarrays for detection, complex communities can be very rapidly profiled without the need for culturing. In principle, the technique can even be implemented in a portable system, allowing species identification in the field within 50 min (Bavykin et al. 2001). However, we need to realize that, unlike gel-based methods such as DGGE, microarray-based profiling can only be conducted with species for which genomic information is already available, because this information is required to develop the probes on the array. This implies that the only species that are detected are those that we already have knowledge of—although sometimes that knowledge is limited to the probe sequence alone. We will never find completely new species using microarray-based detection. Four different types of microarray can be distinguished depending on the nature of the probes used (Zhou 2003; Zhou and Thompson 2004; see Table 4.2). One approach is to use the entire genome of a number of target species whose presence is expected (community genome arrays). This approach, based on the principle developed by Voordouw et al. (1991), but then called reverse sample genome probing, does not require prior knowledge of genome sequences, it just spots the whole bacterial genome on the array. This can be
122
INTRODUCTION TO ECOLOGICAL GENOMICS
Table 4.2 Overview of four types of microarray approach used in microbial ecology to detect microorganisms in the environment
Source of probes Type of information provided Specificity Sensitivity (ng of DNA detectable)
Community genome arrays
Genome fragment arrays
Phylogenetic arrays (phylochips)
Functional gene arrays
Entire genomic DNA of species Community composition Species
Random fragments of DNA from target species Relatedness between species Species, strains
Selected regions of 16 S rRNA genes Taxonomy, species identification Species, strains, mutants
Genes with specific function in an ecological process Potential functions
0.2
Not determined
Not determined
All species within 80–90% sequence homology 1–8
Source: Adapted from Zhou (2003).
done with microorganisms that can be isolated in pure culture; the array then detects the species in a sample from the environment. Another, similar approach is to use random genome fragments rather than the entire genome (random-genome fragment arrays). The third type of microarray uses 16 S rRNA sequences. Because this gene is diagnostic for prokaryote classification, this type of microarray is called a phylogenetic microarray or phylochip (perhaps taxochip would be a better qualification, because the information retrieved is essentially taxonomic, not phylogenetic in the evolutionary sense). The final approach is to develop probes on the basis of specific functional genes, often genes related to nutrient cycles such as nitrification or sulphate reduction. These arrays are called functional gene arrays; however, it should be noted that they only detect the presence of genes, not their activity or the functions themselves. Depending on which parts of the gene are used as probes, functional gene arrays may detect the same gene in a wide variety of organisms, so the information retrieved is not of a taxonomic nature, unless species-specific parts of the gene are targeted. Functional gene arrays can be equipped with oligonucleotide probes (50–70 bp) and manufactured using photolithography, or they can be prepared by spotting longer gene fragments (200–1000 bp), which are amplified by PCR from a clone library. The proof of concept for microarray-based detection of bacteria was given by Cho and Tiedje (2001). These authors used four species of
Pseudomonas as reference for the preparation of probes. The genome of each species was fragmented mechanically and fragments of 1–2 kbp (60–90 per species) were spotted on a coated slide (Fig. 4.5). The fragments represented 1–3% of the genome. The array was then tested by hybridization with labelled DNA from one of the species and with related species. It turned out that each species was recognized uniquely and other Pseudomonas species whose DNA was not on the array were detected with lower intensity. Comparing the hybridization patterns of related species and strains, a distance tree could be developed that was consistent with the phylogenetic tree obtained from 16 S rRNA sequences. Due to the use of many probes per species, the sensitivity of this approach is potentially very high; however, for profiling complex communities very large arrays would be necessary (e.g. for 1000 species, each represented by 100 probes, an array of 100 000 positions would be required). This is possible with oligonucleotide arrays prepared by photolithography, but more difficult with spotted arrays. Also, since the probes are a random selection from the genome, many of them may represent conserved genes that are not diagnostic of the species. This work nevertheless showed that the principle of microarray-based detection was valid and it has triggered further developments. A strong argument in favour of the use of microarrays in microbial detection is that it can, at least in principle, replace PCR amplification of target sequences. PCRs applied to a heterogeneous
STRUCTURE AND FUNCTION IN COMMUNITIES
123
P. fluorescens P. chlororaphis P. putida P. aeruginosa
Figure 4.5 Format of a microarray used by Cho and Tiedje (2001) for bacterial species determination. Random fragments of 1–2 kbp from the genome of four Pseudomonas species were spotted in duplicate on amino silane-coated glass slides. Duplicates were placed in the upper and lower halves. Positive and negative controls (genes from yeast and bacteriophage l) are indicated by circles and rectangles, respectively. The different shades of grey indicate the ratio between the channels of test DNA (Cy3) and reference DNA (Cy5). From Cho & Tiedje (2001) by permission of the American Society for Microbiology.
collection of DNAs from the environment often suffer from preferential or aspecific amplification of certain sequences over others (PCR bias), especially when the PCR is addressed to a specific, limited group of organisms. This is due to the initially small number of template copies that must be found in a large background of DNA to be ignored. Biodiversity screens in which a PCR step is included are vulnerable to the criticism that the diversity in the amplified assemblage may be different from the diversity of the environment. With microarrays the PCR step can (in principle) be skipped altogether, as demonstrated by some authors (Small et al. 2001; Urakawa et al. 2002; El Fantroussi et al. 2003). In this strategy RNA extracted from environmental samples is fragmented, labelled, and hybridized directly with the microarray. The target RNA will consist mostly of rRNA that hybridizes with 16 S rRNA probes on the array. A multiple melting-curve analysis is then performed to detect aspecific hybridizations. Although this strategy seems to be particularly applicable in an environmental context, most authors still prefer to start with a PCR to obtain sufficient target DNA for hybridization (e.g. Loy et al. 2002; Peplies et al. 2003; Taroncher-Oldenburg et al. 2003). Such a PCR uses universal bacterial primers (targeting all bacteria) to minimize
possible bias, after which specific groups are picked out by microarray hybridization. Oligonucleotide phylochips are presently considered as the most promising instruments for microbial detection, because of the enormous capacity of such chips and the possibility of maximally exploiting the information in rRNA sequence databases. From the databases, 20-mer probe sequences can be developed that target different taxa in the hierarchical classification system of microorganisms. For example, in a microarray system targeting E. coli some probes are universal for all bacteria, others are specific for the phylum Proteobacteria, and still others for the g subdivision of Proteobacteria; then some probes target only the group of enteric bacteria and the most specific probes address specific genera of Enterobacteria, such as Escherichia or Salmonella. So DNA from E. coli should hybridize with all these probes, and DNA from Nitrosomonas, a betaproteobacterium, should hybridize only with the first two. From the hybridization pattern of a complex community an indication can be obtained of the taxonomic composition; however, not all groups of bacteria can be resolved in this way. In most cases the discriminatory power is limited to genera; in several cases, when genera are very similar in their 16 S rRNA gene, only the higher taxonomic levels
124
INTRODUCTION TO ECOLOGICAL GENOMICS
are resolved. The taxa (be it genera, families, or divisions) that can be detected in this way are designated as operational taxonomic units (OTUs). The strategy of hierarchical arrangement of SSU RNA probes was applied by Wilson et al. (2002) to develop a photolithography gene chip with 31 179 oligonucleotide probes. As in the case of gene chips used for transcription profiling, each 20-mer probe was paired with a control probe in which the eleventh nucleotide was replaced by a mismatch position; these control probes should not hybridize with the target and so serve to control for nonspecific effects. The number of probe pairs targeting a specific taxon ranged between 1 and 70, depending on the completness of sequence information of the rRNA region. In total there were 1945 prokaryotic and 431 eukaryotic sequences represented on the chip. By way of a test, the chip was used to detect bacteria and fungi recovered from filtered air samples. The results showed that the airborne microbial assembly was dominated by bacteria from the Gram-positive BacillusLactobacillus-Streptococcus subdivision and the Grampositive high-G þ C group; in addition significant amounts of ascomycete and basidiomycete DNA (presumably spores) were found in the ‘aeroplankton’. There was a good correspondence between chip-based detection and PCR amplification of 16 S RNA genes followed by cloning and sequencing; however, cloning revealed 28 novel sequences that did not correspond well to any phylogenetic group in the RDP database and so were not detected by the microarray. The principle of microbial detection in air was further developed with a gene chip of 500 000 probes allowing detection of 9121 OTUs (Andersen et al. 2004). A sampling campaign was conducted with this array to survey the air of two cities in
the USA, Austin and San Antonio, over several months. The use of microarrays to gauge air biota had a mainly medical relevance, and was specifically motivated in the USA by the need for bioterrorism defence strategies against possible mischievous release of pathogenic agents. In the monitoring campaign, significant seasonal trends were observed; the abundance of bacteria was correlated negatively with air temperature and positively with the dew point. An interesting observation was that, although the time trends were similar for the two cities, the compositions of the microbial assemblies were different, indicating that in addition to climatic determinants there are local sources of airborne microorganisms. Low levels of Bacillus anthracis (causing anthrax) and Clostridium botulinum (causing botulism) were detected, because these bacteria are normally found associated with livestock and occur naturally in sediments. Inevitably, some of these bacteria are aerosolized and become airborne with the wind. It is therefore necessary to know the background levels of these pathogens so as to single out situations hazardous to human health. Similar detection strategies applied in ecological settings, for example using DNA from soils, sediments, or water, meet more difficulties than air sampling, because the chemical matrix in which the environmental DNA is contained is much more complex. In particular, humic derivatives are notorious for causing disruption to DNA samples. Nevertheless, several successful attempts have been made. Loy et al. (2002) developed an oligonucleotide microarray called SRP-PhyloChip for cultivation-independent detection of sulphatereducing prokaryotes (SRPs). Sulphate reducers form a highly heterogeneous, polyphyletic, group of bacteria. The capacity to gain energy from
Figure 4.6 Showing a phylogeny of sulphate-reducing bacteria in the orders Desulfobacterales and Syntrophobacterales of the Deltaproteobacteria. The tree was developed on the basis of 16 S rRNA sequences using maximum parsimony and other methods. Non-sulphate reducers are underlined. The probes used on the array are indicated by short names such as DSTAL, DSRHP185, etc. Braces indicate the taxonomic span of the probes, e.g. DELTA495a, DELTA495b, and DELTA495c target all Deltaproteobacteria, DSB706 targets the upper clade of 11 species plus T. norvegica, DSB230 targets a group of eight species within the upper clade, and DSRHP185 targets two species of the genus Desulforhopalus. Numbers in parentheses next to a probe name indicate that more than one probe was used to target different parts of the rRNA molecule, e.g. five different DSTAL probes target the genus Desulfotalea. The codes after the species represent GenBank accession numbers of their 16 S rRNA sequences. Adapted from Loy et al. (2002), by permission of the American Society for Microbiology.
DSACI (2) TDRNO (3)
Desulfobacter latus, M34414 DSBLA623 Desulfobacter halotolerans, Y14745 Desulfobacter vibrioformis, U12254 Desulfobacter postgatei, M26633 DSB623a Desulfobacter curvatus, M34413 DSB623b Desulfobacter hydrogenophilus, M34412
}
Desulfotignum balticum, AF233370 Desulfospira joergensenii, X99637 Desulfobacula phenolica, AJ237606 Desulfobacula toluolica, X70953 “Desulfobacterium vacuolatum”, M34408
}
“Desulfobacterium niacini”, U51845 Desulfobacterium autotrophicum, M34409 Desulfofaba gelida, AF099063 Desulfofrigus oceanense, AF099064 Desulfofrigus fragile, AF099065
}
} } }
DSBACL (5)
}
DSBM1239
DSFRG (3) DSBOSA445
“Desulfobotulus sapovorans”, M34402 Desulfobacterium cetonicum, AJ237603 Desulfosarcina variabilis, M34407 “Desulfostipes sapovorans”, AF148141 Desulfobacterium indolicum, AJ237607 “Desulfobacterium oleovorans”, Y17698 Desulfococcus multivorans, M34405 Desulfonema ishimotonii, U45992 Desulfonema magnum, U45989 Desulfonema limicola, U45990
}
DSC193 DSBMIN218 DCC209 DSNISH (3)
}
DSN658
Desulfobacterium anitini, AJ237601 “Desulfoarculus baarsii”, M34403 Desulfomonile tiedjei, M26635 Desulfomonile limimaris, AF282177 Desulfobacca acetoxidans, AF002671
}
DSMON (2)
Desulfocella halophila, AF022936 Syntrophus buswelii, X85131 Syntrophus gentianae, X85132 Geobacter/Pelobacter/Desulfuromusa/Desulfuromonas
} }
}
}}
DELTA495a DELTA495b DELTA495c
}
DSBAC355
Desulfacinum infern um, L27426 Desulfacinum hydrothermale, AF170417 Thermodesulforhabdus norvegica, U25627
DSBAC355
SYBAC986
DSB706
}
DSB986 DSB1030
DSBB (2)
DSB674
}
}} DSB230
DSRHP185
DCC868
Desulforhabdus amnigena, X83274 Syntrophobacter wolinii, X70905 Desulfovirga adipica, AJ237605
}
DSBAC355
Desulfobulbus rhabdoformis, U12253 Desulfobulbus propionicus, M34410 Desulfobulbus elongatus, X95180
DSTAL (5)
DSB1240
Desulforhopalus singaporensis, AF118453 Desulforhopalus vacuolatus, L42613 Desulfofustis glycolicus, X99707 Desulfocapsa thiozymogenes, X95181 Desulfocapsa sulfexigens, Y13672
}
DSB220
Desulfotalea psychrophila, AF099062 Desulfobacterium catecholicum, AJ237602
DSSDBM (4)
Desulfotalea arctica, AF099061
125
DSB706
STRUCTURE AND FUNCTION IN COMMUNITIES
126
INTRODUCTION TO ECOLOGICAL GENOMICS
sulphate reduction has evolved independently several times in different lineages. In some cases species that can and cannot perform sulphate reduction are taxonomically closely related. This situation makes it impossible to target sulphate reducers on the basis of a PCR with a single 16 S rRNA sequence; instead, several different PCRs would be needed. For microarrays, which can deal with many probes in parallel, the situation presents no problem. As in the example discussed above, Loy et al. (2002) based their probes on sequences available from public databases. Sulphate reducers (134 recognized species in total) are present in five different lineages of prokaryotes: Deltaproteobacteria, Firmicutes, Nitrospirae, Thermodesulfobacteria (all Bacteria), and Euryarchaeota (Archaea). Fig. 4.6 provides an example of the affiliations in two orders of the Deltaproteobacteria. The alignments of 16 S RNA sequences led to the development of 138 18-mer probes, which in conjunction are diagnostic for the community of sulphate reducers. For example, the genus Desulfotalea was specifically detected by five probes and was also targeted by three probes with broader specificities (Fig. 4.6). In some cases, however, the taxonomic resolution did not go further than a group of three genera (see SYBAC986 in Fig. 4.6). If the array is hybridized with a sample of PCR-amplified 16 S rRNA genes, a read-out of hybridizations will produce a list of taxa present in the sample. This can be conveniently done using a software tool named ChipChecker (Loy et al. 2002). The SRP-PhyloChip was used to investigate the sulphate-reducing community of a hypersaline cyanobacterial mat from Solar Lake, Egypt. Bacteria from the genera Desulfonema and Desulfomonile were identified and this was confirmed by cloning and sequencing. Another genomics survey of bacterial community composition was applied by Valinsky et al. (2002). These authors were interested in the diseasesuppressiveness of agricultural soils. Agricultural experience shows that soils can become suppressive to soil-borne pathogens if they are managed in certain ways. One of the best-known examples is suppression of the fungus Gaeumannomyces graminis var. tritici (Ascomycota), which causes a root disease
of wheat worldwide (the syndrome is described as take-all). When wheat is cropped in continued monoculture, one or more severe outbreaks of the disease usually follow, but thereafter the soil spontaneously develops a suppressiveness and the fungus is unable to grow any more in such soils (take-all decline). This is correlated with an increase in the abundance of bacteria of the genus Pseudomonas, some of which are known to produce an antifungal compound, 2,4-diacetylphloroglucinol. This well-known example of soils developing suppressiveness is a model for research at the interface between plant pathology and soil microbiology (Weller et al. 2002; De Souza et al. 2003; Garbeva et al. 2004). Valinsky et al. (2002) investigated a case of soil suppressiveness towards the plant-parasitic nematode Heterodera schachtii (sugar beet cyst nematode). Two adjacent agricultural fields, one suppressive and the other not, were sampled and microbial communities were screened using an array-based method. The authors used a membrane to which the soil-extracted and PCRamplified 16 S rRNA genes were fixed, while different radioactively labelled oligonucleotide probes were added to detect a 16 S rRNA sequence of a specific species or group of species. A great number of bacterial clusters were identified, which were grouped into five major taxa (Table 4.3). There were obvious differences between the soils; the disease-suppressive soil had fewer Bacillus species, more Alphaproteobacteria, and fewer Enterobacteria. Interestingly, DGGE analysis of the same soils revealed only 13 bands and did not detect any bands differential between the two soils. This illustrates the enormous increase in resolution that can be obtained by genome-wide analyses. Further research is necessary to reveal the mechanistic relationships between community composition and suppressiveness to cyst nematodes in these soils.
4.2.3 Statistical approaches to prokaryote diversity The recurrent question of how many species of prokaryote there are has also been addressed using
STRUCTURE AND FUNCTION IN COMMUNITIES
127
Table 4.3 Taxonomic composition of bacterial rRNA clones obtained from two agricultural soils using an array-based screening method
Bacillus Cytophaga–Flexibacter–Bacteroides group Actinobacteria Alphaproteobacteria Beta- and gammaproteobacteria Enterobacteria
Number of clones Reference soil
Soil suppressive to sugar beet cyst nematode
405 5 130 10 162 127
35 25 185 142 87 8
Source: From Valinsky et al. (2002).
1400 Number of estimated OTUs
statistical approaches applied to genome data (Hughes et al. 2001; Curtis et al. 2002; Ward 2002). When a community is sampled and the number of species is counted in successive samples, the total number of species retrieved will show a curve of diminishing returns. A plot of the cumulative number of observed species versus sample size produces a species-accumulation curve, also called collector’s curve, which tends to level off to a plateau beyond a certain sample size (Krebs 1999). Assuming a suitable model (e.g. a hyperbola or a negative exponential) the total number of species in the community may be estimated by extrapolation, even though a fraction of species remains unnoticed. Such methods are commonly applied to field inventories of plants and insects, but they are rarely found in microbial ecology. Hughes et al. (2001) reviewed various microbial data-sets and showed how the ecological methodology can be applied to estimate species richness in a microbial setting. One of the data-sets analysed was due to McCaig et al. (1999). These authors had sequenced 16 S ribosomal genes from clones isolated from soils of two upland pastures in Scotland, one natural but grazed by sheep in summer, the other reseeded, fertilized and grazed during the whole season (‘improved’). Applying the 97% similarity criterion as a species boundary, there were no differences in observed species richness between the two sites (113 in the fertilized habitat and 114 in the natural grassland); however, there were differences in species composition. Hughes et al. (2001) re-analysed the data and
1200 1000 800 600 400 200 0 0
20
40 60 80 100 120 Number of clones sampled
140
Figure 4.7 Estimates of species richness according to Chao applied to 16 S rRNA sequences differing more than 3% from each other (OTUs) in two upland pastures in Scotland, one natural (), the other fertilized (*), with 95% confidence intervals (dashed lines for the natural grassland, solid lines for the fertilized habitat). From Hughes et al. (2001), by permission from the American Society for Microbiology.
applied Chao’s estimator for total species richness, ST, which is ST ¼ Sobs þ
n21 2n2
where Sobs is the observed number of species, n1 is the number of singletons (species captured once) and n2 is the number of doubletons (species captured twice). The theory also accounts for a standard error of this estimate. Applying this equation to the Scottish grassland data produced the species-accumulation curve shown in Fig. 4.7. Total species richness ST was was estimated as
128
INTRODUCTION TO ECOLOGICAL GENOMICS
590 OTUs in the natural grassland and 467 OTUs in the improved grassland. Due to the significant number of rare species (singletons relative to doubletons), this estimated total number of species in the community was considerably higher than the actual number observed. There seemed to be more species in the natural grassland soil than in the fertilized soil, although the difference was not statistically significant. Another approach to estimation of microbial diversity was applied by Curtis et al. (2002). These authors used the distribution of species over abundance classes as a basis for extrapolation. We know from basic ecology that in any community there are a few species with very high abundance, whereas most species have intermediate abundance. The distribution of species over abundances can be characterized by a function f, where Z Nmax ST ¼ fðNÞdN Nmin
in which ST is the total number of species in the community, Nmin the abundance of the least abundant species, and Nmax the abundance of the most abundant species. Integrating f over all abundances is equivalent to cumulating species over all abundance classes, from rare to dominant. Community ecologists have argued that f often takes a bell-shaped symmetrical form if abundance is grouped into geometric-scale units, e.g. in classes whose widths increase by a factor of 2 with every successive group (octave scale; Krebs 1999). The function f then approaches a normal curve on a logarithmic scale. Lognormal species-abundance curves are assumed to hold particularly well for microorganisms, which exhibit highly dynamic and random growth, influenced by many independent factors. The lognormal distribution is defined by only two parameters, allowing ST to be estimated from the number of species in one of the classes (e.g. the largest class) plus the spread of the distribution (Krebs 1999). However, these two quantities are still difficult to measure in the case of microorganisms, therefore Curtis et al. (2002) developed an expression allowing ST to be estimated from two quantities easily accessible to measurement: the total number of individuals in the community (NT)
and the abundance of the most abundant member (Nmax). Applying the formula to data for microbial clone abundance reported in the literature, the authors were able to estimate prokaryote species diversity for several ecosystems. In addition, they also estimated the global diversity of Bacteria and Archaea in the sea (Table 4.4). The analysis of Curtis et al. (2002) depends crucially on abundance data, which, even for the most abundant organisms—prokaryotes—are not very reliable. Nevertheless, these estimates show that prokaryote species richness may be orders of magnitude greater than can ever be achieved with clone libraries; even the most extensive clone libraries do not reach beyond a few hundred species. When better quantitative data become available in the future the estimates can be refined; however, to develop a reliable empirical species-abundance curve for a microbial community will be a serious experimental challenge. For the moment the theoretical predictions seem to stand on firmer ground. There are also some intriguing questions inherent to the estimates in Table 4.4; for example, why the global species richness of the Archaea is so much lower than that of the Bacteria and why the biodiversity of soil ecosystems increases less with increasing scale than the biodiversity in the sea. Table 4.4 Estimates of local and global biodiversity of prokaryotes, derived from abundance data assuming a lognormal distribution of species over abundance classes Environmental compartment
Estimated number of species
Bacteria in1 ml of ocean water Bacteria in the entire sea (pelagic) Archaea in the entire sea (pelagic) Bacteria in an average lake Bacteria in 1 g of soil Bacteria in 100 g of soil Bacteria in 1000 kg of soil All soil bacteria in the world Bacteria in the global atmosphere Bacteria in 1 ml of sewage sludge All bacteria in a sewage works
163 2 000 000 20 000 8000 6300–38 000 100 000–1 000 000 4 000 000 4 500 000 4 000 000 70 500
Source: From Curtis et al. (2002).
STRUCTURE AND FUNCTION IN COMMUNITIES
Estimates of species richness can also be derived from computer-aided assemblies obtained by applying the WGS approach (see Section 2.2) to communities. This approach was applied in a largescale sequencing campaign examining marine biodiversity (Venter et al. 2004). The Sorcerer II expedition is an undertaking of the Venter Institute aimed at analysing the vast untapped and unseen world of oceanic biota around the world (www. sorcerer2expedition.org). In the first phase of the project, samples were collected from the Sargasso Sea, off the coast of Bermuda, and that DNA was cloned into plasmid vectors and sequenced using the WGS approach. Traditionally, WGS sequencing has been applied to identify the genome sequence of one particular organism, but the approach taken by Venter et al. (2004) was to capture representative sequences from as many organisms as possible (see also Section 4.4 below). Obviously, when sampling the community at random, the most abundant species will be sequenced many times and the rare species only occasionally. Using an adapted assembly algorithm with enormous computational power, scaffolds were constructed that could be assigned to species. A ‘genomic species’ was defined as a clustering of assemblies
129
or unassembled reads with more than 94% sequence similarity. Venter et al. (2004) developed a new method for estimating species-richness from the data obtained. In Section 2.3 we saw that in a WGS assembly the probability of a base position being sequenced r times, P(r), can be modelled as a Poisson distribution, for which the mean equals the average depth of coverage. Similarly, for a mixture of rare and abundant genomes, different species have different depths of coverage and P(r) is a composite Poisson distribution. By fitting the theoretical distribution to the data, the number of genomes at each depth of coverage could be estimated (Table 4.5), and the sum of these numbers is an estimate of the number of species in the community. For a 200 l sample from the Sargasso Sea, species richness was estimated as at least 1800, which is consistent with the extrapolations from the model of Curtis et al. (2002) discussed above. However, since 80% of the assembled sequence is contributed by organisms of very low abundance, the actual species richness could be much greater, perhaps an order of magnitude more. Our tour d’horizon of prokaryote biodiversity screening has demonstrated an inherent weakness
Table 4.5 Illustrating a model to estimate genome (species) diversity in microplankton communities analysed by WGS sequencing Sequencing coverage depth
Fraction of assembly consensus organisms
Expected fraction of genome sequenced
Genomes
25 21 13 9 7 6 4 2.4 2 0.25 Total
0.0055 0.0050 0.0035 0.0040 0.0080 0.0047 0.0100 0.0258 0.0700 0.8635 1.0
1.0 1.0 1.0 1.0 0.999 0.998 0.982 0.909 0.865 0.221
2.5 2.3 1.6 1.8 3.6 2.1 4.6 12.8 36.4 1756.7 1824.4
Notes: Assembly consensus sequences are classified by the sequencing depth coverage. For example, 0.55% of the organisms have been sequenced 25 times and such sequencing covered the whole genome. This results in an estimated number of 2.5 genomes falling into this class, assuming a mixture of Poisson distributions. The total number of species estimated for a 200-l sample from the Sargasso Sea is 1824. Reprinted with permission from Venter et al. (2004). Copyright 2004 AAAS.
130
INTRODUCTION TO ECOLOGICAL GENOMICS
of microbial ecology compared to plant and animal ecology: the difficulty of obtaining reliable estimates for abundance and species richness. It is expected that genomics approaches will improve on this situation in the near future. Still, sequences cloned from environmental samples are rarely identical to sequences of cultured bacteria in gene databases. Several investigations report on completely new bacterial lineages. For example, only a few years ago it was realized that the phylum Acidobacteria, previously known from only three described species, is as diverse as the whole superphylum of Proteobacteria. DNA sequences of this group are found everywhere in clone libraries; often no less than 30% or even 50% of the 16 S rRNA gene inserts in clone libraries from soil sample belong to Acidobacteria, which is indicative of a very important (but unknown) ecological role (Quaiser et al. 2003). Obviously, a levelling-off in the collector’s curve of global microorganisms is not even in sight.
another, from one redox state to another, or from one environmental compartment to another. Many of these transitions are catalysed by enzymes in specific biological entities. To understand and predict biogeochemical cycles it is necessary to know the mechanisms by which organisms direct the transitions in these cycles. In this section we will therefore focus on the genomic determinants of such transitions and conversions. Knowledge of the responsible genes and the organisms in which these are expressed can be used to develop screening instruments by which biogeochemical functions in environmental samples may be assessed. Table 4.6 is a guide for the discussion. We focus on key links in the carbon, nitrogen, sulphur, phosphorus, iron, calcium, and silicium cycles. We do not discuss all the biochemical aspects of nutrient cycles; for a full treatment of this the reader is referred to a microbiology textbook such as Madigan et al. (2003).
4.3.1
4.3 Microbial genomics of biogeochemical cycles The crucial role of microorganisms in biogeochemical cycles has been known about for a long time, but only recently have we gained insight into the architecture and diversity of the genetic systems responsible for these ecological functions. In addition, new and unexpected links between element cycles have been discovered that were not taken into account before. The new evidence is coming from two sources: detection of functional genes using microarrays and cloning of environmental genomes. The second topic will be discussed in Section 4.4, and this section is devoted to an overview of the genes and genomic background associated with conversions in the major element cycles, as well as examples of studies using microbial functional genomics in the field. All elements in the Earth’s crust and the atmosphere interact with the biosphere and for some elements, especially those that are used as essential building blocks or catalysts in cells, the interaction is particularly strong. Many elements undergo transitions from one chemical compound to
Key genes in the carbon cycle
Starting with carbon, we note that photosynthesis is the most important link in the cycling of nutrients through the biosphere, because it is the process upon which almost all other life depends. Most organisms that can use sunlight for the generation of metabolic energy (phototrophs) divert that energy to the synthesis of organic molecules from CO2 and so are photoautrophic. There are also phototrophs that rely on organic carbon for their growth, although they use light as a source of energy; these are called photoheterotrophs. Another distinction relates to the source of reducing power for the conversion of CO2 to organic carbon. This can come from water, producing O2 as a by-product, from reduced sulphur compounds in the environment such as H2S, or from molecular hydrogen, H2. The first type of photosynthesis, which is practised by cyanobacteria, green algae, and land plants is called oxygenic (producing oxygen), whereas the second type, practised by purple bacteria and other prokaryotes, is called anoxygenic. The use of H2S or H2 as a source of reduction equivalents is not always driven by light, it can also be coupled
STRUCTURE AND FUNCTION IN COMMUNITIES
131
Table 4.6 Overview of genes associated with key links in biogeochemical cycles, classified by element and process Element
General process
Specific process
Gene products, enzymes
Gene clusters
Carbon
Anoxygenic photosynthesis
Photopigment biosynthesis
Enzymes of bacteriochlorophyll and carotenoid biosynthesis Light-harvesting and reaction-centre complex subunits and assembly factors Enzymes of chlorophyll, phycobilin, and carotenoid pathways Photosystem I and II subunits
bch, crt
Ribulose bisphosphate carboxylase complex (Rubisco) subunits, phosphoribulokinase ATP citrate lyase Proteorhodopsin
rbc, cbb, prk
Oxygenic photosynthesis
Carbon fixation
Non-chlorophyll phototrophy Decomposition
Methanotrophy Methanogenesis Nitrogen
Nitrogen fixation
Assembly of photosynthetic complex Photopigment biosynthesis Assembly of photosynthetic complex Calvin cycle
Reverse citric acid cycle Light-driven energy generation Polysaccharide catabolism Lipid catabolism Lignin degradation Methane oxidation
Nitrogenase
Denitrification Anammox Nitrification
Sulphur
Anaerobic ammonia oxidation Aerobic ammonia oxidation Nitrite oxidation
Sulphate reduction Dimethyl sulphide generation Sulphur oxidation
Phosphorus Iron
Calcium Silicium
Polyphosphate hydrolysis Iron reduction Iron oxidation Formation of calcareous skeletons Formation of frustules, spicules
Periplasmic electron shuttling Electron shuttling Calcium carbonate precipitation Silica uptake, silica precipitation
Amylase, cellulase, pectinase, chitinase Phospholipase, acyl-CoA dehydrogenase Peroxidase Methane monooxygenase Methylreductase, heterodisulphide reductase Dinitrogenase a and b, dinitrogenase reductase, electron-transport flavoproteins Nitrate reductase, nitrite reductase, NO reductase, N2O reductase Nitrite oxidoreductase
puf, puh, puc apc, cpc psa, psb
acI gpr amy, cel, pem pel, chi, phl mnp pmo mrc, hdr nif, fix
nap, nar, nir, nor, nos nor
Ammonia monooxygenases a and b Nitrite oxidoreductase Adenosine phosphosulphate reductase, sulphite reductase Catabolism of dimethylsulphoniopropionate Sulphite oxidase, sulphur dehydrogenase Exopolyphosphatase
amo
pps
c-Type cytochromes
omc, mtr, cct, cym
Rusticyanin, c-type cytochromes Vacuolar-type ATPase proton pump
rus, cyc, cox V-ATPase
Silaffin, frustulin, silicatein
Sil
nor aps, dsr Dimethylsulphonio propionate lyase sox
132
INTRODUCTION TO ECOLOGICAL GENOMICS
to chemoautotrophic energy generation, although the use of water and the production of O2 is always driven by light. Interception of light by photoautotrophs relies on chlorophyll, a porphyrin molecule with a magnesium atom in the centre of the ring structure. Several chlorophylls are known, which differ from each other in substituents on the porphyrin ring and side chains attached to it. These substituents influence the spectroscopic properties of the Mg-porphyrin, and so the different chlorophylls have different absorption maxima. Cyanobacteria, green algae, and land plants have chlorophyll a and b, several algal groups (Phaeophyta, Chrysophyta, Dinoflagellata) have chlorophyll a and c, and red algae have a type of chlorophyll a called bacteriochlorophyll a. In addition, most phototrophic organisms have various accessory pigments that support the capture of light (phycobilins) or protect against damage from radicals (carotenoids). The main genomic models for investigating bacterial photosynthesis are purple bacteria of the genera Rhodobacter (Alphaproteobacteria, Rhodobacterales) and Rhodopseudomonas (Alphaproteobacteria, Rhizobiales). These bacteria are anoxygenic phototrophs, which generate sulphur from H2S rather than oxygen from water. Rhodobacter sphaeroides is readily amenable to genetic manipulation, allowing the development of mutants that are deficient in some aspect of the process and this has greatly helped in reconstructing the genomic organization of the photosynthetic apparatus. In Rhodobacter, the genes involved in photosynthesis are clustered in operons in a 50 kb region of the chromosome called the photosynthetic cluster. The operons are transcribed in a highly coordinated manner to allow the correct assembly of new photosynthetic complexes. The cluster involves bch genes, which encode proteins involved in the synthesis of bacteriochlorophyll, crt genes, which encode proteins involved with carotenoid synthesis, puh and puf genes, which encode pigment-binding peptides of the reaction center, and puc genes, encoding assembly factors. These genes may be used to develop probes for functional gene microarrays (Table 4.6).
The main model for oxygenic photosynthesis in bacteria is Synechocystis, a cyanobacterium from the order Chroococcales, the fourth microorganism to have its genome sequenced completely and the first photosynthetically active species to do so (Kaneko et al. 1996). We know from plant physiology that cyanobacteria, green algae, and plants have a more complicated system for the flow of electrons than the anoxygenic phototrophs; namely, they use two interconnected photosystems. In the first step, conducted by photosystem II, water is split into oxygen and hydrogen, whereas the second step, conducted by photosystem I, produces NADPH. The double system is also called noncyclic photophosphorylation because the electrons liberated from chlorophyll by light excitation are transferred to NADP þ , rather than back to chlorophyll as in anoxygenic or cyclical photophosphorylation. The evolution of photosystem II in Cyanobacteria around 3.5 billion years ago changed the face of the Earth because it allowed the use of water as an electron donor and the production of oxygen, which came to accumulate in the atmosphere. The subunits of the two photosystems are encoded by genes of the psb cluster (for photosystem I) and psa (for photosystem II). Other genes of the photosynthetic complex are the enzymes of the pathways for chlorophyll synthesis and accessory photopigments (Table 4.6). Several mechanisms are known for the fixation of CO2 in organic molecules, but the Calvin cycle is the most widespread. Both photoautotrophs and chemoautotrophs use the generation of ATP and NADPH to fuel CO2 fixation. The Calvin cycle uses two key enzymes, ribulose bisphosphate carboxylase (Rubisco) and phosphoribulokinase. Rubisco is the most abundant enzyme of the biosphere and it shows a remarkable constancy across all autotrophic organisms, from bacteria to flowering plants. The complex consists of several subunits, encoded by rbc and cbb genes. In plants some of the subunits are encoded in the chloroplast, others in the nuclear genome. The second enzyme that is unique to the Calvin cycle is phosphoribulokinase, which is encoded by genes from the prk cluster. In green sulphur bacteria (Chlorobium is the bestinvestigated genus), and in some chemoautotrophic
STRUCTURE AND FUNCTION IN COMMUNITIES
bacteria and Archaea, an alternative CO2-fixation pathway is active, the so-called reverse citric acid cycle. Most of the enzymes in this cycle are the same as in the normal Krebs cycle, except for the enzyme ATP citrate lyase, which is specific to this pathway and is used as a genetic marker for reverse citric acid carbon fixation. In Chlorobium the enzyme is encoded by two adjacent ORFs, acIB and acIA (Kanao et al. 2001). Only recently, thanks to a genomics approach, has another mechanism of phototrophy been implicated in the carbon cycle. In this pathway energy is generated from light, not through chlorophyll but through a retinal-dependent light-activated proton pump, proteorhodopsin. This mechanism was known previously only from some Archaea (in which the protein was called bacteriorhodopsin) until Be´ja` et al. (2000a) discovered that rhodopsin-like genes were associated with uncultured Gammaproteobacteria of the SAR86 clade in the sea. Further research has shown that this protein is very common in marine bacterioplankton and is present well outside of the phylum Proteobacteria (Be´ja` et al. 2001; De la Torre et al. 2003; Venter et al. 2004). Proteorhodopsin most probably supports a photoheterotrophic lifestyle in which light is used to generate energy, relieving respiratory costs in bacteria that do not fix CO2. However, proteorhodopsin may be coupled to an as-yet-unknown photoautotrophic pathway. Turning to the catabolic part of the carbon cycle we note that a great variety of enzymes are used by heterotrophs to degrade polymers from photosynthetically fixed cabon. These are all part of the decomposition subsystem, which returns CO2 or CH4 to the atmosphere. Decomposition is a crucial process ocurring in soils and sediments. It actually involves more than just breakdown of organic matter, it includes mineralization of nutrients and synthesis of humus, leading to humus–clay complexes that stabilize the soil. All organic matter eventually ends in the decomposer network, to which an enormous variety of heterotrophic organisms contribute. The number of genes that can be used as indicators of the decomposition process is potentially very large; we have mentioned in Table 4.6 only a few enzymes associated
133
with carbohydrate and lipid catabolism. Many of these enzymes are present in bacteria, fungi, and animals; however, cellulase (more correctly called b-1–4-glucanase) has a limited distribution. Most fungi can degrade cellulose, but only few groups of bacteria; no animal, except the tunicates (see Section 3.3), has cellulase. Consequently all animals depend on microorganisms for the degradation of this abundant polysaccharide. Many animals have recruited a specialized microflora in one of their gut compartments to do the job of cellulose degradation for them. The capacity for lignine degradation is even more limited in nature. Certain basidiomycetes called wood-rotted fungi are responsible for this important link in the carbon cycle and they do this by means of aspecific peroxidases. We have seen in Section 3.3 that the white rot fungus Phanearochaete chrysosporium was selected as a genomic model for lignin degradation. In addition to the polymeric substrates attacked by decomposition reactions, a great variety of simpler organic compounds may be used by heterotrophic microorganisms as a source of carbon and to generate energy (e.g. disaccharides, organic acids, phospholipids). A special case is C1 metabolism, which is conducted by some Gamma- and Alphaproteobacteria (Methylomonas, Methylosinus) that are able to grow on compounds with only one carbon atom and thus have to synthesize all carbon–carbon bonds themselves. Methane is the most common one-carbon substrate; the microorganisms that use methane as their sole source of carbon are called methanotrophs. These organisms are found whereever a stable source of methane is combined with availability of oxygen; for example in the transition zone between oxic and anoxic strata of lakes and soils. Methane oxidation is an important link in the carbon cycle, because it converts methane back into cell material and CO2. A key enzyme in the methane oxidation pathway is methane monooxygenase, a haem protein of the same family as ammonium monooxygenase (see below), which is encoded by the pmo gene cluster (Table 4.6). The last link in the carbon cycle to be discussed is the process of methanogenesis. This is an
134
INTRODUCTION TO ECOLOGICAL GENOMICS
extremely important process in the climate-change issue because methane is a very effective greenhouse gas. Methane is generated in marshes, swamps, lake sediments, paddy fields, and landfill sites under anoxic conditions by a group of strictly anaerobic Archaea, called methanogens. These organisms are found in five orders of the phylum Euryarchaeota and include the genomic model species Methanococcus jannaschiii, a hyperthermophile from the ocean floor (mentioned in Section 1.2 as the first fully sequenced archaeon), as well as many mesophilic species such as Methanosarcina mazei, whose genome was discussed in Section 3.2. The most important substrate used in methanogenesis is CO2, which is reduced to CH4 using H2 as an electron donor in the overall reaction: CO2 þ 4H2 ! CH4 þ 2H2 O In addition to CO2, many methanogens can use simple alcohols and organic acids as well—for example methanol, methylamines, formate, and acetate—but not larger organic molecules such as sugars. This implies that methanogens must rely on decomposing (CO2 producing) and fermenting (formate- and acetate-producing) microorganisms in their immediate surroundings for the supply of necessary substrates. This trophic interdependence within microbial communities is called syntrophy. The reactions leading to the reduction of CO2 to CH4 are quite complex and involve some unique enzymes and coenzymes. The terminal step is conducted by the methyl reductase complex, which is encoded by the mrc gene cluster. The reaction catalysed by methyl reductase produces not only free methane but also leads to the formation of a complex of two coenzymes (coenzyme B and coenzyme M), linked via a disulphide bridge. This disulphide is then reduced to produce the free coenzymes by the enzyme heterodisulphide reductase, another unique enzyme found only in methanogens; its three subunits are encoded by genes of the hdr cluster (Table 4.6).
4.3.2
Key genes in the nitrogen cycle
Figure 4.8 shows an overview of the nitrogen cycle. Most of the inorganic nitrogen on Earth is present
8 8
N2 7 N2O
1
7 NO
5 5
5
NH3
7 – NO2 6
4
7 – NO3
2 3 Organic N
Figure 4.8 Overview of the nitrogen cycle. 1, Nitrogen fixation; 2, ammonium assimilation (uptake by microorganisms and plants); 3, reductive nitrate assimilation (uptake); 4, ammonification (deamination, mineralization, decomposition); 5, aerobic ammonia oxidation; 6, nitrite oxidation; 5 þ 6, nitrification; 7, denitrification; 8, anaerobic ammonia oxidation. Modified after Kowalchuk and Stephen (2001), reproduced with permission from Annual Reviews.
as inert dinitrogen gas, N2, which surrounds all plants and animals, but is unavailable to them. Only certain prokaryotes can utilize dinitrogen gas and reduce it to ammonia, which is then taken up into the biosphere. Nitrogen fixation is therefore a key link in the nitrogen cycle (process 1 in Fig. 4.8), although on a global scale it is now surpassed by industrial nitrogen fixation in behalf of the production of mineral fertilizers (the Haber process). Among the nitrogen-fixing organisms are freeliving aerobic bacteria such as Cyanobacteria, free-living anaerobic bacteria, such as Clostridium, symbiotic bacteria of the family Rhizobiaceae, living in association with leguminous plants, and symbiotic bacteria of the actinomycete genus Frankia, living in association with nonleguminous plants such as alder trees (Alnus) and buckthorn (Hippophae). The ability to fix nitrogen is not associated with a monophyletic group of prokaryotes, but is found scattered among several bacterial and archaeal lineages, phototrophs, chemo-organotrophs, and chemolithotrophs. Nitrogen fixers are also called diazotrophs (deriving nutrition from dinitrogen). The reduction of N2 to NH3 is a highly energydemanding process, catalysed by the enzyme
STRUCTURE AND FUNCTION IN COMMUNITIES
complex nitrogenase, which consists of two units, dinitrogenase and dinitrogenase reductase Dinitrogenase contains iron and molybdenum in its active centre, whereas dinitrogenase reductase contains only iron. Because the fixation of N2 requires such a large amount of energy, the activity of these enzyme complexes is highly regulated. The genetic architecture of nitrogen fixation has been studied in detail in the model species Klebsiella pneumoniae (Gammaproteobacteria, Enterobacteria), a species normally living in soil or water but occasionally causing pneumonia in humans, hence its name. The structural and regulatory genes associated with nitrogen fixation are organized in a complex network of operons, the nif regulon, encoding no less than 20 different proteins, all dealing with regulation, maturation, and assembly of the nitrogenase complex (Fig. 4.9). The various nif genes are indicated with letters; for example, nifK encodes the b-subunit of denitrogenase, nifD encodes the a subunit of the same enzyme, and nifH encodes the enzyme dinitrogenase reductase. The regulon also includes several proteins that support the
135
processing of Mo, its insertion in the apo-enzyme, and expression regulators and inhibitors, etc. Similar nif regulons are present in other nitrogen fixers such as cyanobacteria. Some of the nif genes have been used succesfully to develop probes for assessing diazotroph microbial communities in the field (see below). In addition to the nif cluster, symbiotic nitrogen fixers have a fixABCX gene cluster, which encodes electron-transport flavoproteins (ETFs), which presumably support the electron transport to nitrogenase. This fix gene cluster is under transcriptional control by one of the regulatory proteins from nif, NifA. Nitrogen can assume six different oxidation states, with the valency of the nitrogen atom varying from þ5 in nitrate to 3 in organic N (amino groups and heterocyclic compounds). Nitrogen fixation is a reduction process because it changes N from oxidation state 0 to 3. Another reduction takes place in the process of denitrification, where N changes from þ 5 to 0. Denitrification (process 7 in Fig. 4.8) is the biological conversion of nitrate to nitrogen gas, a process that is detrimental in agriculture, because it diminishes
Dinitrogenase reductase FeMo co-synthesis
FeMo co-synthesis Dinitrogenase reductase processing
Mo processing
Dinitrogenase FeMo co-synthesis
Homocitrate synthesis
β
Electron transport
α
Regulators Positive Negative Flavodoxin
Pyruvate flavodoxin oxidoreductase
FeMo co-insertion into dinitrogenase
Metal centre biosynthesis
nif Q
B
A
L
F
M Z W V S U
X
N
E
Y
T
K
D
H
J
DNA
Transcriptional units Figure 4.9 Schematic representation of the nif regulon in Klebsiella pneumoniae. The 20 nif genes are indicated by letters (Q, B, A, etc.). They are transcribed as seven polycistronic messengers indicated below the genes; the direction of transcription differs between operons. The functions of the various proteins are indicated in the boxes and by arrows. From Madigan et al. (2003), with permission from Pearson Education.
136
INTRODUCTION TO ECOLOGICAL GENOMICS
the effect of fertilization, but favourable in other situations, such as sewage treatment, because it removes eutrophicating nitrate from the effluent. Most denitrifying prokaryotes are members of the Proteobacteria and they represent a metabolically versatile group, growing both aerobically and anaerobically. Some denitrifying bacteria will also use other electron acceptors such as ferric ion (Fe3 þ ). Four consecutive enzyme systems are involved with denitrification, converting nitrate subsequently to nitrite, NO, N2O, and finally N2. The enzymes are referred to as nitrate reductase, nitrite reductase, NO reductase, and N2O reductase, respectively. Some bacteria, such as E. coli, can only carry out the first two steps and therefore generate NO, not N2. Natural denitrification, although considered beneficial in the combat against eutrophication, has negative side effects because it is always accompanied by the emission of NO and N2O, which in themselves are greenhouse gases and by reaction with water in the atmosphere contribute to the acidity of rain. The reduction of nitrate in the environment is also called dissimilative nitrate reduction, to distinguish it from nitrate reduction following uptake in plants, which is called assimilative nitrate reduction (process 3 in Fig. 4.8). The biochemistry of denitrification has been studied in detail in Paracoccus denitrificans, which can conduct all four denitrification steps. This organism can express both a periplasmic nitrate reductase (between cell membrane and outer membrane) and a membrane-bound nitrate reductase, where the latter is formed only under anaerobic conditions and also functions exclusively under these conditions. A third nitrate reductase is active in the cytoplasm and associated with assimilatory nitrate reduction. The membranebound reductase is encoded by a nar gene cluster and the periplasmatic nitrate reductase by the nap operon. As in the case of nitrogen fixation, these clusters include both structural genes, encoding subunits of the enzymes, and regulatory proteins. Another gene cluster, nir, encodes nitrite reductase, whereas nor genes encode NO reductase and a nos genes encode N2O reductase. Because of the toxicity of nitrite and nitric oxide, the expression of
these genes must be highly co-ordinated; a comprehensive set of regulators (including nitrite sensors) is involved, as well as transporters that may prevent intracellular accumulation of nitrite. Van Spanning et al. (2005) provided a recent review of the distribution of denitrificationassociated genes in Bacteria and Archaea. The third link in the nitrogen cycle that we discuss here is the process of nitrification, of which the first and rate-limiting step is aerobic ammonia oxidation (process 5 in Fig. 4.8). It is commonly assumed that, unlike nitrogen fixation and denitrification, the capacity for ammonia oxidation has a limited distribution within the bacterial kingdom. However, recent metagenomic screening has suggested that ammonia oxidation may be more widespread (see Section 4.4). Up until now, all terrestrial ammonia-oxidizing bacteria have been found in the Betaproteobacteria, involving the well-known genera Nitrosomonas and Nitrosospira. Another group of ammonia oxidizers is present in the Gammaproteobacteria (Nitrosococcus), but these organisms seem to have a limited distribution, being mainly marine. Nitrite oxidizers are found in the Alphaproteobacteria (Nitrobacter), the Deltaproteobacteria (Nitrospina), and the phylum Nitrospirae (Kowalchuk and Stephen 2001). The b-ammonia-oxidizing bacteria Nitrosomonas/ Nitrosospira group forms a monophyletic lineage and can be probed with a single set of 16 S rRNA primers. Most ammonia-oxidizing bacteria are autotrophic; in addition to the system for nitrate oxidation they have the Calvin cycle for CO2 fixation. The ATP and reducing power requirements for this process, added to the relatively limited amount of ATP generated by nitrate oxidation, may explain the slow growth of these bacteria in laboratory cultures. The key enzyme in aerobic ammonia oxidation is ammonia monooxygenase, which oxidizes ammonia to hydroxylamine (NH2OH), which is then oxidized further to nitrite by hydroxylamine oxidoreductase. Ammonia monooxygenase splits O2, and incorporates one of the oxygen atoms in NH3, while the other reacts with H þ to form water. Similar reaction schemes using monooxygenase enzymes apply to the oxidation of
STRUCTURE AND FUNCTION IN COMMUNITIES
methane and organic compounds such as benzene. The genome of Nitrosomonas europaea has been completely sequenced and serves as the main genetic model for nitrification research (Chain et al. 2003). Two genes in the amo cluster of Nitrosomonas, amoA and amoB, encode the two subunits of monooxygenase, whereas a third gene, amoC, encodes a supporting membrane protein. AmoA is one of the genes that is used in microarray-based profiling of environmental samples (see below). The enzyme nitrite oxidoreductase, which is used by nitrite oxidizers to produce nitrate from nitrite, is encoded in the nor operon, which is essentially the same gene cluster as used by denitrifiers to reduce NO to N2O. In addition to being oxidized under aerobic conditions, ammonia can also be oxidized under anoxic conditions by means of a process called anammox. This involves the joint use of ammonia and nitrite in the overall reaction: NHþ 4 þ NO2 ! N2 þ 2H2 O
indicated by process 8 in Fig. 4.8. The first organism that was identified as responsible for anoxic ammonia oxidation, Brocadia anammoxidans, is a member of the bacterial phylum Planctomycetes, a somewhat unusual group of prokaryotes because they have membrane-enclosed compartments inside the cell. One such compartment, the anammoxosome, is geared specifically towards the anammox process. Br. anammoxidans is an autotroph and uses nitrite as an electron donor to fix CO2. This is the same principle as used by nitrite oxidizers (e.g. Nitrobacter). In addition, the same enzyme, nitrite oxidoreductase, is used, encoded in the nor operon (Table 4.6). Finally, the mineralization of organic nitrogen to ammonia (ammonification) takes place during the decomposition of organic material and involves deaminase reactions. Many heterotrophic organisms can do this and there are many different deaminases, so no key enzyme for ammonification can be indicated. Under neutral to acid pH conditions ammonia from decomposition reacts with water and is present in the environment as an NHþ 4 ion, adsorbed to the sediment or soil-exchange complex. At low pH very little NHþ 4 dissociates to
137
form NH3 and because NH3, not the ammonium ion, is required for ammonia oxidation, low pH was long thought to be a limiting factor for nitrification; however, even at pH 3 in nitrogensaturated coniferous forest soil a substantial rate of nitrification by acid-tolerant Nitrosopira has been measured (Laverman et al. 2001). This overview of the nitrogen cycle shows that it is accompanied by a great variety of redox reactions and conducted by many different microorganisms. For most of the transitions the key enzymes have been well characterized. It is evident that in some cases similar enzymes conduct different reactions in different organisms and apparently their action depends on the context of the organism in which they are expressed. Several genes are indicative of key steps in the nitrogen cycle and these can be used in environmental genome-profiling studies.
4.3.3
Other nutrient cycles
Sulphur, like nitrogen, can take different oxidation states and the transitions between these are exploited by many microorganisms. One of the best known reactions is dissimilative sulphate reduction, the conversion of sulphate to sulphide, which can be liberated as smelly H2S gas or precipitate with cations. Sulphate-reducing bacteria are found in many different lineages of Bacteria and Archaea, as we have seen above (Fig. 4.6). The species Desulfovibrio vulgaris (Deltaproteobacteria), whose genome has been sequenced recently (Heidelberg et al. 2004), is a model species for the study of sulphate reduction. Most sulphatereduction processes take place under anoxic conditions and use electron donors from organic compounds. Intertidal sediments are prime examples of sulphate-reducing environments, because of the combination of high sulphate availability in seawater with abundant organic material from salt-marsh vegetation and anoxic conditions due to regular flooding. The black colour of intertidal sediments is due to the precipitation of sulphide with iron to form FeS. In the sea itself, sulphate reduction is limited by the availability of carbon sources. In addition to sulphate reduction in the
138
INTRODUCTION TO ECOLOGICAL GENOMICS
environment, sulphate is also reduced after uptake by microorganisms, plants, and animals (assimilative sulphate reduction), because the major form of sulphur in organic molecules is the reduced form of the thiol (SH) group in proteins. The reduction of sulphate proceeds through a series of steps. Sulphate is first activated by binding to ATP to form adenosine phosphosulphate (APS) before it can be reduced to sulphite by the enzyme APS reductase. In the next step sulphite is reduced to sulphide by sulphite reductase. The two reactions require electrons from a suitable donor, either hydrogen or acetate, which is oxidized to water or CO2. The aps locus of sulphate reducers encodes the key enzyme APS reductase, and dsrA and dsrB encode the a and b subunits of sulphite reductase. The three genes are highly conserved in several deep-branching phyla of the Bacteria and Archaea and seem to have been subject to lateral gene transfer. Sulphate reducers often occur in close association with methanogenic Archaea and with methanotrophic (methaneoxidizing) Archaea and they use each other’s products (another case of syntrophy). Taken together, the only oxidants that this small community requires are CO2 and sulphate, compounds which existed before the Earth became oxygenated by photosynthesis. Therefore, communities consisting of sulphate reducers, methanogens, and methanotrophs, found in salt marsh sediment and in association with hydrothermal vents on the ocean floor, could represent the modern descendents of extremely ancient communities dating back to the beginning of the Proterozoic era (Teske et al. 2003). In addition to H2S, a major source of sulphur emission to the atmosphere is due to the volatile compound dimethyl sulphide (DMS; CH3–S–CH3). Microbial mats of salt marshes are well-known emission sources for DMS. This compound is a degradation product of b-dimethylsulphoniopropionate (DMSP), which is produced in large amounts by many marine algae, cyanobacteria, and salt-marsh plants, probably to protect them against osmotic shock (Yoch 2002). DMS is assumed to have an anti-greenhouse effect, because sulphate aerosols generated by DMS act
as cloud-condensing nuclei, reducing the amount of sunlight reaching the Earth’s surface. However, by generating sulphate, DMS may contribute significantly to acid rain in places where there is no air pollution and the concentration of aerosols is low. When the DMSP-containing organisms die off or are grazed by zooplankton, DMSP becomes available in the environment and is converted to DMS by means of an enzyme, DMSP lyase, which is expressed by sulphate-reducing bacteria such as Desulfovibrio and Roseobacter. Some Roseobacter live in close association with dinoflagellates, which are major producers of DMSP, and it is assumed that the bacteria may benefit from the DMSP produced by the dinoflagellates (Miller and Belas 2004). Reduced sulphur compounds such as elemental sulphur and sulphide can also be used as electron donors in the process of sulphur oxidation. Sulphur oxidizers often live attached to a surface, because elemental sulphur does not dissolve in water. Oxidation, from either S0 or S2 , leads to the production of sulphite, sulphate and H þ and may lower the ambient pH considerably. Sulphur oxidizers are autotrophs that fix CO2 by means of the Calvin cycle. The sulphur-oxidizing system was investigated in detail in the Gram-negative lithoautotrophic species Paracoccus pantotrophus (Friedrich et al. 2001). The sox gene cluster of P. pantotrophus comprises at least 15 different protein-encoding genes. Seven of these genes encode four proteins with sulphite oxidase and sulphur dehydrogenase activities. The cluster also contains transcriptional regulators and transport regulators. Evidence has emerged that similar proteins are present in other bacteria, but not in the archaeon Sulfolobus solfataricus. Homologies can be drawn between the genes of the various species (Fig. 4.10), and a common mechanism for all sulphur-oxidizing bacteria is emerging (Friedrich et al. 2001). Regarding the phosphorus cycle, we note that it is dominated by physical processes (erosion, precipitation) more than by biological influences. Phosphorus undergoes hardly any microbe-mediated redox reactions in the environment; an exception is the process of phosphite oxidation conducted by
STRUCTURE AND FUNCTION IN COMMUNITIES
1 2 skiV W
1 kb
1 2 skiV W
199328
X Y Z
X
W
A
A
B
C
Y Z
B
C
D
E
D
W
E
F
P. pantotrophus GB17
H
G
F
139
F
W
213304 514920
Z Y
517441 689903
G
690889
1264888
A
1265910
R. palustris
W
1537634
E
F
X Y Z
A
W
B
W
W
A
X
B
Z AA
W
1536345 1276828
W Y
W
B
W
E
F
G
F
X
W
W
C
Y Z
B
B
D
Z
A
B
C. tepidum
A. vinosum W W
W
H
1269540
677784
C
677185
W W
C
2
C
2
545540
E
544374 147541
G
F
W W
G
E
E
F
W
F
144273
A. aeolicus
R. capsulatus
M. extorquens
S. novella
P. salicylatoxidans KCT001 C
S. solfataricus
Figure 4.10 Map of the sox gene cluster of Paracoccus pantotrophus and other sulphur-oxidizing bacteria. Homologies are indicated by common letters. Explanation of gene codes: 1, ArsR-type transcriptional regulator; 2, periplasmic thioredoxin; skiV, membrane-bound transporter involved with cytochrome c biogenesis; W, periplasmic thioredoxin; X, Y, Z, A, B, C, and D, structural genes encoding four proteins—SoxXA, SoxYZ, SoxB, and SoxCD; E–H, proteins of unknown function. P. pantotrophus, Paracoccus pantotrophus; R. palustris, Rhodopseudomonas palustris; C. tepidum, Chlorobium tepidum; A. vinosum, Allochromatium vinosum; A. aeolicus, Aquifex aeolicus; R. capsulatus, Rhodobacter capsulatus; M. extorquens, Methylobacterium extorquens; S. novella, Starkeya novella; P. salicylatoxidans, Pseudaminobacter salicylatoxidans; S. solfataricus, Sulfolobus solfataricus. After Friedrich et al. (2001), by permission of the American Society for Microbiology.
lithoautotrophic sulphate reducers (Schink and Friedrich 2000), in which the redox state of phosphorus changes from þ3 to þ5. All organisms need phosphate, which they take up using membrane-bound transport systems, of which there is a great variety. Phosphorus may be present in the environment as polyphosphates (long chainpolymers of phosphate, contrasted with orthophosphate, PO3 4 ) and these need to be hydrolysed before take-up. Microorganisms use exopolyphosphatase to hydrolyse polyphosphates. The ppx operon of E. coli K12 encodes this enzyme, and presumably many microorganisms have similar loci. In addition, all cells, prokaryotic and eukaryotic, accumulate polyphosphate internally, where it functions as a phosphate reserve and as a sequestration mechanism for otherwise toxic cations, for example Ni and Pb (Kulaev and Kulakovskaya 2000). Another major source of phosphate in the environment is organic phosphorus in dead organic matter, from which phosphate is released during decomposition by phosphatase activity of heterotrophic microorganisms. The fact that biota do not directly alter the chemical appearance of phosphorus in the
environment to a great extent does not diminish the important growth-limiting effect that phosphate has in most aquatic systems and to an extreme degree in the sea. Iron has two oxidation states, ferric (III) and ferrous (II), and undergoes redox reactions in the environment catalysed by microorganisms. Since the valency of the iron atom is correlated with differences in solubility and stability of its compounds, iron redox reactions have important consequences for the biogeochemical cycles of other elements, especially sulphur and phosphorus. For example, Fe2 þ may precipitate with S2 to form insoluble FeS, preventing the release of gaseous H2S, and Fe3 þ oxides may bind phosphate, preventing the dissolution of phosphate in water. The latter phenomenon is well-known among limnologists who are familiar with the fact that release of phosphate from sediment into the overlying water is much greater under anaerobic conditions than from the same sediment under aerobic conditions. The most important bacteria conducting iron reduction in the environment are from the genus Geobacter (Deltaproteobacteria). Other iron reducers
140
INTRODUCTION TO ECOLOGICAL GENOMICS
are Shewanella (mainly marine), Geothrix, and Anaeromyxobacter (North et al. 2004). Most iron reducers can also use other metal ions as electron acceptors, such as uranium (VI) and manganese (IV). Various organic molecules (e.g. acetate, benzene and toluene) can act as electron donors in Fe3 þ -dependent anaerobic growth. By oxidizing organic molecules in conjunction with iron reduction, iron-reducing bacteria may contribute significantly to the natural purifying capacity of subsoils, for example when ferric-rich aquifers are polluted by leachate from landfills or oil-storage tanks (Lovley 2003; see also Fig. 4.4). The genomes of Shewanella oneidensis and Geobacter sulfurreducens have been sequenced completely (Heidelberg et al. 2002; Methe´ et al. 2003). The genomes of these species contain an unprecedented number of c-type cytochromes, some with two or more haem groups. The abundance of cytochromes highlights the importance of electron transport to these organisms. Three different strategies are followed by Fe3 þ reducing bacteria (Lovley et al. 2004): they can attach to an iron-rich surface and transfer electrons directly to the mineral, they can release iron chelators to bring iron to the cell where it can be reduced, or they can use extracellular electron shuttles to transfer electrons back and forth between the mineral and the cell. A model for the latter mechanism, iron reduction at a distance, was proposed by Croal et al. (2004) and Lovley et al. (2004) (see Fig. 4.11a). Different iron-reducing bacteria seem to have different sets of cytochromes, although there are also some genes that are common among the three species G. sulfurreducens, Sh. oneidensis, and Desulfovibrio vulgaris. These genes are potential markers for iron reduction activity in the environment. Recently, Chin et al. (2004) showed that expression of omcB, a gene encoding an outer membrane c-type cytochrome (Fig. 4.11a), was very well correlated with Fe-reduction rates in G. sulfurreducens. It is not yet certain that this gene can be used as a universal indicator of Fe-reducing capacity in the environment; the relatively small overlap between the derived gene complements of different iron-reducing bacteria suggests that their metal-reducing capabilities are not simply related to their sharing an exclusive set of genes.
(a)
Fe(III)
Fe(II) ?
OmcA
OmcB MtrB
OM Fe(II)
MtrA
Fe(III)
? ?
CctA
PERI.
CymA CM
(b)
MQ
Fe(II)
OM
Fe(III)
Cyc2 Rus Iro? Cyc1
PERI.
CoxABCD
O2
2H2O
Figure 4.11 Models for electron-shuttling processes involved in (a) Fe2 þ reduction by Shewanella oneidensis MR-1 and (b) Fe3 þ oxidation by Acidithiobacillus ferrooxidans. OM, outer membrane; PERI., periplasmatic space; CM, cell membrane; OmcA and OmcB, outer-membrane cytochromes A and B; MtrA and MtrB, metal-reduction proteins A and B; CctA, small tetrahaem c-type cytochrome A; CymA, inner-membrane cytochrome A; MQ, menaquinone; Cyc1 and Cyc2, c-type cytochromes 1 and 2; Rus, rusticyanin; Iro, ferredoxin; CoxABCD, cytochrome oxidase complex. After Croal et al. (2004) with permission from Annual Reviews.
In addition to metal reductase activity associated with anaerobic respiration, iron is also reduced during uptake into the cell (assimilative iron reduction). Fe is often scarce in the environment because of the insolubility of Fe(OH)3. Therefore many organisms have developed mechanisms of scavenging Fe3 þ by excreting compounds in the medium with an extremely high iron affinity. Citrate is often used for this purpose, but also molecules completely geared to Fe chelation, siderophores, are used. These compounds may either donate Fe to a membrane-bound transporter or be taken up entirely by pinocytosis after binding to a membrane
STRUCTURE AND FUNCTION IN COMMUNITIES
receptor. Genes encoding ferric citrate transporters and iron siderophore receptor proteins are found in many bacteria. Expression of siderophore receptor proteins is regulated by membrane-bound sensor systems encoded by fecIR genes. Few bacteria use iron oxidation as an energyyielding reaction; large amounts of iron need to be oxidized in order to deliver sufficient energy for growth. Iron oxidation can take place under anaerobic conditions by nitrate reducers and photoautotrophs (Straub et al. 2004), but most iron-oxidizing bacteria are aerobic acidophiles. At neutral pH hardly any energy can be gained from iron oxidation under aerobic conditions because ferrous ion then oxidizes spontaneously to ferric iron. Iron oxidation leads to the formation of Fe(OH)3 precipitates; this process is recognizable in many places with a boreal climate, where ironrich groundwater from acidic marshes comes into contact with aerobic sandy soils. Another environment where iron oxidation is important is acid-mine drainage; a very acid leachate develops under the influence of iron oxidizers and sulphur oxidizers when iron sulphide comes into contact with the air in coal mines (see Section 4.4). Model species for iron oxidation are Acidithiobacillus (Thiobacillus) ferrooxidans (Gammaproteobacteria) and Leptospirillum ferrooxidans (Nitrospirae). A crucial role in iron oxidation by Ac. ferrooxidans is played by a periplasmic coppercontaining protein, rusticyanin (Fig. 4.11b). This protein oxidizes ferrous ion in the periplasm and then reduces a cytochrome in the cell membrane. After a very short electron-transport chain O2 is reduced to water under consumption of H þ , allowing the generation of ATP. The rus operon of Ac. ferrooxidans encodes the rusticyanin protein as well as two c-type cytochromes (cyc1 and cyc2) and four subunits of a cytochrome c oxidase (coxABCD). Recent work by Yarza´bal et al. (2004) has shown that expression of this operon is induced by ferrous ions and so rus seems an excellent candidate for indicating the capacity of iron oxidation in the environment (Table 4.6). Regarding the calcium cycle, a significant influence, at least in oceanic systems, is due to coccolithophorid algae (Coccolithophorida,
141
Chrysophyta). Emiliania huxleyi is a well-known representative from this group, recognized by its beautiful platelets of calcite, coccoliths, which form a skeleton structure around the cell (Fig. 4.12). Em. huxleyi, although very small, is extremely common in the ocean, such that extensive fields of Em. huxleyi blooms can be observed even from space. Coccolithophorids are favourite study objects among palaeontologists because they are abundant in marine sediments extending back to the Cambrian era, and may be used as indicators for climate reconstruction. The ecological relevance of these organisms is due to the fact that they fix carbon not only for synthesis of organic molecules but also for coccolith formation. By sedimentation of cells to the bottom of the ocean significant amounts of carbon and calcium are withdrawn from the biological sphere of influence. The coccoliths are formed inside the cell in specialized calcifying vesicles of the Golgi apparatus, and later pushed outwards. The formation of calcifying vesicles is an interesting model for biomineralization. It is assumed to involve a vacuolar-type ATPase (V-ATPase), a proton pump that is known from many other eukaryotes as well. Ca2 þ and CO2 ions are assumed to precipitate as CaCO3 3 on a macromolecular template inside the vesicle.
Figure 4.12 Scanning electron micrograph of Emiliania huxleyi, a representative of the Coccolithophorida (Chrysophyta, golden algae), well-known for its beautiful external platelets, coccoliths, made of calcium carbonate. Coccolithophorids are a key link in the oceanic carbon and calcium cycles. Courtesy of Jeremy Young and Markus Geisen, Palaeontology Dept., The Natural History Museum, London.
142
INTRODUCTION TO ECOLOGICAL GENOMICS
Coccolithophores have very large genomes, exceeding 200 Mbp, and there is hardly any genomic information about Em. huxleyi, although Wahlund et al. (2004) developed a cDNA library and sequenced 3000 ESTs. The library was found to contain multiple copies of genes for calnexin and calreticulin, two chaperones that play a key role in calcium homeostasis, but the authors did not find a V-ATPase. Further research is needed before a definitive marker gene for calcification can be identified. The silicium cycle in the ocean is greatly influenced by diatoms (Bacillariophyta) who incorporate silicium in their silica cell wall or frustule. Like coccolithophorids, diatoms withdraw carbon from the atmosphere by sinking to the bottom of the sea, and in doing so also remove silicium from the sea water. The delicate structure of diatom frustules and their bewildering array of forms (Fig. 4.13) have fascinated biologists ever since the invention of the microscope and their reproducible fine structure presently also raises interest among nanotechnologists (Bradbury 2004). The genome of Thalassiosira pseudonana, a diatom with a centric cell shape (resembling a Petri dish, in contrast with elongate, pennate cells), has recently been (a)
(c)
(b)
(d)
Figure 4.13 Scanning electron micrographs of centric and pennate species of diatom. (a) Biddulphia reticulata, (b) Diploneis sp., (c) Eupodiscus radiatus (single valve), (d) Melosira varians. Scale bars, 10 mm. Courtesy of Mary Ann Tiffany, San Diego State University.
sequenced (Armbrust et al. 2004). Not surprisingly, the genome contains many genes with a function in silicium metabolism. The authors identified three genes that encode transporters for active uptake of silicic acid. Silica precipitates in a silicadeposition vesicle, in a process controlled by a family of phosphoproteins called silaffins, that are embedded in the frustule while it is being formed. Five such silaffins could be identified in the genome of Th. pseudonana, but surprisingly these did not match proteins of similar function in other diatoms and sponges. Another group of proteins associated with frustule formation are the frustulins (casing glycoproteins), which protect the frustule at the outside.
4.3.4 Microarray-based screening of functional genes Not all the genes discussed above and mentioned in Table 4.6 have been exploited for environmental screening with genomics technology. Until now, the nitrogen cycle has attracted most attention, primarily because it offers such a rich variety of enzymatic systems, many of which have welldescribed biochemistries (Ye and Thomas 2001). We saw in Table 4.2 that functional gene microarrays are designed to detect the presence of genes with specific functions in the environment, irrespective of the species. Depending on hybridization conditions, all genes showing a sequence similarity of more than 80% with the probes will be detected. Microarray screening of functional genes provides an indication of the capacity to conduct the function, it does not demonstrate the function itself. Assessment of the function itself requires isolation of RNA and reverse transcription to cDNA, followed by competitive microarray hybridization, as in the case of transcription profiling in model organisms (Section 2.6). Such studies are more difficult in environmental microbial communities than in model eukaryotes, because of the instability of microbial mRNA, which is characterized by long transcription products without poly(A) tails covering several genes, and the ensuing difficulty of obtaining reliable RNA samples other than rRNA from environmental matrices (Ye et al. 2001).
STRUCTURE AND FUNCTION IN COMMUNITIES
One of the first attempts to apply DNA array technology for assessing functional gene diversity was made by Wu et al. (2001). These authors developed a prototype microarray with 104 probes representing PCR-amplified genes from bacteria involved in nitrogen cycling: the nitrate reductase genes nirS and nirK, and the ammonium monooxygenase gene amoA. Strong hybridization signals were obtained with DNA extracted from a marine sediment and from a surface soil. The diversity of nirS and nirK genes was similar in the two environments, indicating comparable capacities for denitrification. Similar results were obtained by Tiquia et al. (2004), who used an oligonucleotide microarray with several hundred 50-mer probes developed from genes in the cycles of nitrogen, carbon, and sulphur (nirS, nirK, amoA, nifH, pmoA, and dsrAB). Although the potential for detection was clearly demonstrated, sensitivity is still a critical issue in these hybridization experiments, because they use DNA extracted directly from the environment without prior PCR amplification. It is estimated that only genes from populations contributing more than 5% to the environmental genomes can be detected in this way (Cho and Tiedje 2002); however, this figure can be brought down to 1% by using modified 70-mer probes printed on special substrates (Denef et al. 2003). Bodrossy et al. (2003) developed a functional gene microarray for methanotrophs. A survey of published pmoA and amoA gene sequences allowed the construction of a nested set of 68 probes that together could diagnose almost the entire known diversity of methanotrophs. A microarray with these probes was fabricated and used to survey methanotroph diversity in soils and microcosms. The study confirmed that all cells representing more than 5% of the targeted community could be detected. As an example of successful use of functional gene microarrays (with prior PCR amplification) in an ecological context we will discuss the work by Taroncher-Oldenburg et al. (2003). These authors developed a microarray with 70-mer oligonucleotides targeting genes encoding the functions of nitrification (amoA), nitrogen fixation (nifH), and denitrification (nirK, nirS). Samples were taken
143
from sediments in the Choptank river (in Maryland, USA) and extracted DNA was amplified with gene-specific primers. Data for nirS diversity are shown in Fig. 4.14. Among 64 nirS probes, 29 were detected in a sample from the upstream area, and 11 in the downstream area. Hybridizations were distributed over a great variety of sequences; that is, they were not limited to a distinct cluster in the dendrogram of probe sequences. The data suggest that the composition of denitrification genes is quite different between the two sampling sites. It is also evident that the diversity of denitrification genes is lower in the downstream location. Denitrification rates measured in sediment cores from the downstream river station were also lower than in the upstream location. So, this study suggests a positive correlation between community biodiversity and ecological function, in accordance with the ‘rivet hypothesis’ mentioned at the beginning of this chapter. The differences in the composition of the denitrifier community were possibly related to an environmental gradient of salinity and dissolved organic carbon in the river. Studies like this are still relatively rare. This may be taken to illustrate that the declared promises of microarray-based microbial detection have not yet been realized. Most studies reported in the literature are still in the development and testing phase; more work needs to be done to increase sensitivity and specificity (Cho and Tiedje 2002; Zhou 2003). In addition to solid-support microarrays, the use of membranes for probe immobilization (macroarrays) is another attractive option (Jenkins et al. 2004; Steward et al. 2004). It is to be expected that technology development will not halt and that the coming years will see more definite tests of the diversity-function hypothesis with the aid of genomics technology. An interesting new development is the combination of stable-isotope probing (SIP) with microarray analysis (Dumont and Murrell 2005). In SIP, a substrate (e.g. methanol), enriched with a stable isotope (e.g. 13C) is added to an environmental sample and after a designated incubation time DNA is extracted. DNA from microorganisms that have taken up the substrate can be separated from other DNA by using CsCl density-gradient
144
INTRODUCTION TO ECOLOGICAL GENOMICS
76020’W
76010’W
76000’W
CR1A 38045’N
Paracoccus pantotrophus Paracoccus denitrificans CR1A2-132 CR1A2-138 CR1A-2 CR1A2-31
38040’N
38035’N
38030’N
HP Paracoccus pantotrophus Paracoccus denitrificans CR1A2-132 CR1A2-138 CR1A-2 CR1A2-31
CR1A2-40 Roseobacter denitrificans CR1A2-20 CR1A2-8 CR1A-17 CR1A-18 CR1A2-57 CR1A-24 CR1A2-5 CR1A2-95 CR1A-19 CR1A-25 CR1A-29 CR1A2-7 CR1A2-58 CR1A2-53 CR1A2-37 CR1A2-6 CR1A2-70 CR1A2-94 CR1A-9 CR1A2-36 CR1A2-115 CR1A2-124 CR1A2-110 CR1A2-48
CR1A2-40 Roseobacter denitrificans CR1A2-20 CR1A2-8 CR1A-17 CR1A-18 CR1A2-57 CR1A-24 CR1A2-5 CR1A2-95 CR1A-19 CR1A-25 CR1A-29 CR1A2-21 CR1A2-7 CR1A2-64 CR1A2-58 CR1A2-139 CR1A2-53 CR1A2-4 CR1A2-37 CR1A2-89 CR1A2-6 CR1A2-81 CR1A2-70 CR1A2-97 CR1A2-94 CR1A2-61 CR1A-9 CR1A-26 CR1A2-36 Pseudomonas aeruginosa CR1A2-115 CR1A2-124 Pseudomonas fluorescens CR1A2-110 Ralstonia eutropha CR1A2-48 CR1A-27 CR1A2-21 CR1A2-27 CR1A2-64 CR1A-13 CR1A2-139 CR1A2-19 CR1A2-4 CR1A2-24 CR1A2-89 CR1A2-93 CR1A2-81 CR1A2-54 CR1A2-97 CR1A2-25 CR1A2-61 CR1A2-137 CR1A-26 CR1A-12 Pseudomonas aeruginosa Thauera aromatica T1 Pseudomonas fluorescens Thauera aromatica 3CB3 Raistonia eutropha CR1A2-35 CR1A-27 CR1A2-55 CR1A2-27 Thauera selenatis CR1A-13 Azoarcus evansii KB740 CR1A2-19 Azospirilium brasiliense CR1A2-24 Pseudomonas stutzeri JM300 CR1A2-93 Alcailigenes faecalis CR1A2-54 Pseudomonas stutzeri 14405 CR1A2-25 CR1A2-137 CR1A-12 Thauera aromatica T1 Thauera aromatica 3CB3 CR1A2-35 CR1A2-55 Thauera selenatis Azoarcus evansii KB740 Azospirillum brasiliense Pseudomonas stutzeri JM300 Alcaligenes faecalis Pseudomonas stutzeri 14405
STRUCTURE AND FUNCTION IN COMMUNITIES
centrifugation. The diversity of this DNA can then be screened with a microarray, usually targeting the 16 S rRNA gene. By focusing only on DNA in which 13 C is incorporated, a profile is obtained of a single functional guild, defined by the capacity to metabolize the substrate (DeLong 2001; Gray and Head 2001; Radajewski et al. 2003; Wellington et al. 2003). Another promising, newly developed, technique goes under the name isotope array (Adamczyk et al. 2003). As in SIP, a labelled substrate is added to a community, but the label is a radioisotope such as 14 C. rRNA is then extracted, labelled with a fluorescent label, and screened for 16 S rRNA diversity using a phylochip (see Section 4.2). By scanning for both flurorescence and radioactivity one can single out species from a designated functional guild that have proven to be active because they have taken up the substrate. Adamczyk et al. (2003) used this approach to profile nitrifying communities in activated sludge from two different wastewater-treatment plants. Diversity of ammonia-oxidizing bacteria in the sludge was assessed from the incorporation of added bicarbonate (leading to radioactively labelled rRNA) combined with hybridization to ammonia-oxidizing bacterium-specific 16 S rRNA probes (which is possible since ammonia-oxidizing bacteria constitute a monophyletic lineage). Such a combination of different molecular tools seems to be particularly promising.
4.4 Reconstruction of functions from environmental genomes An exciting new development in microbial genomics is the exploration of communities by isolating large fragments of DNA directly from the environment and cloning them into vectors such as BACs, followed by probing, sequencing, or screening for functions (Ball and Trevors 2002;
145
Handelsman 2004; Riesenfeld et al. 2004a; Tiedje and Zhou 2004; Allen and Banfield 2005; DeLong 2005; Schleper et al. 2005). This approach, designated community genomics or metagenomics, allows insight into microbial diversity, and it may lead to the discovery of new genes and functions, novel metabolic pathways, and previously unknown properties of microorganisms that cannot be cultured. Most importantly, metagenomic analysis may lead to reconstruction of functions from genome sequences of organisms that have never been cultured. Comparative analysis of different environments has demonstrated that metagenomes contain habitat-specific signatures that can be used for environmental diagnosis (Tringe et al. 2005). Sometimes genes found in metagenomes may be ‘brought to life’ in the laboratory by expressing the DNA segment in a suitable host. A characteristic property of the metagenomics approach is that genes and functions are studied without consideration of the species from which the DNA derives. The metagenome of a habitat thus consists of the collective genomes of all organisms together. Of course, such an approach has its limitations, because a specific cell environment and the joint expression of several genes together in a delimited volume are often crucial to the function. In addition, the genomes of different species will differ in dynamics and responses to environmental change, and so the composition of a metagenome could be highly variable in time (DeLong 2001). Nevertheless, several important discoveries have been made by probing communities in this way, as we will see in the examples discussed below. Two different approaches may be discerned for screening environmental genome libraries: function-driven screening and sequence-driven screening (Schloss and Handelsman 2003). In the first approach, the aim is to identify clones in the library that express a certain function, often one that
Figure 4.14 Comparison of nirS (cytochrome cd1-containing nitrite reductase) gene diversity in two samples taken from sediments of the Choptank river, Maryland, USA. A total of 64 nirS probes (each 70 bp) were spotted on a microarray and the similarity between these sequences is shown as a dendrogram. Probes were developed from environmental nirS sequences isolated earlier (indicated by codes) and from pure cultures of bacteria (indicated by species names). Positive hybridizations are shown in white type on a black background. The diversity of nirS sequences is greater in the upstream location (CR1A) than in the downstream location (HP). After Taroncher-Oldenburg et al. (2003) by permission of the American Society for Microbiology.
146
INTRODUCTION TO ECOLOGICAL GENOMICS
has potential applications in medicine, agriculture, or ecology. For example, one may be interested in genes from biosynthetic pathways for antibiotics or genes associated with crucial links in biogeochemical cycles. Usually the frequency of active clones is quite low, so one needs a simple assay by which large numbers of clones in a library can be tested quickly. A clever, high-throughput, method was developed for this purpose by Uchiyama et al. (2005). The authors made use of the fact that many genes are induced by the substrate that they catabolize. A vector containing green fluorescent protein, suitable for shotgun cloning, was used with the effect that host cells with an insert carrying the promoter of the target gene expressed green fluorescent protein in the presence of the target substrate; these cells could then be sorted by an automated cell-sorting system. In the second type of screening, sequence-driven screening, one uses hybridization probes to detect clones containing a desired known sequence. The probe can be a phylogenetic anchor, such as a 16 S rRNA sequence, or a specific functional gene. A variant to sequence-driven screening was proposed recently by Sebat et al. (2003), who screened a metagenomic library with a microarray. In their study, the microarray consisted of probes from a stable reference community, cloned in a cosmid library. Hybridizations with the metagenomic library were evidence of the presence of certain species. A great advantage of microarray-based screening of libraries is that many probes are used in parallel. Library screening is usually followed by partially or completely sequencing the clones of interest. In addition, the library may also be sequenced from the start, without prior screening, if one is interested in all sequences. In this case the library is not prepared with large-insert cloning vectors such as BACs, but with small-insert plasmid vectors that are suitable for direct sequencing. By picking out clones at random and following the WGS philosophy (see Section 2.2), assembly of multiple complete genomes is then attempted. We will discuss examples of all these approaches below.
4.4.1
Marine community genomics
One of the most appealing results of community genomics is the discovery by Be´ja` et al. (2000a) of proteorhodopsin in the ocean. As we have seen above, proteorhodopsin is a retinal-dependent light-driven proton pump, which may support a photoheterotrophic lifestyle of marine bacteria. The widespread presence of this pathway in the carbon cycle was an unexpected outcome of genomics exploration. Crucial to the approach applied by Be´ja` et al. (2000a) was the construction of a large-insert BAC library after preparation of DNA using a special type of electrophoresis, pulsed-field gel electrophoresis (Be´ja` et al. 2000b). With this technique, applied to environmental DNA digests, it was possible to isolate high-molecularmass DNA fragments up to several hundred kilobase pairs. The library was screened with 16 S rRNA probes to survey the taxonomic diversity and to find clones with new species of Archaea and Bacteria. Be´ja` et al. (2000a) decided to sequence a 130 kbp genomic fragment from a clone in which the 16 S probe had detected an rRNA sequence of an uncultivated member of marine Gammaproteobacteria, the SAR86 group. Sequencing the rest of the clone revealed an ORF for a rhodopsin-like protein called proteorhodopsin, which showed similarity with rhodopsin genes from extreme halophilic Archaea and the fungus Neurospora crassa (Fig. 4.15). Rhodopsins act as transmembrane channels that can bind the chromophore retinal (a derivative of vitamin A) to become sensitive to light. Absorption of light energy by the protein–retinal complex leads to a series of conformational shifts, promoting the transport of ions across the cell membrane. In the case of proton transporters, the outside surface of the cell membrane will become charged with protons and the resulting electrochemical membrane potential creates a motive force for another membrane-bound molecule, H þ -ATPase, to drive ATP synthesis. Three groups of rhodopsins are present in Archaea, one group acting as chloride pumps (halorhodopsins), another as proton pumps (bacteriorhodopsins), and the third
STRUCTURE AND FUNCTION IN COMMUNITIES
147
Bacteriorhodopsin H+ pump
Halorhodopsin CI– pump
BR_Halval 2829812 BR_Halsp_4579714 BR_Halsod_3023375
HR_Natpha_114809 HR_Halsp2_4579716
36 69
100
BR_Halhal_114811
71
HR_Halval_2829811 HR_Halsod_4579718
Proteorhodopsin
83 89 60
54
78
65
HR_Halsp1_114808 81
100
NOP1_Neucra _5565892
SR_II_Natpha _1168615
0.10
SR-II_Halval _1168614
58
SR-I_Halval _2499388
SR-I_Halsod_4579720 SR-I_Halhal_114812
Sensory rhodopsin
Figure 4.15 Unrooted phylogenetic tree of the proteorhodopsin sequence of an uncultured marine gammaproteobacterium found by Be´ja` et al. (2000a), aligned with rhodopsins in Archaea and the fungus Neurospora crassa. HR, halothodopsin, light-driven chloride pumps; BR, bacteriorhodopsin, light-driven proton pumps; SR, sensory rhodopsin; Halsod, Halorubrum sodomense; Halhal, Halobacterium salinarum; Halval, Haloarcula vallismortis; Natpha, Natronomonas pharaonis; Halsp, Halobacterium sp. (all Archaea); Neucra, N. crassa (Ascomycota). The scale bar indicates the proportion of amino acid difference. Reprinted with permission from Be´ja` et al. (2000a). Copyright 2000 AAAS.
as photosensory receptors (sensory rhodopsins). The last group of molecules is related to the opsin proteins found in eyes throughout the animal kingdom. In N. crassa a related opsin protein acts in the maintenance of circadian rhythmicity. That the sequence found in the marine BAC clone represented a functional protein and not a pseudogene of some sort was proven by recombinant expression. E. coli cells, transfected with the rhodopsin sequence, expressed the protein and it was shown that a combination of retinal and yellow light triggered cross-membrane proton transport in E. coli cell suspensions (Fig. 4.16). Subsequent research using membrane preparations collected directly from seawater exposed to laser-flash photolysis demonstrated that similar photoactive molecules were very common in the environment (Be´ja` et al. 2001). The widespread occurrence of proteorhodopsins in the sea was confirmed by Venter et al. (2004). As
mentioned in Section 4.2, these authors applied the WGS sequencing approach to microbial communities collected from the Sargasso Sea off the coast of Bermuda. The intention was to collect representative sequences from many diverse organisms simultaneously. Whereas the WGS approach is normally used to assemble a genome sequence for an individual species, the community WGS approach aimed to reconstruct as many genomes as possible from the mixture of genomes of varying abundance. In total 1.36 Gbp of microbial DNA sequence was generated, from at least 1800 genomic species, including 148 previously unknown bacterial phylotypes and 1.2 million previously unknown genes. Some distinct groups of sequence scaffolds could be distinguished, one clearly related to a Burkholderia species, others to Shewanella, Prochlorococcus, and a SAR86 gammaproteobacterium. The presence of Burkholderia, a nutritionally versatile genus of Betaproteobacteria,
148
INTRODUCTION TO ECOLOGICAL GENOMICS
Off On Proteorhodopsin
Retinal
–
–
+
–
–
+
+
+ pH 0.02
5 min On Off
Figure 4.16 Diagram showing the pH change in a medium with cell suspensions of E. coli expressing a proteorhodopsin. In the presence of both the protein and retinal, an outward transport of protons occurs when the cells are exposed to yellow light (>485 nm, indicated by On/Off), leading to a decrease in the pH of the medium. Reprinted with permission from Be´ja` et al. (2000a). Copyright 2000 AAAS.
was unexpected, because this genus was considered typical for terrestrial environments. Similarly, Shewanella is an abundant genus in aquatic, nutrient-rich environments. The presence of these organisms in the open ocean shows that they have a wider ecological amplitude than thought previously, or that there are nutrient-rich microhabitats (possibly associated with marine animals or anthropogenic waste) in which they may survive. In the metagenome of the Sargasso Sea Venter et al. (2004) found 782 different rhodopsin-like genes, which were classified into 13 distinct subfamilies. Four of these families consisted of the archaeal, fungal, and sensory rhodopsins mentioned above, but nine families were related to sequences from uncultured species, including seven only known from the Sargasso Sea samples. Analysis of scaffolds containing both a taxonomic marker (s subunit of RNA polymerase) and a
rhodopsin gene demonstrated that rhodopsins are not limited to the Gammaproteobacteria in which Be´ja` et al. (2000a) had first discovered them. For example, in one scaffold a rhodopsin was found together with a s subunit RNA polymerase from the phylum Flavobacteria. Bioinformatic analysis of the massive sequence data from the Sargasso Sea is by no means exhausted. It is expected that many more functional aspects of marine bacterial communities can be recovered from these data, while still more sequence information is expected to come from the Sorcerer II expedition. Table 4.7 provides an overview of some functional aspects of the Sargasso Sea sequence data. As an example, consider the presence of an ammonia monooxygenase gene sequence associated with an archaeal taxonomic marker, which indicates scope for archaeal nitrification in this environment. Previously, marine biologists had argued that nitrification in the ocean was hardly possible due to the sensitivity of chemoautotrophic bacteria to high levels of UV irradiation. Nitrification by Archaea would not be inhibited by UV light and this activity would be in accordance with the relatively high nitrite concentrations that are seen along with nitrate at certain times of the year in the Sargasso Sea. In a commentary to the paper by Venter et al. (2004), Falkowksi and De Vargas (2004) remarked that the massive sequencing approach is reaching its limits when applied to community genomes. For example, despite the huge sequencing effort, only two nearly complete genomes (those of Burkholderia and Shewanella) could be reconstructed, and this could only be achieved by using already existing databases as a reference to support the assembly. The major part of the community is represented by rare organisms, and to obtain 95% coverage of these more than an order of magnitude of sequencing depth would be needed. Furthermore, if the approach was extended from prokaryote to eukaryote DNA the project would become much more problematic, because some dominant eukaryotes in seawater plankton (dinoflagellates, coccolithophorids) have extremely large genomes. Despite these obvious limitations, further WGS sequencing of marine communities
STRUCTURE AND FUNCTION IN COMMUNITIES
149
Table 4.7 List of some remarkable functional insights reconstructed from WGS sequencing of Sargasso Sea microbial DNA by Venter et al. (2004) Genomic property
Functional relevance
782 different rhodopsin genes belonging to 13 protein families
Rhodopsin-mediated phototrophy is very common in oceanic bacterial plankton Rhodopsin-mediated phototrophy distributed well outside the Proteobacteria Oceanic nitrification not limited to the Bacteria; there are nitrifiers among the Archaea, and ammonia oxidation is not inhibited by UV light Versatile use of phosphorus compounds in oceanic environment to deal with severe phosphorus limitation
Rhodopsin gene in scaffold bearing a taxonomic anchor from the Flavobacteria/Cytophaga group Ammonia monooxygenase in archaeal-associated scaffold Genes encoding phosphonate and high-affinity phosphate transporters; many genes responsible for utilization of pyrophosphates and polyphosphates Gene homologous to umuCD DNA damage-induced DNA polymerase of E. coli found on plasmid Genes for arsenate, mercury, copper, and cadmium resistance found on plasmids At least 50 bacteriophage gene groupings in scaffolds and 150 in singletons
will undoubtedly lead to new surprises and possibly new insights in oceanic functions, even though complete reconstruction of communities may remain beyond reach. Another marine metagenomic study focused on viral communities (Breithart et al. 2002). Viruses represent a very important factor in biogeochemical cycles and microbial biodiversity; by means of transduction they interfere with the genomes of their hosts, which for the marine ecosystem are mostly bacteria and algae. Viral activities are also considered important drivers of microbial community diversity by ‘killing the winner’ and promoting growth conditions of species with low abundance (Weinbauer and Rassoulzadegan 2004). Obtaining an overview of the biodiversity of viruses is difficult, because these organisms do not possess universal taxonomic anchors like the 16 S rRNA gene in prokaryotes. The DNA polymerase gene pol can be used as a taxonomic marker for a subset of viruses (Short and Suttle 2002). New taxonomic systems are being developed that use all the genes in a viral genome to determine distances between species. This is elaborated in the Phage Proteomic Tree, a database and taxonomic algorithm for classifying bacteriophages
Resistance against UV damage by allowing DNA replication even when damaged by UV irradiation Possible role of oceanic microorganisms in trace-metal cycling in an oligotrophic environment High diversity of phages in oceanic bacterial community; significant fraction of bacteria infected
(Edwards and Rohwer 2005). However, not many viral genomes have actually been sequenced completely (Paul et al. 2002). Another issue is that viruses cannot be cultured outside their hosts, which in the case of marine bacteria are themselves mostly uncultured. So, a metagenomic approach to surveying viral biodiversity seems very appropriate. In the study of Breithart et al. (2002) free-living viruses were collected by differential filtration and density-gradient centrifugation from surface sea water at two sites—Scripps Pier and Mission Bay—along the coast of California, USA. Special precautions must be taken when cloning viral DNA in a bacterial host, due to the presence of modified nucleotides and genes that could lyse the host. A total of 1934 sequences was obtained in a WGS approach, of which 70% showed no significant hits on sequences reported previously in GenBank. Among the remaining sequences no more than 34% were annotated in GenBank as viral sequences, and the rest were sequences of Archaea, Bacteria, and Eucarya, as well as mobile elements and repeat sequences. It appears that viral genomes carry a significant amount of DNA that originates from their hosts. About 83% of the
150
INTRODUCTION TO ECOLOGICAL GENOMICS
viral sequences were related to bacteriophages, and these were classified further over the major groups of phages (Fig. 4.17). The viral community seemed to differ between the two sampling sites. Viral genomes at Scripps Pier were more ‘bacterial’ in origin, whereas viral genomes of Mission Bay had a more eukaryotic signature. Among the phage types, the Siphoviridae (l-type phages) were more dominant at Mission Bay than at Scripps Pier. Why the viral community should differ between two sampling stations and whether there is any
ecological relevance in such differences remains uncertain. A possibility could be that viral community composition is a reflection of eukaryotic versus prokaryotic dominance of the plankton, for example due to algal blooms of variable composition. Given the fact that the majority of the two marine communities appears to be uncharacterized, any conclusions in this direction stand on shaky ground. Like the Sargasso Sea study illustrated above, the community analysis of marine genomes is still in the exploratory stage.
Scripps Pier
Mission Bay
(a) Hits to genBank Known (304)
Known (278) Unknown (569)
Unknown (783) (b) Biological groups
Archaea (2)
Archaea (5) Bacteria (89)
Virus (105)
Repeat (5)
Mobile (61)
Eucarya (13)
Virus (95)
Repeat (70)
Bacteria (71) Eucarya (36) Mobile (30)
(c) Phage types
Unclassified (3) Prophage Sipho (14) (21) Myo (21)
Podo (36)
Unclassified (5) Prophage Sipho (13) (22) Micro (2) Myo (7)
Podo (22)
Figure 4.17 Overview of the content of viral genomes recovered from two marine coastal sampling stations, Scripps Pier and Mission Bay in California, USA. (a) A total of 1934 sequences were BLASTed to GenBank and 582 sequences produced a significant hit. (b) These sequences were classified according to sequence annotation, and 200 sequences were truly viral. (c) Among the 200 viral sequences 166 were from bacteriophages and these were classified according to the main phage families: Sipho, Siphoviridae (l-like); Podo, Podoviridae (T7-like); Myo, Myoviridae (T4-like); Micro, Microviridae (fX174-like). From Breitbart et al. (2002), by permission of the National Academy of Sciences of the United States of America.
STRUCTURE AND FUNCTION IN COMMUNITIES
4.4.2
The soil metagenome
Soil organisms have been most valuable sources of all kinds of natural products ever since the Scottish bacteriologist Alexander Fleming discovered in 1928 that the soil fungus Penicillium produced a substance that killed Staphylococcus bacteria. Many other products derived from microbial secondary metabolites have been used to develop antibiotics, anticancer drugs, fungicides, immunosuppressive agents, enzyme inhibitors, antiparasitic agents, herbicides, insecticides, and growth promoters. Over the years, most of the microorganisms that can be cultured in the laboratory have been examined thoroughly for the production of compounds with biological activity, and biotechnological investigators have gained the impression that the limits of what these organisms can yield in terms of valuable products have been reached. However, as we have seen above, any environment, and certainly the soil, holds a great diversity of uncultured microorganisms that remain to be investigated. With the advent of metagenomic recombinant DNA technology (Handelsman et al. 2002) it became technically feasible to screen soil microorganisms for new functionalities without culturing them. This opportunity has raised great expectations and renewed interest in gene mining. The soil has been likened to Lady Bountiful (Rondon et al. 1999) and is considered a rich source for the discovery of novel natural products (Lorenz and Schleper 2002; Cowan et al. 2004; Daniel 2004, 2005). How high is the probability of finding a novel product by functional screening of a metagenomic library? Gabor et al. (2004) explored this question in a theoretical way by analysing existing genome sequences of microorganisms. Assuming a random approach to expression cloning, it was argued that the probability of isolating an expressed gene in a metagenomic library depends on the mechanism by which that gene is expressed. The minimal requirements for gene expression in a host include the presence of a promoter for transcription and a ribosome-binding site for initiation of translation. Both of these sites must be recognized by the expression machinery of the host. If expression involves trans-acting factors from the host—for
151
example special transcription factors, inducers, etc.—or if modifying enzymes are necessary for the gene product to become functional, the situation becomes much more complicated. Calculations were made for three modes of expression to estimate the number of clones that would have to be screened before a target gene was recovered with a probability of greater than 90%. For the most simple case, independent expression, the expected number of clones was found to depend on the size of the insert and decreased to around 3000 with an insert size increasing to 100 kbp. It was also estimated that 40% of the genes can be found in this way. So, if metagenomic screening effort covers a library of several thousands clones, each with an insert of 100 kbp, there is a fair chance that a designated gene will be found. A pioneering study in soil metagenomics was the work of Rondon et al. (2000). These authors developed BAC libraries with DNA isolated from agricultural soil in Wisconsin, USA. The largest library had 24 576 clones with an average insert size of 44.5 kbp, whereas 10% of the clones had an insert size of between 70 and 80 kb. It was estimated that this library contained 1000 Mbp of DNA; given an average density in microbial genomes of one gene per 1000 bp, about 1 million genes were expected to be present in the library. Screening of the library for biological activities employed a variety of strategies. For example, to find clones expressing the enzyme cellulase, plates with the host cells were overlaid with agar containing brilliant red hydroxyethyl cellulose, and a yellow halo around the colony was taken as an indicator of cellulase activity. In this way, a great variety of enzymatic activities were screened, including b lactamase, keratinase, chitinase, and amylase. A remarkable discovery coming from the metagenomic library screening conducted by Rondon et al. (2000) concerned a clone that had antibacterial activity against Bacillus subtilis and Staphylococcus aureus, but not against E. coli. The clone in which this activity was found was sequenced completely and it appeared to contain 29 ORFs, including a cluster of eight genes associated with phosphate transport. This showed that it is possible for BAC
152
INTRODUCTION TO ECOLOGICAL GENOMICS
clones to contain complete, intact, operons. Fourteen of the 29 ORFs could not be assigned a function. Using transposon mutagenesis, the genes were mutated to see which one was responsible for the antibacterial properties of the clone. Finally a single candidate gene was identified, of which the predicted amino acid sequence had several repeat units (Fig. 4.18). The authors also considered the hydrophobicity profile of this molecule. This is a plot
(a)
of scores along the sequence, in which each amino acid is given a number indicating the degree of hydrophobicity (see Lesk 2002). The profile of the unknown protein showed seven peaks, which is indicative of a membrane pump (amino acids anchored in the membrane have a high score for hydrophobicity if they are to be embedded stably in the lipophilic environment of the membrane). Recombinant expression of the protein confirmed
MSFMKRFFCSCLTVAVILTACFSAAAQSEGTLDVSFNTTGVRYEDFGGAD DKAMAVAVQLDGKIVSVGSSEVSGSGIDEAVVRYNSDGTLDSSFGTGGKV TTAIGPGTSSDIAYSVVIQSDGKIVVAGSAAGISGTETDFAIVRYNANGT LDTSFGGTGKVTTPFGVATSADVANSVALQADGNIVPAGYADDGSGADFA LARYNTNGSLDASFDTFGKTTTAIGAGTLGDFAQAVAIQSDGKIVAAGWT EAASGLSIDFALARYNTNGSLDATFDGDGKVITTVGSSTTFDLANAVLVQ ADGKIVAGGFSDSLSSGADEALVRYNTNGSLDTSFDTDGIVITAIGPGTY FDIAKAIVLQPDGKIIAAGYTDDLLVGFPSTDLALARYNVDGSLDTSFNA DGKATIDLGGTEIINGAAIYAGNRIVVAGSSASNFLTARIWIATLVTAAP VTVSGRITDERGRALKGVSVTLTDQDGVSSVASTNGFGYYRFTRVESGGT HFLHATDRGYTFAPPVRIVDTKSDVSDADFVGTKQKGKPNSTR
Hydrophobicity
(b)
100
200
300
400
500 3 2 1 0 –1 –2 –3
3 2 1 0 –1 –2 –3 100
200
300
400
500
Amino acid number
Figure 4.18 (a) Predicted amino acid sequence of a protein from an unknown soil organism, responsible for conferring antibacterial activity when expressed in E. coli. Amino acids are indicated by their standard single-letter codes. The ORF was discovered after screening a metagenomic BAC library made from DNA extracted from an agricultural soil. Repeated units are are shown underlined, in bold, or in italic. (b) Hydrophobicity profile of the ORF, showing seven clusters of hydrophobic amino acids (peaks above the line), which is indicative of a membrane protein. The horizontal axis shows amino acids numbered from N- to C-terminus and the vertical axis is a dimensionless score for the hydrophobicity of each amino acid. For details see the text. After Rondon et al. (2000), by permission of the American Society for Microbiology.
STRUCTURE AND FUNCTION IN COMMUNITIES
that it conferred antibacterial activity to the host; however, the protein itself was not active. The sequence shows significant homology with a gene in the genome of Bdellovibrio bacteriovorus, a deltaproteobacterium whose genomic sequence was established recently (Rendulic et al. 2004). Bdellovibrio is a predator of other bacteria and its genome is considered a valuable reservoir of antimicrobial substances. The nature of the possibly novel mechanism of antibacterial activity in the soil metagenomic library remains unknown to date (M. Rondon, personal communication). Functional metagenomic screening exercises similar to Rondon et al. (2000) have been applied by a several other authors (Henne et al. 2000; Gillespie et al. 2002; Knietsch et al. 2003; Voget et al. 2003; Piel et al. 2004; Riesenfeld et al. 2004b). These studies were all motivated by the search for products with a medical or biotechnological relevance. Metagenomic profiling for ecological functions (e.g. crucial links in biogeochemical cycles, organic matter decomposition, and allelochemical production) has not yet been attempted. Important insights into soil microbial communities have also come from sequence-driven screening of soil metagenomic libraries. Quaiser et al. (2002) were interested in the Crenarchaeota, a group of mesophilic Archaea that are frequently detected in soil communities; some of them are especially common in the rhizosphere. The Crenarchaeota are only known from their 16 S rRNA sequences and have never been brought into pure culture. Quaiser et al. (2002) screened a fosmid metagenomic library developed from DNA
Hydrol 01 DNA Polym
16S
23S
02
04 PHA Synth
extracted from a calcareous grassland near Darmstadt, Germany, using a 16 S rRNA probe. A clone of 33 925 bp which contained a crenarchaeotic 16 S rRNA gene was sequenced entirely. It contained 17 ORFs, of which five could not be assigned a function. An overview of the organization of the clone is given in Fig. 4.19. Among several others, an interesting cluster of genes was encoded in the crenarchaeote clone, which showed high similarity to the fixABCX gene cluster of nitrogen-fixing bacteria. In a phylogenetic analysis, the fixA gene of this operon clustered with fixA genes from two other Archaea, both hyperthermophilic crenarchaeotes. Together they seem to form a separate group which goes back to the ancestor of the Crenarchaeota, rather than to other Archaea or Bacteria via lateral gene transfer. As mentioned in Section 4.3, fix genes encode electron-transport flavoproteins and are co-expressed with the nitrogenase (nif ) gene cluster in nitrogen-fixing bacteria. Presumably electron-transport flavoproteins provide the electron transport to the nitrogenase complex. In the symbiotic plasmid of Rhizobium etli the fix genes are tightly associated with the nif cluster (Gonza´lez et al. 2003). The fixABCX operon is highly conserved in diazotrophs as well as in a wide variety of other bacterial and archaeal species; however, its function remains unknown in non-nitrogen fixing species. In E. coli fix genes are related to the carnitine pathway, a transport system of longchain fatty acids into the mitochondrion, prior to fatty acid oxidation. None of the obligately aerobic Archaea that contain the fix genes are capable of
PhSer cons cons Phosph hyp hyp
t-RNAArg 07
08 09
Glycos Asp Transf Synthet
153
10
11
FixA FixB FixCX 12 13
14
15 HisKinase
Figure 4.19 Schematic representation of a 34 kbp archaeal fosmid clone recovered from a calcareous grassland near Darmstadt, Germany. Different shadings indicate the most significant phylogenetic affinity of putative protein-coding genes to the Archaea (diagonal stripes), Bacteria (dots), Archaea and Bacteria (vertical stripes), or Archaea, Bacteria, and Eucarya (light grey). Genes without homology assignment are white. 01, Family B DNA polymerase; 02, a/b hydrolase; 04, polyhydroxyalkanoate synthase; 07, glycosyl transferase group 1; 08, asparagine synthetase; 9, phosphoserine phosphatase; 10, conserved hypothetical protein; 11, transmembrane protein; 12–14, fixABCX; 15, sensory transduction histidine kinase. From Quaiser et al. (2002), by permission of Blackwell Science.
154
INTRODUCTION TO ECOLOGICAL GENOMICS
nitrogen fixation; nitrogen fixation in Archaea is limited to strictly anaerobic euryarchaeotes such as Methanosarcina and Methanococcus. The intriguing presence of the fix gene cluster in Crenarchaeota cannot yet be evaluated from a functional point of view. Several other genes have been recovered from the same metagenomic libraries, some of which are unique to mesophilic Crenarchaeota; however, specific physiological traits have not yet been identified (Treusch et al. 2004). Another group of microorganisms that has enjoyed interest from soil metagenomics research are the Acidobacteria, a relatively unknown phylum of the bacterial kingdom. Molecular ecological investigations had frequently detected 16 S rRNA
75 96
97 100
93 100 73 84 90 57 100 100
67 87
75 95 73 90
96 100
98 95
99 100
sequences from Acidobacteria in soil; sometimes more than 30% of the sequences in a clone library belong to this group. Until recently only three species of Acidobacteria were known, but the work of Quaiser et al. (2003) has shown that 15 clones in a soil metagenomic library contained sequences from this group. Six of these clones were sequenced and several genes were identified. Phylogenies on the basis of a phylogenetic marker for Archaea, the purine-biosynthesis gene purF, were consistent with 16 S rRNA-based phylogenies and showed that the Acidobacteria should be considered a separate phylum of the Bacteria, sharing a common ancestor with the Proteobacteria (Fig. 4.20). The analysis of the metagenomic clones
Synechocystis sp. Synechococcus sp. Nostoc sp. Trichodesmium erythraeum Thermosynechococcus elongatus Streptomyces coelicolor 100 Thermobifida fusca 100 Clostridium acetobutylicum Clostridium perfringens Thermoanaerobacter tengcongensis Desulfitobacterium hafniense Archaeoglobus fulgidus Methanococcus jannaschii Oceanobacillus iheyensis Bifidobacterium longum Streptococcus pyogenes Listeria monocytogenes Bacillus subtilis Bacillus anthracis Bacillus halodurans Geobacter metallireducens Magnetococcus sp. Mesorhizobium loti Rhodospirillum rubrum Magnetospirillum magnetotacticum Zymomonas mobilis Novosphingobium aromaticivorans Rhodobacter sphaeroides Caulobacter crescentus Rhodopseudomonas palustris Sinorhizobium meliloti PurF 23k22 PurF41b15
Cyanobacteria
Actinobacteria Clostridia Archaea
Bacilli
Proteobacteria
Acidobacteria
0.1 Figure 4.20 Phylogenetic analysis using the neighbour-joining algorithm of purF (amidophosphoribosyl transferase, a gene in the purine biosynthesis) sequences of several prokaryotes. Numbers on the nodes are bootstrap values. The position of two sequences from Acidobacteria, found in a metagenomics library of grassland soil DNA, demonstrates that this group should be considered a separate lineage within the bacterial kingdom. The scale bar indicates the proportion of amino acid difference. From Quaiser et al. (2003), by permission of Blackwell Science.
STRUCTURE AND FUNCTION IN COMMUNITIES
also revealed many deduced protein sequences, but only few gave hints of specific metabolic traits in Acidobacteria. A similar high abundance of Acidobacteria was found in a census of rRNA genes in another soil metagenomic library by Liles et al. (2003). As in the case of the Crenarchaeota, the ecological status of this abundant but uncultured group of soil bacteria remains largely unknown.
4.4.3
Genomes in extreme environments
Extreme environments usually harbour only a few species that have developed special characteristics to survive conditions that are lethal to most other organisms. The small and specialized communities found in extreme environments are interesting objects for ecological research. Since such communities involve only a few species, interactions between them and with the environment remain tractable, and each species fills a complete niche. Some extreme environments are considered models for extraterrestrial conditions and the study of such environments is motivated by the fact that microorganisms may leave biosignatures in rocks when they become fossilized (Walker et al. 2005). Extreme environments are also a rewarding object of study in genomics. Among the habitats investigated by ecological genomicists are polar deserts, deep-sea hydrothermal vents, and acid-mine drainage. One of the most exciting studies in community genomics is due to Tyson et al. (2004), who investigated the metabolism of a small community of prokaryotes in an acid-mine drainage biofilm by means of the near-complete reconstruction of their genomes. Acid-mine drainage is a common environmental problem occurring in many coal and iron mines when pyrite (FeS2) comes into contact with the air. This initially leads to the slow chemical oxidation of sulphide to sulphate and lowering of the pH. As we have seen above (Section 4.3) under low pH conditions it becomes profitable for ironoxidizing microorganisms such as Ac. ferrooxidans to gain energy from the oxidation of Fe2 þ to Fe3 þ . Since this reaction allows only little energy gain large amounts of Fe2 þ have to be oxidized. The resulting Fe3 þ ions may react back with pyrite
155
to oxidize the metal sulphide bond, leading to more sulphate and a further lowering of the pH. Once the cycle of pyrite oxidation has started and acidophilic microorganisms have established themselves, the reaction tends to propagate: Fe3 þ is regenerated and large quantities of acid are produced. The overall reaction is: þ FeS2 þ 14Fe3þ þ 8H2 O ! 15Fe2þ þ 2SO2 4 þ 16H
Acid water and reduced iron will leach from the system and when this comes into contact with neutral surface water Fe2 þ oxidizes spontaneously to Fe3 þ and a precipitate of Fe(OH)3 is formed. Microorganisms play a central role in the generation of acid-mine drainage and they may develop a pink biofim growing under very acid conditions (down to pH 0.5). Tyson et al. (2004) developed a small-insert plasmid library from an acid-mine drainage biofilm in the Richmond Mine, California, USA, for WGS sequencing. With a sequence coverage of up to 10 times, the shotgun data-set could be assembled into near-complete genomes of two major members of the community, a bacterium from the Leptospirillum group II, related to L. ferrooxidans (Nitrospirae), and a previously unknown, uncultured archaeon designated Ferroplasma type II (Euryarchaeota, Thermoplasmatales). Partial genome sequences were obtained for another Leptospirillum species (Leptospirillum group III), a species of Sulfobacillus, and a Ferroplasma type I. The sequences of Leptospirillum type II, although arguably from different species, were nearly all the same; the average rate of nucleotide polymorphism was no greater than 0.08%. In the Ferroplasma type II genome, there was however a fair degree of polymorphism (2.2%), and these polymorphisms had a peculiar distribution in which ‘hot spots’ were interspersed with longer homogeneous regions, suggesting that the Ferroplasma type II genome should be considered a mosaic of at least three different strains, combined with each other through recombination. Although this detailed reconstruction of population-genetic structure from an environmental genome was already unique, Tyson et al. (2004) were also able to identify a significant number of functional genes
156
INTRODUCTION TO ECOLOGICAL GENOMICS
in the two dominant species and link these to the geochemical processes in the biofilm (Fig. 4.21). In the genome of Leptospirillum group II 63% of the ORFs could be assigned a function, while in Ferroplasma type II the corresponding figure was 58%. Both species are iron oxidizers but seem to use different systems to gain energy from this reaction. Leptospirillum has a system comparable to the one discussed in Section 4.3 for Ac. ferrooxidans, in which a periplasmic cytochrome oxidizes Fe2 þ and transfers the electron to a membrane-bound electron-transport chain (Fig. 4.11). However, the genome of Leptospirillum does not encode rusticyanin, but rather a ‘red cytochrome’ with the same function. In Ferroplasma (which lacks a cell wall), a putative membrane-bound ‘blue copper protein’ conducts the initial oxidation of Fe2 þ . This copper-containing protein shared sequence characteristics with both rusticyanin of Ac. ferrooxidans and sulphocyanin of the sulphuroxidizing archaeon Su. solfataricus (see Fig. 4.10). The precise relationships between these electrontransport proteins remain to be elucidated, but from the data at hand it can already be concluded that different species may use different proteins for similar functions, and that there are homologies between the proteins used for iron and sulphur oxidation. The situation seems to be comparable to the electron-shuttling proteins used in iron reduction discussed above: a comparison between Geobacter, Shewanella, and Desulfovibrio showed that an evolutionarily diverse set of proteins may be used for similar functions in different species (see Section 4.3). The genome of Leptospirillum encoded all the genes of the Calvin cycle and so Leptospirillum is probably a chemoautotroph. The lack of genes from the Calvin cycle in Ferroplasma and the presence of a large number of ATP-binding cassette (ABC)-type sugar transporters suggests that this species is heterotrophic. Interestingly, neither of the two species had genes for nitrogen fixation, but these were found in a third, incompletely reconstructed species, Leptospirillum group III. It is remarkable that the latter species, which has a much lower abundance than Leptospirillum group II, plays such a key role in the community.
Eukaryotic heterotrophs have also been identified in the acid-mine drainage communities, including two distinct groups of ascomycete fungi (Baker et al. 2004). Thus the community as a whole is a self-sustaining unit, independent of organic input from the surface; it can fix nitrogen and carbon from the air and uses iron oxidation as a prime mechanism for energy generation. The composition of the community with a few dominant genome types is consistent with the extreme character of the environment, providing only a few niches. Obviously, microorganisms living in the extremely acid conditions of acid-mine drainage must be very tolerant to low pH. One aspect of tolerance is a high expression of proteins involved in combating oxidative stress and protein denaturation. We will see in Chapter 6 how such defence mechanisms provide protection against cellular stress. A proteomics study of the Richmond Mine acid-mine drainage biofilm confirmed that stressdefence proteins were a very dominant feature of the community proteome (Ram et al. 2005). Another key feature of acid tolerance is the nature of the cell membrane. A cell membrane with very low proton permeability is found in the acidothermophilic archaeon Picrophilus torridus, which has been sequenced recently (Fu¨tterer et al. 2004). The genome of P. torridus encodes an extraordinary large number of secondary transport systems and this suggests that the steep proton gradient across the cell membrane is used extensively for transport of metabolites. Acidophilic microorganisms must also be tolerant to extremely high levels of dissolved metal and metalloid ions, which reach concentrations in the upper millimolar range. Dopson et al. (2003) reviewed the various mechanisms by which microorganisms can achieve tolerance to As, Cu, Zn, Cd, Ni, Hg, and other metals. Most of the tolerance mechanisms in acidophilic microorganisms involve P-type ATPase efflux pumps, sometimes combined with reductases (in the case of Hg and As). The locus conferring As resistance has been particularly well studied. The ars operon encodes a reductase, an efflux pump, and a regulatory protein. A genomewide inventory of heavy metal-tolerance genes
STRUCTURE AND FUNCTION IN COMMUNITIES
No light
Atmosphere
N2
O2
Amino Nickel Phosphate acids Dipeptide Nitrate
Leptospirillum group II
SO42–H+
CO2
Na+
ArsB CI–
157
K+
H+
K+
Sec-dependent protein translocation
Sec-independent H+ H+ ABC-type transport Metals Toxics protein translocation Efflux Cd2+ systems As3+ Multidrug efflux 2+ permeases Cu permeases + K Zn2+ Pentose Cofactor biosynthesis CI– CO2 G-3-P Embden-Meyerhoff phosphate Voltage-gated Cobalamin pathway pathway Rubisco Protein Haem channels Capsular translocation Pantothenate Carbon polysaccharide Catabolic functions Glu Riboflavin co fixation β-Lactamase export ne Thiamine og Protease NADH en Flagellum Chemotaxis + P-type ATPases Exopolyphosphatase es Citric acid NAD is Lipases/esterase ADP+P H2O cycle ADP+P ATP ATP ATP ADP+P O2 α-Amylase H2O Formate CO2+H2 O2 F0F1-ATPase NH3 Fe3+ NH4+ Formate hydrogenlyase 2H+ Fe2– K+ K+ complex Fe2+ Fe2– Fe2+ Co2+
NO3
PO42–/SO42–
cyt cbb3 oxidase C553 cyt b/FeS Ubiquinone
Multidrug efflux permeases
bd-type oxidase
NH4
K+ ADP+P
P-type ATPases K+ H+ Zn2+ Cd2+ Cu2+
ATP ADP+P ATP ADP+P ATP ADP+P
Catabolic functions β Lactamase Protease Lipases/esterase α Amylase β Galactosidase Fatty acid oxidation Xenobiotics
Cofactor biosynthesis Cobalamin Riboflavin Ubiquinone Haem Pantothenate THF Pyridoxine Coenzyme PQO
ATP
Succinate dehydrogenase
ArsB
NADH; Ubiquinone dehydrogenase
Metals Toxics Defence mechanisms
As3+ DNA-modification system Superoxide dismutase Hydrogen peroxide reductase Cytochrome P450 Mercuric reductase Embden–Meyerhoff pathway
Na+ H+ Mn2+ H+ Na+ Solute Protein translocation Sec-dependent
Gluconeogenesis
Pyrite sediment
Ferroplasma type II
Red cytochrome
ABC-type transport systems Sugars Peptides Multidrug efflux
Formate Pentose phosphate Sec-independent dehydrogenase pathway (partial) Formate ADP + P Reductive acetyl-CoA pathway H+ - transporting (+ THF) ATP synthase (+CoA) ATP Formate CO2 Formate Acetyl-CoA CO H+H+ Pyruvate Carbon monoxide Acetyl-CoA hydrogenlyase H2O H+ H+ dehydrogenase synthase complex Acetyl-CoA Macromolecular O2 CO2+H2 Haeme-copper terminal oxidase biosynthesis H2O Osmolyte SO 2– 3 Fe3+ Sulphocyanin-mediated O2 ADP + P NADPH Citric acid ferrous iron oxidation? Voltage-gated Fe2+ Sulphite oxidase? cycle 2+ channel Fe ATP Fe2+ Fe2+ osmolyte SO42– NADH NAD+ Fe3+
Biofilm Fe2+ FeS2 + 14Fe3+ + 8H2O
15Fe2+ + 2 SO42– + 16H+
AMD solution 42 °C / pΗ 0.83
Figure 4.21 Cell metabolism of the genomes of Leptospirillum group II and Ferroplasma type II in an acid-mine drainage (AMD) biofilm with pyrite sediment and an acid-mine drainage solution of pH 0.83. Note the inner and outer membrane of the Gram-negative bacterium Leptospirillum and the presence of iron-oxidizing red cytochrome in the periplasm, coupled to a short electron-transport chain donating electrons to O2. In the archaeon Ferroplasma type II, which lacks a cell wall, a membrane-bound sulphocyanin-mediated iron-oxidation system is assumed to be present. Both species have a complete citric acid cycle and several catabolic functions. Leptospirillum also has a complete Calvin cycle for CO2 fixation, while Ferroplasma has plenty ABC-type transporters for sugar uptake. The overall reaction combining microbial Fe2 þ oxidation with reduction of Fe3 þ by reaction with pyrite leading to acid generation is shown below. THF, tetrahydrofolate. After Tyson et al. (2004) by permission of Nature Publishing Group.
158
INTRODUCTION TO ECOLOGICAL GENOMICS
was recently made for the non-acidophilic species Pseudomonas putida, the genome of which was sequenced in 2002 (Ca´novas et al. 2003). No fewer than 61 ORFs were found that were likely to be involved in metal(loid) tolerance or homeostasis and some systems appeared to be duplicated. Loci were found for metal-specific uptake pumps, metal-reduction enzymes, chelating proteins, and metal-efflux pumps as well as several transcriptional regulators. Extrapolation of this machinery to acidophilic species may not be warranted, however, because the extreme acid environment poses additional requirements beyond ‘normal’ metal tolerance. Another extreme habitat investigated by genome researchers are hydrothermal vent systems on the ocean floors. The sequencing of the first archaeon in 1996, Me. jannaschii, has illustrated the interest in this environment. The interest is especially strong because of the antiquity and evolutionary significance of these systems, allowing inferences about the very first microbial pathways. Hydrothermal vents on the ocean floor are places where the Earth’s crust drifts apart, allowing seawater to mix with hot minerals, leading to a spurts of fluid at rates of 1–2 m/s with temperatures of 270–380 C. A range of specialized, thermophilic, Archaea and Bacteria have adapted to the high temperatures in these systems with growth optima between of 60 (thermophiles) and 105 C (hyperthermophiles). The energy generated by these microbial communities is derived from inorganic and geothermal sources (sulphide, H2, reduced metals, CO2, CH4; Reysenbach and Shock 2002). The main metabolic strategies are methanogenesis, sulphur reduction (see Section 4.3), and the so-called knallgas reaction (O2 þ 2H2 ! 2H2O). Culture-independent screening using 16 S rRNA probes has shown the presence of several Archaea, including a new phylum, the Korarchaeota, only discovered in 1999 in a hot spring at Yellowstone National Park, USA, the Obsidian Pool. Another new archeal phylum, the Nanoarchaeota, was reported in 2002 (Huber et al. 2002). This phylum is represented by tiny cells that live attached to a sulphur-reducing archaeon of the genus Ignicoccus. They appeared to possess a 16 S rRNA gene that
has many base pair substitutions in regions of the gene considered to be universal; for this reason the group was not found previously when using regular 16 S PCR primers or fluorescent probes. Surprisingly, thermal-vent ecosystems are also colonized by animals. A peculiar example is the polychaete worm, Alvinella pompejana (Pompeii worm), that is extremely tolerant to high temperature (Fig. 4.22). With a body temperature that can reach 80 C, this species is the most thermotolerant animal known. Population-genetic studies have shown that despite the island-like structure of their habitat, hydrothermal polychaete worms are able to disperse via larval stages, and genetic differentiation is determined by hydrography and topography of the ocean (Hurtado et al. 2004). The dorsal surface of Al. pompejana is covered with bacteria of the group Epsilonproteobacteria, which are considered symbionts, providing the worm with organic material. Campbell et al. (2003) developed a fosmid library of the symbiontic bacteria and showed that it contained two
Figure 4.22 Picture of Alvinella pompejana, a polychaete worm occurring near hydrothermal vent ecosystems on the ocean floor, carrying a dense layer of symbiontic bacteria on its dorsal surface. The Pompeii worm is the most thermotolerant animal known. Courtesy of the University of Delaware.
STRUCTURE AND FUNCTION IN COMMUNITIES
enzymes from the reversed citric acid cycle, a system used for CO2 fixation in green sulphur bacteria in lieu of the Calvin cycle (see Table 4.6). Therefore it is likely that these symbionts are chemoautotrophs, fixing CO2 in the same way as green sulphur bacteria. Similar symbiotic relationships occur in the Vestimentifera, a peculiar group of tube-living marine animals, formerly classified as a separate animal phylum (Pogonophora), but now considered an order of the Annelida on the basis of molecular data. Vestimentiferans lack a normal intestinal tract but have developed a specialized tissue, the trophosome, in which symbiontic chemolithotroph (sulphur-oxidizing) bacteria live, nourishing the animal. Molecular investigations of these symbionts living in different hosts and different geographical sites have shown that the transmission from one generation to another is mainly horizontal; that is, the larvae acquire the symbionts from their environment, prior to attachment (Di Meo et al. 2000). Community genomic studies in extreme environments are likely to deliver more surprises, when complete metagenomic libraries have been sequenced. Several of such projects are underway. Hydrothermal vent systems are more complicated than other extreme environments (deserts, acidmine drainage) because of their relatively rich biodiversity; however, at the same time they offer exciting opportunities for investigating community syntrophy and peculiar symbiotic relationships.
4.5 Genomic approaches to biodiversity and ecosystem function: an appraisal Microbial ecology has developed a wide variety of methods that can be used to study functions in ecosystems and it can rely on a rich background of biochemistry and genetics of the organisms involved. Genes associated with crucial links in all major biogeochemical cycles have been identified. The presence and diversity of these genes can be studied without consideration of the species in which they are present, as indicators of an ecosystem’s capacity to perform specific functions. Most of these genes are known from microbial
159
biochemistry and microbial genetics but the possibilities offered by this strong background have not yet been exploited fully in an ecological context. Ecological studies have focused on genes from the nitrogen cycle, in particular denitrification genes. The few genomics studies that have been conducted with the aim of answering questions about biodiversity and ecological function seem to indicate a positive correlation between overall function and species biodiversity, supporting the rivet hypothesis (see Section 4.1). Community genomics studies also confirm that species carrying out indispensable key functions are not always among the dominant members of the community. Ideally, assessment of functions in the environment would use transcription profiling, starting with extraction of functional mRNAs, as is done in model eukaryotes. This is more difficult in prokaryotes, however, and in microbial studies it is mostly limited to profiling pure cultures, rather than communities in the field. Instead, the potential for microbial functions is assessed from the presence, not the expression, of functional genes. With this limitation, the various microarray approaches hold good promise for large-scale profiling and monitoring. Attention needs to be paid to improving sensitivity and specificity before microarrays can be routinely applied for detecting functional genes. Oligonucleotide microarrays with 16 S rRNA probes seem to be best for taxonomic surveys, especially since a large database on aligned 16 S sequences is now available. However, technological improvement is also necessary in this area, to allow these phylochips to be used without prior PCR amplification of environmental DNA. Microbial ecology faces a tough problem, in that many organisms in the environment cannot be cultured in the laboratory and so remain undescribed as proper species. With every survey of environmental samples, new sequences are detected and a levelling-off of the collector’s curve is not yet in sight, not even for common habitats such as lake sediments and forest soils. The most common system to classify microorganisms is the SSU rRNA gene, although some groups remain unnoticed in this way, as demonstrated by the recent
160
INTRODUCTION TO ECOLOGICAL GENOMICS
discovery of a completely new archaeal phylum, the Nanoarchaeota. Theoretical arguments, based on lognormal distributions of species over abundance classes, predict that prokaryote biodiversity may be an order of magnitude greater than even the maximum indicated by current genomics surveys. Recent studies have also shown that spatial aspects and geographic barriers are more important in microbial community composition than thought before (Whitaker et al. 2003). We have seen evidence for this in the aeroplankton surveys discussed in Section 4.2, where two different sampling locations revealed differing community compositions, suggesting that there are local sources of airborne microbes. Studies of the relationship between structure and function in microbial communities should include an assessment of the sources of biodiversity, as in community studies of island biogeography (Curtis and Sloan 2004). Community genomics is a recent field where exciting new discoveries may be expected. It has been made possible by new techniques of library construction and massive sequencing capacity. The two studies published in 2004 on Sargasso Sea microplankton and on acid-mine drainage biofilms are particularly impressive and seem to indicate the dawn of a major new direction of research. The
question can be asked, are there limits to what brute-force sequencing of the environment may reveal? For the moment a focus on simple communities in extreme environments seems to be most profitable in the light of ecological theory. Given the relatively small number of species in such systems, a full reconstruction of their genomes is now within reach. It is also interesting to investigate the genomic background of the mutual interdependencies of species in such communities, varying from syntrophy to symbiosis. The community genomics or metagenomics approach has also brought renewed interest in bioprospecting; that is, exploring novel functions by screening metagenomic libraries in which unknown genes from the environment are expressed in a heterologous host. This strategy has until now mostly been focused on functions of biotechnological relevance (new enzymes, antibiotics pathways); however, we see no reason why the same approach could not be applied to solving ecological questions. Has ecological genomics solved the basic ecological question about biodiversity and ecological functions? Not yet. Only preliminary answers can be given at the moment, but all indicators suggest a major breakthrough soon.
CHAPTER 5
Life-history patterns
The great diversity of life cycles in nature, from short-lived annual plants to long-lived trees, from prolific reproducers such as oysters to economical types such as the albatros, has fascinated many biologists. An important scientific question has arisen from this fascination: can the life cycle of a species be understood in the context of the environment in which it lives? Attempts to answer this question have given rise to a large body of ecological literature, including observational data (population census, age distributions), experimental data (life-history manipulation by food or temperature), genetic data (heritable variation in life-history traits), and theoretical models (demography and quantitative genetics). Life histories of model organisms have also been analysed using molecular and genomic approaches. In this chapter we will visit this exciting blend of life-history ecology and genomics.
5.1
The core of life-history theory
When Charles Darwin travelled with the H.M.S. Beagle to Tierra del Fuego and the Falkland Islands in 1834, he was surprised to find, on counting the eggs of a large white Doris (a sea slug), how extraordinarily numerous they were. The slugs produce their eggs as a long ribbon, rolled up in a cone, and adhered to the rock. The inquisitive naturalist, extrapolating from a part of the structure, estimated the total number of eggs in one spire to be at least 600 000. Yet the animal itself was certainly not very common. Although he often searched under the stones, he could find only seven individuals. He then added in a
footnote (Darwin 1845): No fallacy is more common with naturalists than that the numbers of an individual species depend on its powers of propagation.
If the abundance of a species does not depend on the number of offspring, why are there such large differences between species in reproductive styles? That such differences exist is obvious. The mathematical biologist A.J. Lotka distinguished between the ‘lavish type’ and the ‘economical type’ (Lotka 1924). Many marine animals, including Darwin’s slug, obviously belong to the first type, whereas humans, with their low birth rate and long lifespan, are an example of the second type. Also within relatively homogeneous groups of organisms large differences between species may exist. For example, in birds clutch size varies from one egg in petrels and condors up to 20 eggs in pheasants and partridges. Likewise, among lizards the number of eggs laid in a season varies per species from 2 to 20. An even more extreme variation may be observed among plant species. This diversity in reproductive output across species is usually positively correlated with juvenile mortality rate and negatively with longevity, so each species with stationary population size strikes a balance between mortality and natality; however, the weights on each side of the balance vary enormously between species. An answer to the question of why the power of propagation differs so much between species comes from life-history theory. Characteristic for this area of population ecology is the recognition that the various life-history traits, also called vital rates, such as juvenile mortality, age at maturity, 161
162
INTRODUCTION TO ECOLOGICAL GENOMICS
adult body size, clutch size, and longevity, cannot be isolated from each other. The theory considers all these traits jointly, including the interrelationships among them. An important concept is the presence of trade-offs. A trade-off is a negative correlation between two life-history traits in such a way that an increase of one trait (e.g. clutch size) imposes a cost to another (e.g. chick mortality). However, the term trade-off is also used in a broader sense to indicate any negative correlation between two traits, whether they are causally related or not. Given the trade-off structure among life-history traits, the theory attempts to explain patterns across species by assuming that the life history as a whole is subjected to natural selection and is optimized with respect to the environmental conditions to which the organism is exposed, subject to lineage-specific constraints. Life-history theory has developed into a major field of population ecology and the subject is summarized in several textbooks, such as those by Stearns (1992) and Roff (2002). Life histories can be described using the formalism of demography, the science of age-structured populations and their dynamics. The aim of demographic analysis is to develop models in which life-history traits, such as mortality and fertility, are linked to population size and age structure. In human demography such models are used to forecast future population growth and composition, given fertility and mortality schedules. In ecology, the same models are used to estimate the optimal life history, given a trade-off structure among the vital rates and a criterion for optimality, which is usually taken as the population growth rate. In other words, it is assumed that survival and fertility of a species are optimized in such a way that, accounting for constraints from trade-offs, population growth rate is at a maximum. In addition to trade-offs, vital rates are also constrained by lineage-specific effects, which arise from the body plan and the physiological limits posed by the phylogenetic history of the group to which the species belongs, which, for example, prevents a bird from producing as many eggs as a mussel. As an example of how arguments are developed in life-history theory, we consider a relatively
simple model outlined by Roff (2002), who considers a hypothetical animal in a constant environment with a simplified life history about which the following two assumptions are made. First, mortality rate, indicated by y, is constant. This implies that throughout life a constant fraction of a birth cohort is removed and the survival of the cohort is described by a negative exponential. Such a survival curve is often seen in species for which mortality mainly comes from external sources, such as from predators. Second, fertility is constant within one life cycle, but there are different options, depending on the age at which reproduction starts. If reproduction starts later, fertility is higher; a linear relationship is assumed between fertility and the age at maturity. Such a relationship is often seen in organisms in which reproductive capacity increases with body size. By postponing reproduction, the animal can reach a larger body size and consequently acheive greater fertility. These assumptions are displayed graphically in Fig. 5.1. Three possible fertility scenarios are plotted: one that starts at age 5 and maintains a reproductive output of 15 per time unit (the total number of eggs laid by a female surviving to age 20 would be 225), one that starts at age 10 and produces 40 eggs per time unit (total number of eggs produced from age 10 to 20 would be 400), and one that starts at age 15 and produces 65 eggs per time unit (total output 325 eggs). If all animals survive to age 20, the best of these three scenarios would be the second; however, a still-better scenario is to start at age 11, since this would provide a total reproductive output of 405 eggs ( ¼ (20 11) 45). However, reproductive output must be corrected for the fewer and fewer animals remaining to produce eggs and so the actual optimum will be lower than 11. How much? A quantitative valuation can be given by considering a common criterion for optimality, net reproductive rate, R0, which is given by Z 1 lðxÞmðxÞdx R0 ¼ a
where m(x) is fertility (number of offspring produced per time unit by individuals aged x), l(x) is survival from birth to age x (as a fraction),
100
1.0
80
0.8
Fecundity, m(x)
l(x)
m(x) for α=15
60
40
m(x) for α=10
0.6
0.4
163
Survival, l(x)
LIFE-HISTORY PATTERNS
0.2
20 m(x) for α=5 0
0
5
10 Age, x
15
0.0 20
Figure 5.1 A hypothetical life history in which survival is a single exponential given by l(x) ¼ eyx, where y is the rate of mortality, and fertility, m(x), is constant with age, but dependent on age at maturity, a, as m ¼ a þ ba. Parameters are chosen arbitrarily as follows: y ¼ 0.4, a ¼ 10, and b ¼ 5. Three different fertility scenarios are shown, for a ¼ 5, 10, and 15. Using the net reproductive rate R0 as a criterion (see text) it can be shown that the optimal value for a is 7. After Roff (2002), reproduced with permission from Sinauer Associates.
and a is the age at maturity (i.e. first reproduction). Net reproductive rate is the average number of individuals in the next generation by which an individual of the present generation is replaced. Although Roff (2002) uses R0 as a criterion for optimality, most authors prefer a parameter called intrinsic population growth rate, which can be calculated from l(x) and m(x) in a similar but more complicated way. R0 ignores variation in generation time but is preferred in field studies with more or less stationary populations (Kozlowski 1993). The use of both net reproductive rate and intrinsic growth rate is supported by the central theorem of demography, which states that any population with time-invariant fertility and mortality schedules will, after some generations, attain a stable age distribution and then grow exponentially. A strong implication of the central theorem is that the growth factor per generation, R0, can be estimated beforehand, directly from the life history; we need not wait until exponential growth is actually realized. In this way, R0 can be
considered an indicator measuring the fitness of a life history. The equation above shows that to estimate R0 one needs information about fertility and mortality rates for each age class; in the case considered by Roff (2002), l(x) ¼ eyx and m(a) ¼ a þ ba, where y is the rate of mortality (set at 0.2 in the example), and a and b are constants (set at 10 and 5, respectively). This parameterization leads to 1 R0 ðaÞ ¼ ða þ baÞeya y The optimal age at maturity, ^ a, is that which maximizes R0, and is found by evaluating qRo b a ab eya ¼ 0 ¼ y qa which produces ^ a¼
1 a y b
So conditions promoting postponement of reproduction (large ^ a) include a low rate of mortality
164
INTRODUCTION TO ECOLOGICAL GENOMICS
(small y) and a slow increase of fertility with age (small b). If two related species live under conditions of unequal mortality, everything else being equal, the one living under the highest mortality regime should have the shortest juvenile period. In the numerical example of Fig. 5.1, ^a ¼ 7 and the net reproductive rate of the optimal life history is 30.8. This simple example shows how mathematical models can help to draw inferences on the optimality of life-history traits if some basic attributes of the species and its environment are given. Whereas age at maturity, body size, and clutch size are important traits for animals, for plants traits such as germination fraction, shoot–root allocation, flowering time, and number of seeds are considered. Much more complicated elaborations of the basic demographic principles are discussed in Roff (2002), including fluctuating and predictably changing environments. A crucial role in many models is played by trade-offs; in the present case it was assumed that the organism could increase its fertility by postponing maturity and growing larger first, and that there was a linear relationship between the two. Such a mechanism is often considered a consequence of energy allocation: what is spent on one side cannot be spent on the other side. The idea of trade-offs due to energy allocation is very old and can be traced back to the ‘loi de balancement’ proposed by Geoffroy Saint Hilaire in 1818 (Leroi 2001). Darwin (1859) noted that artificial selection of domestic animals and plants showed many examples of correlated reponses or ‘compensation of growth’. He referred to both Geoffroy and Goethe in stating ‘if nourishment flows to one part or organ in excess, it rarely flows, at least in excess, to another part; thus it is difficult to get a cow to give much milk and to fatten readily’. The principle of energy acquisition and allocation was developed by Kooijman (2000) into a systematic physiology-based framework of growth, reproduction, and aging, the dynamic energy budget model (DEB model). In this model, food uptake is assumed to be proportional to body surface and assimilated energy is converted into reserves. The reserve pool is in dynamic equilibrium with a mobile pool available to all organs of
the body. A fixed proportion (k) of the circulating pool is spent on growth plus maintenance, and the remaining portion, 1–k on development plus reproduction. This aspect of the model is designated as the k rule for allocation. Energy taken up by somatic tissues is first used for maintenance, and the remainder is used for growth. In this way growth competes directly with maintenance, but reproduction competes with growth only through the k rule. This model can explain why many animals continue to grow after the onset of reproduction. Their growth slows down due to the increasing maintenance costs of a larger body, not directly through competition with reproduction. In the model, the onset of reproduction, which is due to the 1–k flux being redirected from development to reproduction, does not create the discontinuities and inconsistencies that are present in other allocation models. The great variety of examples discussed in Kooijman’s (2000) book illustrates that the DEB model is a powerful instrument for analysing energetic relationships since it argues from first principles rooted in thermodynamics and emphasizes the similarities across organisms as different as yeast, waterfleas, parasites, fish, and birds. Despite the importance of allocations and trade-offs in life-history theory, reliable empirical measurements are difficult. This is especially annoying because often the outcome of an optimization procedure depends critically on the shape of a trade-off function, for example a convex relationship between reproduction and survival predicts iteroparity (repeated ongoing reproduction), whereas a concave relationship predicts semelparity (a single, large reproductive output followed by death). Empirical studies are hardly able to distinguish between these two forms of trade-off. In addition, trade-offs may be masked by fluctuation in the resource that is the subject of allocation. For example, if the total energy available for growth and reproduction increases due to increasing food intake, the allocation between them becomes invisible, and the correlation between growth and reproduction at the phenotypic level may turn from negative to positive (Van Noordwijk and De Jong 1986). There has been a tendency to
LIFE-HISTORY PATTERNS
measure trade-offs in terms of negative genetic correlations between life-history traits, either by pedigree analysis or by selection, using the formalism of quantitative genetics; however, such estimates have not produced satisfactory results because very large sample sizes are needed to resolve the presence of genetic correlations (Roff 2002). In addition to energy allocation, two other classes of mechanism can cause negative associations between life-history traits: negative (antagonistic) pleiotropy and hormonal signals (Zera and Harshman 2001; Leroi et al. 2005). Geneticists define pleiotropy as the phenomenon that one gene affects two or more phenotypic traits. Negative pleiotropy arises when expression of a single gene affects one trait in a positive way and another trait in a negative way. This can also be true for hormonal control: the same hormone may affect one process in a positive direction, and another in a negative direction. Negative pleiotropy may be a more common mechanism for negative association between life-history traits than energy allocation. Leroi et al. (2005) examined several classes of genes involved with the regulation of longevity and concluded that many of them have antagonistic effects on life-history traits. Additional evidence for the importance of negative pleiotropy comes from the literature on tolerance to pesticides (Van Straalen and Hoffmann 2000). Many pesticide tolerances are associated with apparent ‘costs’ to vitality or reproductive capacity, but these costs are more often due to metabolic side effects of a gene mutation that confers tolerance, than to an energy drain towards detoxification of the pesticide. A new framework for addressing questions about life-history patterns may come from genome-wide gene-expression studies. Stearns and Magwene (2003) suggested that trade-offs can be seen as conflicts over gene expression. This argument is illustrated in Fig. 5.2. If two functions in an organism—for example, reproduction and longevity—are regulated by two sets of genes, a trade-off between the functions may arise if the two sets overlap and if, for example, one function calls for upregulation and the other for downregulation. Such a trade-off can also arise from
(a)
165
G
F1
F2
(b)
G
F1
F2
Figure 5.2 Theoretical illustration of how trade-offs between life-history traits might be explained by conflicts over gene expression. G is the set of all expressed genes in an organism, F1 is the set whose expression changes in response to function 1, and F2 to function 2. If there is overlap between F1 and F2, as in (b), a trade-off will arise if genes need to be upregulated in response to 1 and downregulated in response to 2. After Stearns and Magwene (2003) by permission of the University of Chicago Press.
conflicting signals downstream of gene expression, as we will see below. Finally, we want to point out that life-history traits always result from interaction between genotypic determinants and the environment. Even those traits that are under strong genetic control, for example clutch size in birds, may vary depending on environmental conditions. The way in which a life-history trait is shaped by an environmental factor can itself be considered an aspect of the life-history pattern. For example, some birds will tune their clutch size to environmental food supply, taking advantage of years with abundant food availability and minimizing reproduction in bad years; other birds just lay the same number of eggs irrespective of the environment. This aspect of a life history is denoted as
INTRODUCTION TO ECOLOGICAL GENOMICS
phenotypic plasticity, and the function describing a life-history trait as a function of an environmental factor is called a norm of reaction. A reaction norm is a property of a genotype; different genotypes may have different slopes of the reaction norm, allowing natural selection to act on plasticity. Until now plasticity as an adaptive trait has been analysed mainly by statistical methods (multivariate quantitative genetics), but genomic technology is opening up new perspectives for providing a genetic basis to phenotypic plasticity (Pigliucci 1996). In this chapter we will explore the genomic basis of life-history patterns, emphasizing proximate causation in the life history. There is a lot of literature on the evolution of longevity and aging that is left undiscussed here; the reader is referred to Kirkwood and Austad (2000) and Partridge (2001) for reviews of theories and experimental data. The molecular work on aging, which is mainly on C. elegans, Drosophila, and mouse, is often inspired by its possible extrapolation to human gerontology and is not very well integrated in ecological studies. We nevertheless believe that a molecular connection can provide a mechanistic basis for life-history theory and so increase its power to explain the variety of life-history patterns in nature.
5.2
food shortage or crowding (see Section 3.3). Here we will consider the signalling pathways associated with dauer formation as well as extended longevity.
5.2.1
The insulin signalling pathway
The first report of single-gene mutations that affected lifespan and reproduction in C. elegans dates back to 1988. The gene involved was called age-1, and mutations in this locus increased longevity and decreased hermaphrodite fertility (Friedman and Johnson 1988). Later, Kenyon et al. (1993) discovered that two other single-gene mutations could affect lifespan. One of these longevity-regulating genes was known as daf-2 (daf from dauer formation); animals mutated at the daf-2 locus lived twice as long as the wild-type worms (Fig. 5.3). It was also shown that a second gene, daf-16, is required for the lifespan-extending effect of daf-2, because the double mutant, daf-2; daf-16, had a normal lifespan (Fig. 5.3). Interestingly, the reproductive output of the daf-2 mutant was hardly decreased (the brood size was 212 36 eggs in the long-lived mutant versus 278 35 in the wild type) and it was also shown that ablation of the germ-line precursor cells, effectively sterilizing the adult, did not increase lifespan. Thus the increased
Longevity and aging
The nematode C. elegans has developed into a classical model for the study of aging. Most of this research is motivated by a possible connection with aging in humans, but the new insights accumulated over the last few years are of equal relevance to ecology and life-history theory. It also appears that the properties of the molecular machinery regulating aging are shared with Drosophila and are even conserved across the whole animal kingdom. The main reason why C. elegans became a model for aging was due to the discovery of mutants that showed extended longevity. It turned out that the genes mutated to extend longevity were the same as those associated with the formation of dauer larvae. The dauer larva is a developmentally arrested stage, the entry of which is triggered by adverse conditions such as
100
Wild type daf-2(e1370)
80 % Alive
166
daf-16(m 26)
60
daf-16;daf-2
40 20 0 0
20
40
60
80
Days (after hatching)
Figure 5.3 Survival curves for C. elegans mutated in the daf-2 gene (daf-2(e1370)), compared with a control group (wild type). Survival curves are also shown for nematodes mutated in the daf-16 gene (daf-16(m26)) and in both genes (daf-16;daf-2). Median survival times are 17 days for m26, 17 days for m26;e1370, 19 days for the wild type, and 46 days for e1370. The comparison of mutants demonstrates that daf-2 dysfunction increases longevity by more than a factor of 2, and this effect requires a functional copy of daf-16. From Kenyon et al. (1993) by permission of Nature Publishing Group.
LIFE-HISTORY PATTERNS
lifespan of the daf-2 mutant was not a consequence of lower reproduction. Later several other genes were identified that can extend longevity when altered in C. elegans, and in total approximately 70 are known today. These genes include regulators of metabolism, genes involved in sensory perception, and reproduction genes. In addition, several genes regulating longevity were found to be associated with defence against oxidative stress. One specific group of genes receiving much attention appeared to encode proteins of the insulin signalling pathway. Insulin is a peptide hormone that in vertebrates is secreted from groups of cells associated with diverticula of the gut, in mammals taking the form of the islets of Langerhans in the pancreas. Insulinlike peptides and insulin-like growth factors (IGFs) are also present in invertebrates, usually in their highest concentrations in the gut. Insulin in mammals has a central role in carbohydrate and lipid metabolism, the best-known effect being increased uptake of glucose from the blood by muscles and adipose tissue and the formation of glycogen by the liver. Insulin and IGF do not enter their target cells but instead react with a receptor protein in the cell membrane, the insulin/IGF receptor. This protein has an extracellular domain, binding insulin or IGF, and a cytosolic domain, which acts as a tyrosine kinase: when activated it catalyses the phosphorylation of tyrosine residues in cytosolic proteins. These proteins in turn activate others in a complicated cascade, finally leading to phosphorylation of a cytosolic protein known as DAF-16. DAF-16 is a transcription factor of the so-called forkhead family. When active, this transcription factor switches on a series of genes that form a programme of dauer-larva formation. As long as DAF-16 is phosphorylated by DAF-2 signalling, it cannot enter the nucleus and so is effectively inactivated as a transcription factor (Lin et al. 2001). The secretion of insulin-like peptides is under control of the nervous system, which receives sensory input from the mouth region. So the whole system seems to be targeted towards translating information about food availability in the environment into either normal development (DAF-16 inhibited by activated DAF-2) or a dauer
167
programme (DAF-16 activated by relaxation of DAF-2; Braeckman et al. 2001; Olsen et al. 2003; Fig. 5.4). The pathway is referred to as insulin/ IGF-1 signalling. The fact that mutations in the DAF-2/DAF-16 pathway regulate longevity as well as dauer formation strongly suggest that the effect of daf-2 knockout on longevity is basically a dauer programme ‘mis-expressed’ in the adult. Indeed, Dillin et al. (2002), using RNAi to suppress daf-2 and daf-16 at different times in the life cycle, found that the same pathway regulates aging in the adult and dauer formation in the larvae. Jones et al. (2001), using SAGE (see Section 2.3) applied to dauer and non-dauer populations of C. elegans, showed that the dauer-specific transcriptome was greatly enriched in genes that previously were known to regulate longevity. The study also showed that dauer formation is not to be considered a true resting stage from a genetic point of view, because no fewer than 18% of the genes detected were specifically upregulated in the dauer larva, compared to a mixed-stage population. Similarly, Wang and Kim (2003) in a microarray study classified 1984 genes as dauer-regulated, which is 11% of the C. elegans genome. The dauer-enriched genes include several enzymes characteristic for anaerobic metabolism (Holt and Riddle 2003). The long-lived non-dauer daf-2 mutant illustrates that it is possible to uncouple part of the dauer programme (the part that confers extended longevity) from the main programme leading to quiescence. The mutations in daf-2 and other genes of the insulin/IGF-1 signalling pathway that affect longevity are weak mutations. Strong mutations in the same genes cause the C. elegans larvae to go into dauer dormancy regardless of environmental cues. This indicates that there may be thresholds in the levels of endocrine signalling such that a mild decrease of signalling is already sufficient to start the anti-aging programme, whereas a further decrease is necessary to enter the dauer stage. These thresholds could also be dependent on temperature; some age-1 mutants that develop into long-lived adults at normal culture temperature will go into dauer diapause at high temperature (27 C).
168
INTRODUCTION TO ECOLOGICAL GENOMICS
Insulin/IGF-like ligand
DAF-2
PI(3,4)P2 P
P
P
P
P
P PI(3,4,5)P3
AGE-1 PDK-1
P
P P P P AKT-2
Inactive DAF-16
AKT-1
Active DAF-16
Dauer formation Stress resistance and longevity
Normal reproduction, development, and lifespan Figure 5.4 Scheme of the insulin/IGF-1 signalling pathway, showing how extracellular insulin-like peptides may trigger a cascade of events, starting with binding to DAF-2, a receptor protein in the cell membrane and eventually leading to phosphorylation of DAF-16, a transcription factor of the forkhead family. By decreased insulin/IGF-1 signalling DAF-16 is activated, allowed to enter the nucleus, trigger a programme of dauer formation, stress resistance, and longevity, and suppress normal reproduction. P, phosphate group; PDK-1, phosphoinositide-dependent kinase 1; PI(3,4)P2, phosphatidylinositol 3,4-bisphosphate; PI(3,4,5)P3, phosphatidylinositol 3,4,5-trisphosphate. After Olsen et al. (2003), with permission from Springer.
Increased longevity similar to decreased DAF-2 signalling is also seen when the animals are cultured under dietary restriction, also called caloric restriction. This refers to a diet in which food intake is limited to 30–40% of the intake shown by
animals fed ad libitum. In C. elegans this can be achieved by diluting the bacteria in the medium or by applying an axenic medium with heat-killed E. coli cells. Because the insulin signalling pathway is associated with carbohydrate metabolism and
LIFE-HISTORY PATTERNS
the apparent cues for dauer induction come from food availability, it seems logical to conclude that dietary restriction promotes longevity through the same DAF-2/DAF-16 pathway. However, this appears not to be the case. Houthoofd et al. (2003) did experiments with daf-2 and daf-16 mutants both exposed to dietary restriction (Table 5.1). Their data show clearly that dietary restriction causes an increase in the median survival time by a factor of two and a half, both in the wild type and in the daf-16 mutant. In addition, a restricted diet can boost the median lifespan of the daf-2 mutant (which is already increased by a factor of 1.7 compared with the wild type), to a record value of 90.9 days (maximum, 136 days). In human terms these animals would correspond to healthy 500 years old! Interestingly, extension of lifespan is this way is not accompanied by decreased metabolic activity; actually, respiration was elevated substantially by dietary restriction as were activities of antioxidant enzymes, such as superoxide dismutase (Houthoofd et al. 2002). Another mutation that extends lifespan in C. elegans seems to act mostly independent of the insulin/IGF-1 signalling pathway. Mutations in the so-called clk-1 gene (the name derives from clock biological timing abnormality) increase longevity in association with a slowing down of the rate of many processes, including cell division, rhythmic behaviour, rate of feeding, and mitochondrial respiration. The correlation between longevity and metabolic rate supports the rate of living hypothesis of aging, which states that aging is Table 5.1 Survival times of different populations of C. elegans showing that effects of dietary restriction increase longevity independent of the insulin signalling pathway Population
N2 (wild type) daf-16(m26) mutant daf-2(e1370) mutant
Medium lifespan (days; mean S.E.) On normal medium
Under dietary restriction on axenic medium
14.4 0.1 12.9 0.1 24.3 0.2
36.4 0.2 32.6 0.2 90.9 0.4
Source: After Houthoofd et al. (2003).
169
a consequence of accumulating metabolic damage, in particular from endogenous oxygen radicals (Finkel and Holbrook 2000; Hekimi and Guarante 2003). Reactive oxygen species such as superoxide anion (O 2 ), hydroxyl radical (OH ), and hydrogen peroxide (H2O2) are amply generated by the electron-transport chain in the mitochondrion. The major source is complex III, in which ubiquinone, alias coenzyme Q, resides. This electron-transport molecule has an unstable intermediate that can easily donate electrons directly to molecular oxygen rather than to complex III. The mutated clk-1 protein cannot perform the final step in the biosynthesis of ubiquinone and as a consequence the precursor, demethoxyubiquinone, is incorporated in the electron-transport chain. Paradoxically, this alternative component appears to be less prone to the production of reactive oxygen species. Another role for clk-1 has been suggested by Branicky et al. (2000). The protein could have a regulatory role by reporting to the nucleus on the metabolic state of the mitochondria, in such a way that the rate of living may be adjusted to the generation of energy. If clk is mutated nuclear genes do not receive the right information on respiration and would set the rate of living at a default level lower than normal. This theory is interesting because it would imply that the effect of respiration on aging acts through a metabolic switch, rather than through a direct impact of damage accumulation (Guarante and Kenyon 2000). In addition to mutations, surgical operations can be applied to C. elegans to increase longevity. An interesting effect is seen after removal of the germ line. As noted in Chapter 3, C. elegans has a completely determinate developmental pattern in which the destination of every cell is fixed as soon as it comes into existence; the adult has exactly 959 cells, not including eggs and sperm cells, which descend from the zygote in a fixed lineage. Two cells, Z2 and Z3, give rise to the germ line by continuous division during development. The germ cells differentiate into sperm during the L4 stage or oocytes during adulthood (see Fig. 3.18). Removing the germ-line precursor cells by means of a laser extends the lifespan of C. elegans by
170
INTRODUCTION TO ECOLOGICAL GENOMICS
about 60% and this effect requires the presence of DAF-16. Animals that lack germ cells due to a mutation are also long-lived. In a series of elegant experiments, measuring the survival curves of various mutants, Arantes-Oliveira et al. (2002) showed that the lifespan-suppressive effect of the germ line is not dependent on the sperm or oocytes themselves, but only on proliferating, active germ-line precursor cells. So, despite the obvious negative correlation between reproduction and longevity in this system, there does not seem to be a simple trade-off in the classical sense that energy allocated to reproduction would detract from maintenance and so increase the rate of aging. Rather, a signal from the germ-line stem cells directs both aging and reproduction, maybe by altering the production of a steroid hormone or by altering the response to such a hormone (Arantes-Oliveira et al. 2002). An important issue in the metabolic network affecting aging in C. elegans is the question of which genes act upstream and which downstream in the insulin signalling pathway. Taking DAF-16 as a reference point, upstream genes are defined as the ones that affect expression or activity of DAF-16. To this category belong the neurosecretory signals leading to secretion of insulin-like factors, the genes encoding the insulin-like peptides themselves, the insulin/IGF receptor DAF-2, and the various genes in the signalling cascade leading to phosphorylation of DAF-16, such as age-1 and pdk-1. The downstream genes include the ones that are regulated by the transcription factor DAF-16 and whose expression contributes to longevity and stress resistance. The difference between upstream and downstream genes is difficult to make when looking at gene expression as such, but can be unravelled by studying mutants that are knocked out at crucial positions in the pathway. For example, Murakami and Johnson (2001) studied a transmembrane tyrosine kinase gene called old-1, which if overexpressed in C. elegans increases longevity by a factor of 1.5; using transgenic nematodes in which the old-1 gene was fused to green fluorescent protein the authors observed that the positive effect of old-1 on longevity was absent in a mutant in which daf-16 was knocked out. This
makes it likely that old-1 is regulated by DAF-16; that is, it is downstream of DAF-16.
5.2.2 Genome-wide analysis of lifespan modulation The various single-gene mutation studies and other manipulations have demonstrated that the effect of insulin/IGF signalling on longevity in C. elegans is linked to a large number of other processes, such as reproduction, lipid metabolism, diapause entry, and stress resistance. This has made the situation increasingly complex and it became difficult to see the bigger picture. However, recent genome-wide microarray studies (Murphy et al. 2003; Golden and Melov 2004; McElwee et al. 2004) have enforced an important breakthrough, presenting an interpretative framework for earlier data and even a new theory of aging. Murphy et al. (2003) aimed to identify all the genes that act downstream of DAF-16 by means of a cDNA microarray survey. These authors focused on genes that showed opposite expression profiles in daf-2- versus daf-16-knockout mutants. They also treated animals with RNAi of selected genes to confirm that these genes had an effect on longevity. A division in two classes was made: class-1 (lifespan-extending) genes were upregulated in daf-2 mutants and in daf-2 (RNAi) animals, but downregulated in animals in which both daf-16 and daf-2 were inhibited by RNAi. The second class of genes (lifespan-shortening) was defined by genes that displayed the opposite profile. A relatively succinct list of genes could be identified as belonging to either class and the most prominent ones of each class are listed in Table 5.2. Inspecting the genes in the two classes, it is obvious that the first class contains many genes of stress-defence systems (Table 5.2). Heat-shock proteins are molecular chaperones that support the folding of other proteins; many of them are highly inducible by several stress factors, including a heat shock, in which they were first described. Cytochrome P450 is an enzyme that catalyses the oxidation of aromatic lipophilic compounds, including many xenobiotics, but also endogenic substances such as steroids. Catalase is an enzyme
LIFE-HISTORY PATTERNS
171
Table 5.2 Overview of genes in C. elegans acting downstream of DAF-16, identified by differential expression using a microarray and reduced expression of daf-2 and daf-16 by RNAi Gene
Brief description
Class 1: upregulated by DAF-16 and positive regulators of longevity ctl-2 Peroxisomal catalase dod-1 Member of cytochrome P450 family hsp-16.1 Heat-shock protein lys-7 Enzyme associated with response to pathogenic bacteria dod-2 Thaumatin (sweet protein) associated with plant pathogenesis hsp12.6 Heat-shock protein, crystalline mtl-1 Metallothionein-like, cadmium-binding protein gei-7 Member of family of malate synthase/isocitrate lyase dod-3 Protein of unknown function dod-4 Aquaporin, member of family of transmembrane channels Class 2: downregulated by DAF-16 and negative regulators of longevity dod-17 Protein of unknown function nuc-1 Endonuclease associated with apoptosis dod-18 Member of Maf-like transcription factors dod-19 Protein of unknown function gcy-6 Putative guanylate cyclase, catalysing cGMP second messenger dod-20 Protein of unknown function dod-21 Protein of unknown function vit-5 Vitellogenin, 170 kDa yolk protein mtl-2 Protein of unknown function dod-22 Protein of unknown function Notes: Only the first 10 most prominent genes are shown for each class. Source: From Murphy et al. (2003).
that supports the catalysis of hydrogen peroxide, a very reactive oxygen species that may cause damage to membranes. It is also striking that class 1 includes several proteins that are known to be involved in antibacterial defence. Stress-defence systems will be discussed in more detail in Chapter 6. The class 2 genes listed in Table 5.2 are less well defined; in addition to a yolk protein, class 2 includes many proteins of unknown function. Several of the differential expressions reported in Table 5.2 were also found in a microarray study by Golden and Melov (2004), who compared a daf-2 mutant with the wild type. How DAF-16 upregulates or downregulates all these genes is not yet clear. Lee et al. (2003) identified 17 genes in the genome of C. elegans that were orthologous between C. elegans and D. melanogaster and had a putative binding site for DAF-16 in their promoter (between the start
site and 1 kbp upstream). Expression analysis confirmed that six of them were differentially expressed between a daf-2 and a daf-2; daf-16 mutant, as expected in the case of genes with a causal relationship to the insulin/IGF-1 signalling pathway. Interestingly, and in accordance with Murphy et al. (2003), both the upregulated and the downregulated genes had the consensus binding motif. However, none of the 17 genes identified by Lee et al. (2003) is shared with the list of Murphy et al. (2003), which indicates that other binding sites and trans-acting factors other than DAF-16 may be involved. Murphy et al. (2003) also discovered that a gene encoding an insulin-like peptide, ins-7, was present among the class 2 members. This protein is not only downstream of the DAF-16 pathway, but, being insulin-like, also acts as an activator of DAF-2. So, any positive signal on DAF-2 will
172
INTRODUCTION TO ECOLOGICAL GENOMICS
amplify the pathway, via inhibition of DAF-16, relieving the negative regulation of ins-7 expression and INS-7 stimulation of DAF-2. This positivefeedback loop in the system was thought to contribute to synchrony across cells in the animal. When dauer larvae sense the presence of favourable food conditions and the DAF-2 pathway is activated in some cells by increasing insulin-like peptides, an amplified signal to other cells will prevent the animals emerging from the dauer stage with a mixture of dauer and non-dauer cells. An overview of the aging-regulator system of C. elegans is given in Fig. 5.5 (Gems and McElwee 2003). The bigger picture integrates many aspects of previous studies. It explains why there are many genes with a small additive effect on aging: they are all regulated by the same transcription factor. The presence of yolk proteins in class 2 is consistent with the link between aging and reproduction, while the presence of antioxidant
enzymes in class 1 is in accordance with the wellknown relationship between oxygen radicals, cell damage, and aging. Another confirmation of the picture is found in Hsu et al. (2003) who showed that the transcription factor HSF-1, which is a regulator of the heat-shock response, also influences aging. Overexpression of hsf-1 extends lifespan, while reducing it shortens lifespan. So the two transcription factors DAF-16 and HSF-1 partly regulate the same genes with similar effects on aging. Another genome-wide survey of insulin/IGF-1 signalling-mediated longevity in C. elegans is found in the work of McElwee et al. (2003, 2004). These authors compared the expression profiles of dauer larvae with those of daf-2 mutants and argued that genes promoting longevity would have an expression signature similar to the dauer profile. It turned out that in fact around 21% of genes upregulated in dauer larvae are also
Other cells
DAF-2 insulin/IGF-I receptor
Signalling cascade Yolk proteins
INS-7 insulin-like protein
DAF-16
Heat-shock proteins
Antioxidant enzymes
Diverse other proteins
Diverse other proteins
Proteins promoting longevity
Proteins promoting aging Longevity
Figure 5.5 The insulin signalling pathway of C. elegans converges on repression of the transcription factor DAF-16. DAF-16 itself downregulates expression of proteins promoting aging and upregulates expression of proteins promoting longevity. Among the factors promoting aging is an insulin-like protein, INS-7, that acts upon DAF-2 as a positive-feedback link in the network and a signal to other cells. After Gems and McElwee (2003), by permission of Nature Publishing Group.
LIFE-HISTORY PATTERNS
upregulated in the daf-2 mutants, and a similar pattern holds for the downregulated genes. Like Murphy et al. (2003), McElwee et al. (2004) noted a prominent representation of genes associated with stress-defence systems among the positive regulators of longevity. Several of these genes are known to be associated with the so-called drug metabolism or biotransformation system. This system of interacting enzymes, which is studied extensively in toxicology, involves two phases in which lipophilic, often aromatic, compounds are first activated and then conjugated to form watersoluble complexes that can be excreted. Phase I of the biotransformation pathway is conducted by enzymes of the cytochrome P450 family. These are haem proteins that can oxidize aromatic compounds to phenols, epoxides, and quinones, which can then be subjected to conjugation by enzymes of phase II, which attach endogenic compounds such as sulphate, glucose, glucuronic acid, or glutathione to the activated product of phase I. The system acts against an enormous variety of lipophilic compounds including many xenobiotics (drugs, environmental pollutants, and plant secondary metabolites) as well as endogenic aromatics such as steroid hormones. We will learn more about this defence system in Section 6.2. The upregulation of many enzymes of the drug metabolism system in long-lived daf-2 mutants suggested to McElwee et al. (2004) that this system plays a central role in protection from the metabolic damage that accumulates with age (Fig. 5.6). Various cellular processes as well as xenobiotics produce ample reactive molecules that can cause permanent damage to cellular constituents. The biotransformation system can prevent such damage and upregulation of its enzymes is assumed to promote longevity. This new theory of aging is attractive since it assigns a central biological role to the biotransformation system which did obviously not evolve only to metabolize man-made chemicals such as drugs. On the other hand, the new theory could turn out to be a bit too simplistic, since biotransformation does not only detoxify chemicals, it can also activate chemicals to intermediates that cause more harm than the substrate itself. The detoxifying role of the biotransformation
173
system depends on a delicate balance between phase I and phase II enzyme activity; a general upregulation of all enzymes would be very ineffective and could even be damaging. In addition, many biotransformation enzymes have a great number of isoforms, with different induction profiles, where each substrate needs another isoform to be metabolized effectively.
5.2.3 Longevity-regulating systems across species One might think that the regulation of lifespan seen in C. elegans is tied so specifically to the dauer stage, which is absent in insects and vertebrates, that it does not have a validity outside nematodes. However, the converse is true! Fundamental aspects of the longevity programme elaborated in C. elegans appear to be conserved across organisms as widely different as yeast, Drosophila, and mouse; that is, the aging mechanisms are ‘public’ rather than ‘private’ (Gems and Partridge 2001; Partridge and Gems 2002a; Partridge and Pletcher 2003). This has stimulated hope for extrapolation to human longevity assurance, but it is also of relevance to ecology, since we may expect that several aspects of the genomic determination of longevity in model species are also valid for non-models in an ecological context. In D. melanogaster, as in nematodes, the discovery of mutants with elongated lifespans has been the trigger for aging research. A first hint that regulation of aging was conserved between nematodes and fruit flies came from the observation that, as in C. elegans, D. melanogaster mutants disturbed in the insulin/IGF signalling pathway have a longer lifespan. The proteins involved in the insulin/IGF-1 signalling pathway of Drosophila are INR (insulin/IGF receptor; homologous with DAF-2 in C. elegans), an insulin receptor substrate designated CHICO, a phosphoinositide 3-kinase, and a protein kinase B. Most attention has been paid to mutations in the gene encoding CHICO, which confer a dwarf phenotype with reduced fecundity, named after the smallest of the Marx brothers. Clancy et al. (2001), studying heterozygous and homozygous D. melanogaster chico1
174
INTRODUCTION TO ECOLOGICAL GENOMICS
OH
OH
OH
GLUC
GS
OH
Xenobiotics
GS
OH
Excretion GLUC
Plasma membrane Smooth endoplasmic reticulum
Phase 1 metabolism
Diverse metabolic and stochastic processes
OH OH OH
OH
Phase 2 metabolism
GLUC
GS GS
OH
GLUC
OH
GS
CYPs
OH
OH
UGTs
GLUC
GSTs
SDRs ROS Lipophilic toxic metabolites
Molecular damage
Aging
ROS Figure 5.6 Schematic representation of the theory by McElwee et al. which holds that a major contribution to the cellular aging process comes from lipophilic toxins generated by cellular activity and xenobiotics, which are biotransformed by phase I and phase II metabolism. ROS, reactive oxygen species; CYPs, cytochrome P450s; SDRs, short-chain dehydrogenase/reductases; UGTs, uridinediphosphate glucosyltransferases and uridinediphosphate glucuronosyltransferases; GSTs, glutathione S-transferases; GLUC, glucosyl or glucuronosyl; GS, glutathionyl. From McElwee et al. (2004), by permission of the American Society for Biochemistry and Molecular Biology.
mutants, were able to show that female median lifespan was increased from 48 to 57 days in the heterozygote and further to 63 days in the homozygote. The longevity-extending effect could be ‘rescued’ by introducing a P-element containing a chico( þ ) construct in the heterozygote chico1. This reduced the median survival time back to a normal value of 49 days. This type of genetic manipulation, by which not only mutants but also engineered rescue transgenes are studied, is necessary by present molecular genetic standards to prove that a gene is causally linked to an observed phenotype. Interestingly, the effect of chico1 acted more strongly in females than in males. The male
heterozygous chico1 showed only a small increase in lifespan, whereas the homozygotes lived for even less time than the wild-type flies. This suggests that female reproductive tissues might have something to do with the regulation of longevity in Drosophila. Mutations in the other components of the insulin signalling pathway, e.g. in InR, the Drosophila homologue of daf-2, produced longer lifespans in mutants with a mild reduction of signalling (Tatar et al. 2001). In addition, Clancy et al. (2001) noted that the effect of chico1 was not due to reduced fecundity per se. This was obvious when chico1 was introduced in a strain carrying a mutation that blocks oogenesis
LIFE-HISTORY PATTERNS
and causes complete sterility. chico1 was still able to extend the lifespan of these sterile flies. Also, chico1 flies did not have a lower metabolism per unit of body mass (Hulbert et al. 2004). Another commonality between the lifespanregulatory mechanisms of C. elegans and D. melanogaster is the involvement of a forkhead transcription factor homologous to the mammalian Foxo, which is called dFoxo in Drosophila and is a homologue of the nematode daf-16. Overexpression of dFoxo in Drosophila fat body increased female lifespan by 20–50% and reduced fecundity by 50% (Giannakou et al. 2004). In accordance with Clancy et al. (2001) there was no effect in male flies. Like C. elegans, Drosophila also shows the effects of dietary restriction. The response of lifespan to food concentration during larval culture shows an optimum curve, in which the optimum falls below normal. Low food density shortens lifespan due a starvation effect, and high density shortens lifespan due to accelerated aging (Fig. 5.7). Interestingly, in this work the response of chico1 mutants to food was very similar to the wild-type
175
flies, but was shifted to a higher food density (Clancy et al. 2002). The data can be explained by assuming that chico1 flies are less sensitive to food concentration, but respond similarly otherwise. This suggests that the metabolic changes induced by chico1 are in some way similar to those of dietary restriction and act along overlapping mechanisms. However, this conclusion is somewhat at variance with work on C. elegans (see above) and mice (Bartke et al. 2001), which has suggested that dietary restriction and reduced insulin signalling rely on two separate mechanisms. As in the case of reduced insulin/IGF-1 signalling, the lifespan-extending effect of dietary restriction is not a consequence of reduced fertility (Mair et al. 2004). We should note that median survival time is only a summary statistic of the survival curve and it does not capture the difference between two treatments well when the shape of the curve is also affected. In principle, an increase in median lifespan can be brought about by two mechanisms: first, by a reduction in the rate of mortality at all ages, extending the survival curve by making it
60
Mean lifespan (days)
55 50 45
chico1 homozygotes
40
Controls
35 30 25 0
0.3
0.6
0.9
1.2
1.5
Food concentration (relative to normal food concentration) Figure 5.7 Interaction between dietary restriction (dilution of food) and reduced insulin signalling (chico1 mutant, backcrossed into the wild-type strain) on adult lifespan. Food concentration is given as a fraction of normal food concentration. Median lifespan was estimated from a survival curve recorded by monitoring deaths every 2–3 days. Reprinted with permission from Clancy et al. (2002). Copyright 2002 AAAS.
176
INTRODUCTION TO ECOLOGICAL GENOMICS
less steep, and second, by postponing the age at which mortality begins, causing a shift of the curve towards higher ages. The effect of dietary restriction on Drosophila is obviously of the first type. There does not seem to be a memory effect of previous food intake: flies that were subjected to dietary restriction after having been fed ad libitum for different times all showed the same immediate reduction of mortality rate (Mair et al. 2003). This would imply that dietary restriction does not exert its beneficial effect on lifespan by preventing accumulation of damage. This is in accordance with the situation in mice, where it appears that dietary restriction slows the rate of aging (changing the slope of the survival curve), while mutations in insulin/IGF-1 signalling delay the onset of aging (Bartke et al. 2001). Summarizing, the insulin/IGF-1 signalling pathway is definitely involved in regulation of longevity in Drosophila, as it is in nematodes, but the effects in Drosophila are slightly more complicated; they seem to depend more on the rate of pathway activity than in C. elegans. Also, the effects of dietary restriction on lifespan seem to be less than in C. elegans and some aspects of the stress response, for example heat resistance, that are induced by daf-2 mutation in C. elegans are not seen in chico1 in Drosophila. Finally, reduced insulin/ IGF-1 signalling activity has an effect on lifespan only in female Drosophila, but this aspect cannot be compared with C. elegans, because all experiments in that species have been done with hermaphrodites, not with males. The evolutionary conservation of longevity regulation is not limited to C. elegans and Drosophila, but extends to other animals. Holzenberger et al. (2003) were inspired by the work on nematodes and fruit flies and investigated the longevity of mice with defective IGF signalling. Whereas C. elegans has only one insulin-like receptor, mammals have several; the one that is a homologue of DAF-2 and InR is insulin-like growth factor-type 1 receptor, IGF-1R. Holzenberger et al. (2003) studied a transgenic mouse in which the essential exon 3 of the igf-1R gene was deleted. Controls were included to show that the knockout allele was transcribed but not translated into a functional
product; in the absence of dosage compensation by the wild-type allele the heterozygote had about half the level of IGF-1R protein. This mutant mouse lived 26% longer than the wild type, but the effect was more pronounced in females (33%) compared with males (16%, not significantly different from the wild type). The mutant was also appreciably more resistant to oxidative stress, which was tested by injection of paraquat. Paraquat is a herbicide and a notorious redox cycler, producing large amounts of oxygen radicals, especially superoxide anion, when activated by biotransformation. In addition, Holzenberger et al. (2003) noted that the igf-1R mutation had hardly any effect on growth and no effect at all on physical activity, food intake, and fertility of the mice. In another study Blu¨her et al. (2003) studied mice with a fat-specific insulin receptor-knockout and these animals likewise showed an extended lifespan, which in contrast to Holzenberger et al. (2003) held for both females and males and was accompanied with reduced adiposity (less fat and a leaner body). Some aspects of longevity regulation in animals may even be linked to yeast (Guarante and Kenyon 2000; Hekimi and Guarante 2003). A key regulator of aging in yeast is a gene involved in silencing chromatin, called sir2 (silent information regulator 2). Gene silencing is a process by which segments of a chromosome are excluded from transcription. SIR-2 silences specific targets of chromatin by deacetylation of histones (proteins that are packed with the DNA in chromosomes), which introduces a local change in chromatin by which DNA is rendered inaccessible to transcription. In yeast, SIR-2 is involved with the regulation of the sexual cycle, and it mediates the formation of spores. Upregulation of sir2 leads to a longer lifespan (greater number of cell divisons before the larger (mother) cell shows signs of senescence). A longer lifespan has also been reported for nematodes with a sir2 duplication (Tissenbaum and Guarante 2001). In addition, it has been shown in yeast that caloric restriction, in the sense of limited glucose supply, increases longevity as well as upregulates sir2. Finally, sir2 is also upregulated in long-lived fruit flies under dietary restriction (Rogina et al. 2002).
LIFE-HISTORY PATTERNS
So, all in all, there is considerable agreement between the three genomic model species of nematode, fruit fly, and mouse, in at least the main aspects of longevity regulation. Some aspects of the system may even extend to yeast. The picture is most complete in C. elegans, but without doubt genome-wide surveys of aging-related gene expression will shed more light on similarities across species soon. The similarities were reviewed by Tatar et al. (2003) and are reproduced here in Fig. 5.8. Upstream of the network there is a sensory mechanism providing input to the central nervous system; this controls the secretion of insulin-like peptides, which suppress the insulin/IGF-1 signalling pathway, starting with daf-2 in C. elegans, InR in Drosophila, and igf-1R in mouse. This then leads to the activation of a forkhead transcription factor, which triggers a great variety of gene expressions and leads to a complicated network, including steroid hormones and signals from the germ line. The final outcome is that growth and reproduction are decreased and anti-aging mechanisms promoted. The division of the body into gonad and soma in this network is crucial (Fig. 5.8).
5.2.4
Trade-off or independent control?
The results discussed above illustrate that the integration of genomics into life-history theory is now in full flight. At the same time, some of the results have come as a kind of shock, because some mutants seem to invalidate a fundamental theorem of life-history theory, the trade-off between lifehistory attributes. Experimental studies suggest that reproduction, metabolic rate, and longevity can sometimes be uncoupled from each other, which is in flagrant conflict with the idea that there should be a ‘cost to reproduction’ to prevent Darwin’s demon—an hypothetical organism that produces an infinite number of offspring directly after birth and lives forever—from conquering the world (Barnes and Partridge 2003). Is there really such a conflict? In many of the experimental studies reviewed above there is an obvious negative correlation between longevity and fertility. Fig. 5.9 summarizes the data on the different daf-2 genotypes in
177
C. elegans (Leroi 2001). From the viewpoint of life-history theory, it is sufficient to know this relationship and use it to draw inferences about the ultimate effects for the optimal life history. From the viewpoint of ecological genomics, however, it is necessary to understand why this negative correlation is there. It then turns out that decreasing reproduction is not the cause of the increased longevity, but that the two processes are regulated by a common mechanism with two different consequences, one usually (but not always) suppressing reproduction, the other increasing stress resistance and (more in females than in males) longevity. Above all, the studies show that the negative relationship in Fig. 5.9 is not due to competition between soma and gonad for a limited resource. Leroi (2001) argued that life-history ecologists too often cannot resist the temptation to postulate some kind of energy allocation wherever they find a negative correlation between two life-history traits. Geoffroy’s ‘loi de balancement’ is assumed to reign whether it applies or not. This conclusion has been challenged, however, by Lessels and Colegrave (2001) and Barnes and Partridge (2003), who argued that the lack of longevity extension seen when the gonad of C. elegans is ablated does not negate the presence of an energy-allocation mechanism, if resources once mobilized but not exploited for reproduction are lost. In other words, ‘removing the bucket will not stop the tap’. Barnes and Partridge (2003) argue that the idea of a cost of reproduction has survived the challenge in this case. Our feeling is that the issue is mainly semantic. Life-history ecologists tend to use the term tradeoff in a general sense, without specifying what kind of mechanism is behind a negative correlation. This is perfectly reasonable because lifehistory theory seeks explanations in evolutionary terms and looks for ultimate causation, rather than proximate mechanisms. Still, we feel that there should be some understanding between these two worlds and evolutionary explanations should be consistent with the underlying physiology and molecular genetics. In particular, if a trade-off is assumed to imply allocation, it should be made clear what kind of resource is being allocated.
(a)
(b)
IPC
Food, Insulin-like peptides environmental cues
Pars intercebralis Insulin-like peptides
DAF-2
DAF-16
?
Circulating insulin-like peptides
Neuropeptides Forkhead?
Steroid (20HE?)
DAF-9, steroid?
?
Insulin-like peptides
GC
Food, environmental cues
Insulin-like peptides
INR
DAF-2 Steroid?
Corpora cardiaca Corpora allata Secondary hormones: Juvenile hormone
Secondary hormones? DAF-2 SG DAF-9 DAF-12
INR ?
CNS and neuroendocrine tissue
INTRODUCTION TO ECOLOGICAL GENOMICS
Neuroectoderm
GC
DAF-2 Intestine DAF-12 Soma
SG
Steroid (20HE?)
20HE
Gonad
Fat body Peripheral soma
Gonad Reproduction
Aging
Aging
Reproduction
(c)
Suprahypothalamic CNS
178
CNS IR / IGF-1R
Unrestricted food intake
Appetite
Hypothalamus IR / IGF-1R Pituitary
LH FSH
GH
TSH Insulin and IGF-1
Thyroid Inhibin and T /T steroid hormones 3 4 ? IR/IGF-1R Steroid hormones Gonad
Reproduction
Leptin
IR Liver Adipose Pancreas IR /IGF-1R insulin IR /IGF-1R Muscle Peripheral IR/ IGF-1R soma
Aging
LIFE-HISTORY PATTERNS
However intricate the genetic or hormonal regulatory pathways, no genomic model organism can escape the energy-conservation laws of thermodynamics. An issue which tends to be neglected in this respect is that in many experiments the actual intake of energy is not measured. This is often due to the difficulty of measuring ingestion and assimilation in animals that take up food from the very substrate in which they live (nematodes, earthworms, fly larvae, flour beetles, etc.). In many allocation arguments the intake of food per unit body mass or surface area is just considered constant, or is assumed to depend only on environmental availability (e.g. prey density). However, food intake is also under control of internal drives. Many animals will eat more when there is a higher internal demand, for example due to the onset of egg production. If this goes unnoticed to the experimenter any energy allocation will be masked. The question may be asked, why are lifespan mutants not more common in nature, if they live longer and some even maintain normal reproduction? Partridge and Gems (2002b) argued that the life-shortening effect of insulin/IGF-1 signalling could be a negative pleiotropic effect of a fitness increase at earlier ages, the advantage being that efficient insulin/IGF-1 signalling promotes fertility in Drosophila and unarrested development in C. elegans. Another part of the answer could lie in the conditions acting upon life-history traits in the wild. Walker et al. (2000) demonstrated that long-lived nematodes carrying a mutation in age-1 quickly disappeared from a mixed culture in which they had to compete with wild-type worms under periodic starvation periods. So there are certainly fitness costs to a long life, but they are not always visible under standard laboratory conditions. Unfortunately little is known about the field ecology of C. elegans and this seriously hampers a
179
better understanding of the ecological relevance of life-history mutations (see Section 3.3). A final remark concerns the ecological relevance of a long life. In almost all organisms in the wild, the life-time of the average individual falls far below the lifespan seen under protected conditions in captivity or laboratory culture. Everyone who has observed great tit parents flying to and fro all day to feed their nestlings knows what fate awaits the great majority of caterpillars in the surroundings. In an earlier career, studying the demography of field populations of Collembola in forest soils, one of us estimated the fraction of hatchlings that would survive to lay their first clutch as 0.7–6.9% and the life expectancy at hatching as 2.0–3.8 weeks (Van Straalen 1985); the large majority of juveniles disappears in the guts of beetles, mites and spiders. Still it is not very difficult to keep individuals of the same species alive in the laboratory for more than 2 years. So do laboratory observations on longevity have any relevance for the field? Kirkwood and Austad (2000) argued that the principal determinant in the evolution of longevity is the level of extrinsic mortality. Animals that live a short life in the wild due to extrinsic sources, are expected to live also short (but longer than in the wild) if the external sources of mortality are taken away in cage or laboratory; the pattern of species differences remains the same. So there could indeed be a relationship between aging phenomena observed in the laboratory and the vicissitudes of outdoor life, but it remains quite a challenge for ecological genomics to demonstrate that relationship.
5.3 Gene-expression profiles in the life cycle The analysis of the Roff (2002) model given at the beginning of this chapter has shown that age at maturation is a very important life-history trait.
Figure 5.8 Model for endocrine regulation of longevity in (a) C. elegans, (b) D. melanogaster, and (c) Mus musculus, showing how environmental cues are translated into neuroendocrine signals, acting upon an insulin/IGF signalling pathway and triggering a variety of hormonal responses, including steroid responses. The ultimate effect is that different priorities are given to gonad versus soma; that is, reproduction and growth versus aging. CNS, central nervous system; FSH, follicle-stimulating hormone; GC, germ-line cells; GH, growth factor; 20HE, 20-hydroxy-ecdysone; INR, insulin receptor; IPC, insulin-producing cells; IR/IGF-1R, insulin receptor/IGF-1 receptor; LH, luteinizing hormone; SG, somatic gonad tissue; TSH, thyroid-stimulating hormone; T3, 3,3 0 ,5-tri-iodothyronine; T4, thyroxine. Reprinted with permission from Tatar et al. (2003). Copyright 2003 AAAS.
180
INTRODUCTION TO ECOLOGICAL GENOMICS
70
60
Longevity (days)
50
40
30
20
10 100
150
200
250
300
350
Lifetime progeny
Figure 5.9 Negative correlation between reproduction and median longevity of different genotypes of daf-2 mutants of C. elegans, which have different levels of insulin/IGF signalling. The wild type is indicated by a filled circle. The rather strong negative correlation (r ¼ 0.75) between the two processes would be seen as evidence for a trade-off in life-history theory; however, molecular analysis of the mechanism provides no evidence for resource allocation, but rather suggests the action of a hormonal signal with two opposite effects. Reprinted from Leroi (2001), with permission of Elsevier.
It is a well-known fact in life-history theory that when it comes to maximizing intrinsic population growth rate, decreasing the age at first reproduction has the greatest effect, especially when reproductive effort is already high. So it is interesting to explore how expression of genes develops with age and how genomic networks underly the timing of important events in the life history, such as the onset of reproduction. The question is, are there specific expression programmes that mark the various life-history stages?
5.3.1
Developmental stage
Gene-expression profiles tend to change markedly in organisms that develop through distinct stages. This is obvious from work conducted on the model organisms C. elegans and D. melanogaster (Reinke and White 2002). An exemplary study with nematodes was conducted by Hill et al. (2000). These authors isolated oocytes, eggs, juvenile
worms, egg-laying adults, and 2-week-old adults (see Fig. 3.19) and profiled the transcriptome of each stage using an oligonucleotide microarray. The statistical technique of ‘self-organizing maps’ (see Section 2.4) was used to cluster the genes into groups that had similar expression changes throughout the stages. In total, 4221 genes were classified and 36 different clusters were recognized, of which four, A–D, are shown in Fig. 5.10. It is obvious that each life stage has its characteristic expression profile. In the four groups in Fig. 5.10 cluster A can be considered adult genes, cluster B are larval genes, cluster C are reproduction and egg development genes, and cluster D represents exclusive egg genes. However, none of the clusters, except possibly D, is expressed in one stage only. There are marker genes for each category; for example, vit-6, a gene encoding a vitellogenin protein, falls into class A, a cuticular collagen, dpy-13, is typical for class B, mom-2, required for polarization of the MDS cell (one of the blastomeres in the four-cell stage), is characteristic of class C. Class D appeared to contain several transcription factors and rare messages, but many of these genes had very low expression levels and the data were not considered reliable; nevertheless, class D seemed to contain mostly egg-specific genes (Fig. 5.10). In short, the genes falling into each category reflect the most prominent activity in a life stage. A similar transcription-profiling study was done by Jiang et al. (2001), who used microarrays spotted with PCR fragments from a genomic library rather than oligonucleotide chips. These authors recognized 25 groups of genes with distinct expression patterns across the stages. Particular attention was paid to a group of genes called cyclins, which encode proteins involved with cell division. Cyclins are named after their periodic appearance in the cell cycle and they activate cyclin-dependent kinases, which trigger various events in the cell cycle. In C. elegans, almost all cell divisions occur in the egg stage, in which the number of cells increases from one to around 700, and in the L4 larva and the adult, in which there is extensive proliferation of cells in the gonads. The C. elegans genome encodes seven cyclin genes,
LIFE-HISTORY PATTERNS
Cluster A: 55 genes
Oocytes 0 h
12 h
24 h
36 h
48 h
Cluster B: 80 genes
60 h 2 weeks Oocytes 0 h
Cluster C: 104 genes
Oocytes 0 h
12 h
24 h
36 h
48 h
181
12 h
24 h
36 h
48 h
60 h 2 weeks
Cluster D: 215 genes
60 h 2 weeks Oocytes 0 h
12 h
24 h
36 h
48 h
60 h 2 weeks
Figure 5.10 Showing changes of gene expression through the life cycle of C. elegans for four clusters of genes. The number of genes in each cluster is indicated above the panel. The profiles were all normalized to the same amplitude, so no units are indicated on the y-axis. Reprinted with permission from Hill et al. (2000). Copyright 2000 AAAS.
which have a similar expression pattern over the stages (Fig. 5.11). They show peak expressions in the embryo, the L4 stage, and the adult, as expected. Another perspective on the C. elegans data may be obtained by clustering the genes according to their similarity with other genomic models. Hill et al. (2000) classified genes as ‘core’ genes (shared among yeast, nematode, and fruit fly), ‘animal’ genes (shared between nematode and fruit fly), and ‘worm’ genes (unique to the nematode). When comparing these gene categories over the life stages the proportion of core genes decreased from
egg to adult and the ‘worm’ genes increased (Fig. 5.12). So, one can say that in the course of development, C. elegans becomes more and more a nematode and loses some characteristics of an average animal. The genes expressed in the early stages are most similar to other animals. This pattern is reminiscent of Ernst Haeckel’s biogenetic law, which states that ‘ontogeny recapitulates phylogeny’; reformulated in genomic wording the law may read that genes expressed in early development tend to be more evolutionarily conserved than genes expressed in adult life. It would be interesting to explore whether similar tendencies
L4 Adult
L2 L3
L1
INTRODUCTION TO ECOLOGICAL GENOMICS
Egg
182
T06E6.2 F48E8.7 F43D2.1 C37A2.4 Y43E12A.1 T12C9.4 ZC168.4 1
4 8
2
Figure 5.11 Expression of seven cyclin genes through the life stages of C. elegans. Expressions were assessed with a microarray spotted with PCR products from a genomic library, and hybridization was relative to cDNA from a mixed-stage population. After Jiang et al. (2001), by permission of the National Academy of Sciences of the United States of America.
Fraction of total expression
0.6 0.5
Core Animal Worm
0.4 0.3 0.2 0.1 0
0
12
24
36
48
60
Developmental time (hours) Figure 5.12 Fraction of genes assigned to three categories (‘core’, shared among yeast, nematode, and fruit fly; ‘animal’, shared between nematode and fruit fly; ‘worm’, unique to nematode) among 4221 genes showing differential expression during the life cyle of C. elegans, as detected by oligonucleotide microarray transcription profiling. Reprinted with permission from Hill et al. (2000). Copyright 2000 AAAS.
are valid for other species; with the availability of more and more genome-wide stage-specific expression profiles, a thorough test of the pattern discovered by Hill et al. (2000) would be feasible. Also in Drosophila, a considerable part of the gene complement shows stage-specific gene
expression. Here comparisons were made between eggs, larvae, pupae, and adults (Arbeitman et al. 2002). Interestingly, many genes in Drosophila appear to be expressed in two waves during development, with embryonic expressions being recapitulated in pupae, and larval expressions recapitulated in adults. Judging from their expression profiles, pupae are like eggs and adults are like larvae. This is understandable from the processes going on in the various stages. The pupa is a stage of intense reorganization of the body, in which most of the larval tissues degenerate and many adult tissues are newly developed from the imaginal discs, processes which are comparable with the extensive cell differentiation in the egg, and apparently involving partly the same genes. The larval stage is characterized by extensive energy acquisition and growth, which is parallelled in the adult by energy acquisition directed to reproduction. Arbeitman et al. (2002) also showed that in the early egg stage a very large proportion of the transcripts are maternal; that is, they are deposited by the mother during oogenesis. Most of these maternal transcripts degrade during the first hours of embryogenesis, but some persist on to the first larva. Maternally derived messengers indicate a mechanism by which the mother can direct the development of her offspring in a non-genetic way. Such maternal effects are very common in insects. Well-known examples can be found in the mechanisms of developmental plasticity in response to seasonal change in temperate climates. The photoperiod experienced by an ovipositing female insect often determines the likelihood that the offspring will go into diapause. This is achieved by adding maternal factors to the egg that will direct its development into a diapausing stage. Such phenomena are a well-known source of annoyance to entomologists doing quantitative genetics experiments, because maternal effects confound any estimation of heritability from parent–offspring comparisons. However, maternal effects are now increasingly recognized as being shaped by natural selection to act as a mechanism by which maternal experience is translated into increased fitness of the offspring (Mousseau and Fox 1998). The study of
LIFE-HISTORY PATTERNS
Normalized Intensity
(a) 0.8
exon 5’ exon 4 exon 2
0.6
CG4550
exon 5 exon 3 exon 1
0.4 0.2 0 –0.2 –0.4 EE
LE
L
P
M
F
Stage (b) 1.2
exon 6 exon 4 exon 2
Normalized Intensity
1 0.8
CG8946
exon 5 exon 3 exon 1
0.6 0.4 0.2 0 –0.2 –0.4 –0.6 –0.8 EE
LE
L
P
M
F
Stage (c) 0.6 0.4
Normalized Intensity
Arbeitman et al. (2002) shows how powerful the mother can be in dominating the transcriptome of the early egg. Recently the diversity of life-cycle transcript changes has been enriched with a new phenomenon, exon-specific expression. Stolc et al. (2004) profiled the transcriptome of D. melanogaster eggs, larvae, pupae, and adults using an oligonucleotide microarray with no less than 179 972 36-mer probes. In this microarray, exons of the same gene were targeted by different probes, allowing the researchers to profile not only the fluctuations of gene expression of individual genes, but also the changes in expression of exons from the same gene. This is especially relevant if genes undergo alternative splicing; that is, the mature mRNA is composed of a subset of exons from the primary transcript, depending on the conditions. Using exon-specific probes on the microarray, Stolc et al. (2004) could indicate several genes for which the abundance of exons was not the same in the different stages. For example, for one gene designated as CG8946, exon 1 showed a peak in larva, whereas exon 4 peaked in pupa, and four other exons were expressed synchronously (Fig. 5.13b). For some genes the expression of different exons was even anticorrelated (Fig. 5.13c). It is likely that such stage-dependent exon-specific expressions are crucially important in the developmental process of each stage. These results imply, quite disquietingly, that a vast amount of variation in gene expression may be missed in microarray studies that use cDNAs or that assess only a subset of exons from each gene.
183
CG1893
exon 1 exon 4
0.2 0 –0.2 –0.4 –0.6 –0.8 EE
LE
P
L
M
F
Stage
5.3.2
Diapause
Many organisms have a dormant stage in which they shut down activities such as locomotion, and develop tolerance against adverse conditions. The best-known example of life-cycle dormancy is the phenomenon of diapause in insects with seasonal phenologies. Depending on the species, diapause may apply to the egg, larva, pupa, or adult. Are there specific gene-expression patterns characteristic of diapause stages? Surprisingly, this question can only be answered in a rudimentary sense.
Figure 5.13 Exon-specific expression profiles for three genes over the life stages of D. melanogaster (EE, early egg; LE, late egg; L, larva; P, pupa; M, male; F, female), assessed using a microarray in which different oligonucleotide probes targeted different exons of the same gene. Expression was normalized by the mean and the standard deviation. (a) In gene CG4550 (ninA, a G-protein-coupled photoreceptor expressed in the eye) all exons are expressed synchronously. (b) In gene CG8946 (Sly, a sphingosine-1-phosphate lyase involved with phospholipid metabolism) exon 1 peaks in larvae and exon 4 peaks in pupae. (c) The two exons of gene CG1893 (encoding a product with phospholipid scramblase activity) show anticorrelated expression over the stages. Reprinted with permission from Stolc et al. (2004). Copyright 2004 AAAS.
184
INTRODUCTION TO ECOLOGICAL GENOMICS
Although there is a tremendous amount of literature on environmental regulation of diapause (especially photoperiod), the circadian clock, and the hormonal changes associated with diapause entry and termination, the molecular genetics of diapause have received little attention (Denlinger 2002). This may be due to the fact that D. melanogaster is not the best model for studying diapause, since in this species diapause consists of only a weak reproductive arrest. Better models are the silkworm, Bombyx mori, which has a facultative egg diapause, and the flesh fly, Sarcophaga crassipalpis, which has pupal diapause. Many agricultural pest species have been used for diapause research, for obvious reasons. Photoperiod is an important driver of diapause entry in many insects, since it is an accurate predictor of seasonal change. It is widely assumed that the circadian clock provides the mechanism by which insects can perceive photoperiod. Photoperiodic clock genes are known from the Drosophila genome and several of them have been sequenced in other insects such as Bo. mori, the tobacco hornworm Manduca sexta, and S. crassipalpis (Goto and Denlinger 2002). The gene period (per) has been examined in relation to diapause, but how the circadian clock triggers the entry into diapause is not clear at all. It turns out that Drosophila carrying a null mutant of per can enter diapause just as well as the wild type, although they do not have a circadian rhythm. Denlinger (2002), drawing together a large number of mostly pre-genomic studies, provides an overview of genes that have their expression regulated by diapause. Table 5.3 gives a summary of this information. Genes are subdivided into six categories, depending on whether they are up- or downregulated early or late in diapause, or not modulated at all. The great majority of genes is downregulated, although some are specifically upregulated. This demonstrates that, like the dauer stage of C. elegans, insect diapause does not imply a simple shutting down of the genome but involves an active and specific programme of gene regulation. This is also evident from the fact that in individuals destined for diapause the stage preceding the diapause is longer than normal.
This stage includes physiological preparations and sometimes specific behaviours aimed at locating suitable microhabitats for hibernation or aestivation. Some of the differential expressions in Table 5.3 could be due to master genes, regulating the various processes during diapause; other genes may act downstream of regulatory cascades, being up- or downregulated as a consequence of master genes. Still other genes have specific functions in the diapause, such as those related to coldhardiness, defence against microbial infection, etc. Some genes are expressed intermittently during diapause, possibly in response to the periodic boosts of respiration triggered by pulses of juvenile hormone. Table 5.3 shows that the picture of diapausespecific gene expression in insects is still incomplete. Some gene expressions are reminiscent of dormancies in other species. This is especially applicable to the upregulation of heat-shock protein 70, which is consistently reported in insect diapause and is similar to the pattern seen in the C. elegans dauer larva (see above) and several other organisms, even fungi. The universal involvement of heat-shock proteins in dormancy and life extension is striking and must relate to a very fundamental role of these proteins in the cell (see also Section 6.2). In insect diapause, not all heat-shock protein are upregulated, however: some are not regulated at all, and Hsp90 is actually downregulated (Table 5.3).
5.3.3
Adult life and sex
After the attainment of adulthood, gene-expression profiles tend to change only little. This is evident both in C. elegans (Lund et al. 2002) and in D. melanogaster (Zou et al. 2000; Jin et al. 2001). Applying rigid statistical criteria, Lund et al. (2002) found only 164 genes, representing about 1% of the C. elegans genome, to change from the first day of adult life to senescence (19 days). Many of these genes were related to stress resistance. The 27 heat-shock genes on the microarray all showed a common expression profile, rising over the first part of adult life and decreasing later in life.
LIFE-HISTORY PATTERNS
185
Table 5.3 Overview of gene products regulated by diapause in insects Gene or gene product
Function
Species
Not influenced by diapause Heat-shock cognate protein 70 (hsc70) 28 S ribosomal protein Cyclins E, p21, and p53 Glutathione S-transferase Ubiquitin
Cellular stress response Protein synthesis Cell cycle Detoxification Cellular stress response
S. crassipalpis, C. fumifera S. crassipalpis S. crassipalpis C. fumiferana C. fumiferana
Downregulated throughout diapause Mitochondrial phosphate transport protein Midgut enzymes Heat-shock protein 90 (hsp90) Proliferating cell nuclear antigen (pcna) cdc2-related Ser/Thr kinase
Respiration Food assimilation Cellular stress response Cell cycle Cell cycle
C. fumiferana L. dispar S. crassipalpis S. crassipalpis Bo. mori
Upregulated throughout diapause Heat-shock protein 23 (hsp23) Heat-shock protein 70 (hsp70)
Cellular stress response Cellular stress response
S. crassipalpis S. crassipalpis, R. pomonella, O. nubilalis L. decemlineata Bo. mori G. atrocyanea L. dispar
Heat-shock protein 70A (hsp70A) E26 transforming sequence (ETS) protein 7.9 kDa peptide Alkaline phosphatase
Cellular stress response Transcription factor Function unknown Various functions
Upregulated in early diapause, downregulated in late diapause pScD41, clone from brain-enrichment library Function unknown, possibly a retrotransposon Samui Cold-induced activator of sorbitol dehydrogenase 55 kDa protein in gut Function unknown
S. crassipalpis Bo. mori L. dispar
Downregulated in early diapause, upregulated in late diapause Ultraspiracle (usp) Ecdyson receptor Sorbitol dehydrogenase (sdh) Conversion of sorbitol into glycogen defensin Microbial defence 45 kDa actin-like protein in brain Function unknown
S. crassipalpis Bo. mori C. fumiferana L. dispar
Genes expressed intermittently during diapause 60 S ribosomal protein PO
S. crassipalpis
Protein synthesis
Notes: Species investigated were S. crassipalpis (flesh fly; Diptera, Sarcophagidae), Choristoneura fumiferana (spruce budworm; Lepidoptera, Tortricidae), Lymantria dispar (gypsy moth; Lepidoptera, Lymantriidae), Bo. mori (silkworm; Lepidoptera, Bombycidae), Rhagoletis pomonella (apple maggot fly; Diptera, Tephritidae), Ostrinia nubilalis (European corn borer; Lepidoptera, Pyralidae), Leptinotarsa decemlineata (Colorado potato beetle; Coleoptera, Chrysomelidae), Gastrophysa atrocyanea (leaf beetle; Coleoptera, Chrysomelidae). Source: After Denlinger (2002).
Another category of differential expressions consisted of insulin-like proteins. Three of the insulin genes increased in expression, but one, Ins-7, showed a decreased expression during life. Ins-7 was identified in the study of Murphy et al. (2003) as belonging to a group downregulated by DAF-16 and contributing to a positive-feedback loop in the
insulin/IGF-1 signalling signalling pathway (see Section 5.2). Decreased Ins-7 expression during life, as found by Lund et al. (2002), is consistent with upregulation of stress-responsive genes by increased DAF-16 activity. So it seems that normal aging in C. elegans is not accompanied by a specific genetic programme. The changing expression
186
INTRODUCTION TO ECOLOGICAL GENOMICS
profiles seem to indicate a response to accumulating cellular damage from reactive oxygen species and unfolded proteins, rather than being part of the developmental repertoire. Also in Drosophila the effects of age on gene expression in normal (wild-type) flies tend to be weak. Zou et al. (2000) measured genome-wide changes in expression of flies between 3 and 50 days of age, using an EST microarray. A total of 127 genes was found to be regulated by age, and these were classified according to three categories: genes associated with reproduction, metabolic genes, and stress-responsive genes. In all categories there was a trend towards decreasing expression with age, but among the stress-responsive genes some were upregulated. In a similar study, Jin et al. (2001) compared 1 and 6 week-old flies of different sexes and from different strains using replicated microarray hybridizations. Expression profiles were mostly affected by sex, less so by strain, and only weakly by age. Analysis of variance showed that sex, in combination with the sex strain interaction component, accounted for between 60 and 90% of the variation in gene expression. Some of the genes that were agerelated in the study of Zou et al. (2000) were confirmed as age-related by statistical significance in the study of Jin et al. (2001), but several others were not. The large influence of sex in this study is a notable result. Much of the sex bias can probably be attributed to reproductive activities that are naturally different between male and female. In C. elegans most studies are done with hermaphrodites, but Jiang et al. (2001) compared expression profiles of hermaphrodites and males. No fewer than 2171 genes (12% of all the genes in the genome) were found to be sex-regulated. About half of the male-specific genes were expressed in the gonad and the sperm, and the other half were expressed in the soma. Male C. elegans have an elaborate mating behaviour to find the hermaphrodite’s vulva with their tails and to ejaculate sperm into it. In conjunction with this behaviour, males have 115 neurons and neuronal support cells not found in the hermaphrodite, whereas hermaphrodites have only eight sexspecific neurons. Sex-specific expression patterns
of the whole animal may partly be due to genes expressed specifically in these cells. One of the groups of sperm-enriched genes is found in the L4 larva, which is the major sperm-producing stage of the hermaphrodite. The sex bias in gene expression in Drosophila and C. elegans is corroborated by the fact that on the phenotypic level strains of the same species tend to be more different in one of the sexes than in the other. On a larger scale, the same phenomenon is seen in the differences between closely related species of fruit fly: such differences tend to be larger in males compared to females. A comparison of gene-expression profiles of the sibling species Drosophila simulans and D. melanogaster showed that 50% of the genes that differed in expression between the species did so in a sex-dependent manner. Almost all the genes that differed by more than a factor of four were male-specific genes (Ranz et al. 2003). These data underline the importance of sex-dependent selection in the differentiation of the Drosophila species cluster. The relatively minor age-specific expression changes observed in the studies reviewed above are more or less at variance with a detailed study by Pletcher et al. (2002) on transcript profiles in aging D. melanogaster. Although these authors analysed only females and so the effects of age cannot be weighed against the effects of sex, the differential expressions they observed indicated that nearly 23% of fruit fly genes were modulated by age, a figure much higher than reported by Jin et al. (2001) and Zou et al. (2000), and by other studies on rodents and rhesus monkeys. There is, however, some degree of similarity across studies in the types of genes regulated by age. Pletcher et al. (2002) found decreasing expression for genes involved in chorion formation, which is obviously due to reproductive senescence, and upregulation of stress-response genes such as cytochrome P450, as in the other studies. Interestingly, aging was also associated with increased expression of antibacterial peptides. This suggests that microbial infection is an important factor in the life of Drosophila in laboratory culture. Whereas some of the age-specific expression profiles are only valid for certain model organisms,
LIFE-HISTORY PATTERNS
and maybe only under specific culturing conditions, ecological genomics of life histories should aim at finding regulatory signatures of life-history events that are of more general validity. Such signatures can be detected when expression profiles are compared across species. One of the first studies to use this approach was done by McCarroll et al. (2004). These authors analysed microarray data from C. elegans and D. melanogaster, in which expressions were compared between two stages, young adults (0 days for C. elegans, 3 days for D. melanogaster) and mature adults (6 days for C. elegans, 23 days for D. melanogaster). The measurements were then paired systematically between orthologous genes from the two organisms. The authors were interested in genes with the same expression ratio in the two species; that is, genes which if downregulated with aging in Drosophila are also downregulated with aging in C. elegans. The methodology is illustrated in Fig. 5.14. Classifying the genes by Gene Ontology categories, McCarroll et al. (2004) identified three categories of shared transcriptional profiles with decreasing expression during adult life: genes involved in oxidative metabolism (respiratory chain, citric acid cycle), genes involved in catabolism (peptidases) and DNA repair, and genes involved in molecular transport functions, such as ion transporters and ABC transporters. So, the shared transcriptional profile of aging seems to involve a decreased commitment to energy generation and active movement of ions, transmitters, and nutrients. Interestingly, these changes are implemented abruptly early in adult life, and only little further change occurred later in life. So it seems that, if there is a developmentally timed transcriptional regulation of aging, it is a programme that is associated with the onset of adulthood. What we see later in life, for example upregulation of stress-response genes in the studies reviewed above, is more a consequence than a cause of aging. The type of comparative functional genomics applied by McCarroll et al. (2004) is a promising
187
new strategy for identifying the general genomic basis of life-history events and to remove some of the noise and contingency that (not unlike ecological studies) seems to be inherent to many microarray-based transcription profiles.
5.3.4
Flowering time in Arabidopsis
The developmental patterns of plants show considerably more flexibility than those of animals. Most of the development process in plants occurs post-embryonically through the action of shoot and root apical meristems. Consequently, there is ample opportunity for plants to adapt their morphology to specific environmental conditions, whereas the body plan of animals is more or less fixed and only certain aspects of it may depend on the environment. One of the major developmental transitions in the life of a plant is the switch from vegetative growth to reproductive development. The timing of this switch in relation to environmental conditions is of crucial adaptive value; fitness will be lost if reproduction and seed set fall in an unfavourable season or are not synchronized with other members of a population in out-crossing species. This implies that flowering time, also called bolting time, and especially the way in which it is modulated by environmental cues, is an important life-history trait optimized by natural selection. The major model for the genomics of flowering time is A. thaliana. There is some work on other Brassicaceae and on crops such as corn and rice, but this is relatively little in comparison with Arabidopsis and therefore we will focus initially on this model. Despite its present widespread distribution (Fig. 3.23), Arabidopsis has its origin in a northern, seasonal climate and so the timing of the reproductive switch with respect to daylength and temperature is a crucial aspect of its life history. A. thaliana is a facultative long-day plant, which implies that bolting is stimulated by the long days of early spring. Bolting also requires vernalization: a prolonged period of cold (3–8 weeks at 4 C or lower), necessary to allow flowering in spring. Through the analysis of mutants a large number of genes has been identified that in some way or
188
INTRODUCTION TO ECOLOGICAL GENOMICS
(a)
(b) *
C. elegans tax-2 Group 1 D. melanogaster CG17922
*
C. elegans tax-4
C. elegans
D. melanogaster
Condition A versus condition B
Condition C versus condition D
Group 2 D. melanogaster Cng
C. elegans unc-59 * Group 3851
D. melanogaster pnut D. melanogaster Sep1 * Ancestral gene
Log-transformed change in expression (log C/D) for D. melanogaster orthologue
(c)
2
1
0
–1
–2
r = 0.15 –2 –1 0 2 1 Log-transformed change in expression (log A/B) for C. elegans orthologue
Figure 5.14 Illustrating the principle of comparative functional genomics, as applied by McCarroll et al. (2004) to identify transcriptional profiles of aging, shared across C. elegans and D. melanogaster. (a) Phylogenetic analysis identifies orthologous pairs between the species. If more than one paralogue is present within a species, the most conserved orthologous gene pair is identified. (b) Transcription profiling with microarrays is applied to reveal the relative change in expression when comparing two conditions (e.g. young and old age). (c) Groups of genes are selected according to the Gene Ontology annotation system and the expression ratio for the two species is plotted in a correlation diagram. If there is a significant correlation, the group is said to have a conserved regulation and may be considered an expression signature of the treatment applied in the two species. From McCarroll et al. (2004), by permission of Nature Publishing Group.
another influence flowering time. Putterill et al. (2004) provide an annotated list of 51 genes. Interestingly, most of their products act as regulatory proteins, for example transcription factors,
RNA binding proteins, signal transducers, and kinases. The number of genes involved illustrates that flowering time is an extreme example of polygenic control. Genetic research has shown that
LIFE-HISTORY PATTERNS
the flowering-time genes fit into four regulatory networks (Koornneef et al. 1998; Mouradov et al. 2002; Ratcliffe and Riechmann 2002; Simpson and Dean 2002; Putterill et al. 2004), which will be discussed in detail below. The ‘default’ life cycle of Arabidopsis seems to be a direct floral transition early in life, and this can be achieved by mutations in some of the floweringtime genes. Such ‘rapid-cycling’ varieties are useful under laboratory conditions, but in the wild type the floral transition is actively repressed. The gene FLOWERING LOCUS C (FLC) is a crucial element of this repression; it encodes a MADSbox transcription factor, which regulates several floral-identity genes in the apical meristem. Consequently, conditions that stimulate bolting and shorten flowering time must remove the repressive action exerted by the FLC locus. This way of regulation, in which an environmental signal removes a repressor, is thought to be more stable and more specific than a system in which the environmental signal acts as a direct positive regulator (Casal et al. 2004). We saw above that a similar system of double-negative regulation governed the dauer transition in C. elegans. The MADS-box genes, to which FLC belongs, are a large family of very old transcription factors, which have diversified in plants more than in animals (Becker and Theißen 2003). They derive their name from the MADS box, a highly conserved 180 bp consensus sequence, which like the homeobox in the Hox genes encodes a DNAbinding domain. There are two types of MADSbox gene, type I and II, which are both represented in plants, fungi, and animals, and which are assumed to derive from a very old duplication in the stem of the eukaryotes, more than 1000 million years ago. Little is known about the type I genes in plants; type II genes have diversified considerably and have given rise to genes that control all the developmental processes in plants, such as the ontogeny of roots, flowers, seeds, and fruits. Loss-of-function mutations in MADS-box genes cause homeotic transformations (replacing, for example, sepals with carpels or petals with stamens), indicating that these genes act to determine the identity of a meristem or a primordium.
189
The type II MADS-box genes in plants belong to two families, MIKC*-type genes and MIKCc-type genes, where MIKCc is subdivided into four subfamilies (Becker and Theißen 2003). FLC belongs to one of the MIKCc subfamilies. As indicated above, four interacting pathways control flowering time in A. thaliana: the photoperiod and light-quality pathway, the vernalization-response pathway, the autonomous pathway, and the gibberellin signalling pathway. These pathways are interconnected and converge on FLC and other flowering regulators such as FT and SOC1 to activate the floral-identity genes AP1 and LFY (Fig. 5.15). The photoperiod-response pathway integrates information from the daylength to promote flowering in response to long days. A crucial gene in this pathway is CO (CONSTANS), named after the mutant that confers insensitivity to daylength. CO induces early flowering by activating FT, which regulates the floral-identity gene AP1 (Fig. 5.15). The expression of CO is influenced by the circadian clock, a system of autoregulated genes with feedback loops such that clock proteins regulate their own expression and appear in an oscillating fashion. The clock is entrained by photoreceptors such as phytochromes (PHYA and PHYB) and cryptochromes (CRY1 and CRY2). Entrainment ensures that the period of the circadian rhythm is synchronized with the daily cycle of light and dark. The circadian feedback loop generates a series of oscillating outputs including rhythmic expression of CO. The peak of expression falls in the second half of the day; however, to exert its action, the CO protein must be stabilized and this occurs only in the light. CO is stabilized by PHYA in far-red light and by CRY1/CRY2 in blue light (Valverde et al. 2004). This recent insight in the post-translational regulation of CO provides an explanation for the external coincidence model, which holds that photoperiodic responses are regulated by a signal with circadian expression that must fall in the light to trigger the response. In the case of CO, the peak of expression at the end of the day coincides with the light only on long days; CO is then stabilized and may act upon FT. In short days, the peak of CO expression falls in the
INTRODUCTION TO ECOLOGICAL GENOMICS
CO
?
FLC
FT
FRI
SOC1
G
Light
A
G
A
CRY2
bi os si gn ynth al lin esis g
C
ir Ph cad ia ot op n c lo er ck io d Ve pa rn th al wa iz y at io n Au to no m ou s pa th wa y
190
FPF1
? AP1
LFY
Figure 5.15 Overview of pathways in control of floral transition in A. thaliana. Four inputs are indicated, with a selection of the key genes involved. CRY2, CRYPTOCHROME 2; CO, CONSTANS; FLC, FLOWERING LOCUS C; FRI, FRIGIDA; FT, FLOWERING LOCUS T; SOC1, SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1; FPF1, FLORAL PROMOTING FACTOR 1; AP1, APETALA 1; LFY, LEAFY; GA, gibberellic acid. Arrows indicate promotion; bars indicate repression. After Mouradov et al. (2002). Copyright American Society of Plant Biologists.
dark, the CO protein is then unstable, FT expression is not upregulated, and flowering is delayed (Yanovsky and Kay 2003; Hayama and Coupland 2004; Putterill et al. 2004; Schepens et al. 2004). A surprisingly large part of the genome of A. thaliana undergoes day–night oscillations. A genome-wide transcription-profiling study by Harmer et al. (2000) classified 6% of the probes on an oligonucleotide gene chip as cycling with a period of between 20 and 28 h. Four categories were recognized: (i) light-harvesting centres, photosynthesis genes, phytochromes, and cryptochromes, (ii) genes involved with photoprotective pigment pathways, such as flavonoids and anthocyanins, (iii) enzymes involved in resistance to chill and drought, for example catalysing lipid modification, and (iv) enzymes of the carbon, nitrogen, and
sulphur pathways. The authors were also able to identify a conserved 9 bp motif in the promoters of 35 cycling genes, which suggests that these genes are regulated by the same transcription factor. A similar study was reported by Schaffer et al. (2001), who used a microarray with 11 521 Arabidopsis ESTs showing that 11% of the genes were expressed diurnally. Obviously, such widespread rhythmicity in the genome reflects the pervasive influence of light on the metabolism of phototrophic organisms; at the same time, it reminds experimenters how important it is to standardize the time of the day when harvesting RNA in studies looking at gene expression in plants. The vernalization pathway for the control of flowering time integrates information from the past temperature regime. A crucial gene in this
LIFE-HISTORY PATTERNS
pathway is FRI (FRIGIDA). This gene promotes the transcription of FLC and so represses the floral transition. Mutations in FRI remove this positive regulation and cause loss of vernalization requirement. The FRI locus is particularly relevant in the ecology of Arabidopsis, because it shows natural variation associated with flowering time. When a comparison is made of flowering times of Arabidopsis accessions of different geographic origin, plants from low latitude tend to flower earlier in a common garden than plants from high latitude. However, this latitudinal cline is only found in ecotypes that have a functional FRI gene (Stinchcombe et al. 2004), suggesting that FRI mediates the transduction of latitudinal information into regulation of flowering time. An important issue in understanding the response to vernalization has been the question of how vernalized plants can remember a cold treatment and flower several weeks later, even when temperatures are higher for some time after the cold signal. It turns out that cold treatment induces an altered state in the shoot apex which can be passed on through mitotic cell divisions, even in the absence of cold. Recent research has shown that gene silencing due to changes in chromatin structure is the basis of this cellular memory (Bastow et al. 2004; Sung and Amasino 2004). We know from basic biochemistry that in eukaryotic chromosomes the DNA double helix is wound around groups of small globular proteins, histones, forming nucleosomes. These histones have tails protruding outward from a nucleosome, in which the lysine residues are normally acetylated. Because histones are highly positively charged proteins, acetylation of the tails is nessessary to prevent the formation of aggregates of nucleosomes and to maintain a loose chromatin structure in which DNA is accessible to transcription. Sung and Amasino (2004) identified a regulatory gene in Arabidopsis called VERNALIZATION INSENSITIVE 3 (VIN3), which, in conjunction with two other vernalization genes, VNR1 and VNR2, inactivates FLC by local deacetylation of histones. Histone deacetylation causes condensation of chromatin and shuts off DNA from transcription. This
191
process is catalysed by histone deacetylase complex (HDAC), a cluster of molecules involving a DNA-binding protein and an acetyltransferase enzyme. The condensed state of chromatin is transferred to the daughter cells when cells divide and so provides a mechanism of inheritance that does not involve alterations in DNA. This type of inheritance is called epigenetic. VIN3 is the most upstream component of the vernalization pathway identified so far, but it is still not known how the protein senses cold. Sung and Amasino (2004) suggest that VIN3 might be a receptor for phosphoinositides (a group of phospholipids) in the nucleus, and could perceive changes in the composition of these compounds that occur during cold exposure. The third pathway for regulating flowering time in Arabidopsis, the autonomous pathway, integrates information from the developmental stage of the plant. In the default state it represses FLC like the vernalization pathway (Fig. 5.15). Arabidopsis mutants of the autonomous pathway are earlyflowering but retain the photoperiodic response, and so the flowering signal is independent of environmental cues (hence the use of the term autonomous). However, work by Bla´zquez et al. (2003) has shown that expression of genes in the autonomous pathway depends on temperature; this would represent a system of thermosensory control of flowering time that acts in parallel to vernalization. The autonomous pathway involves a group of six different genes, which act upon FLC in two different ways. One of the mechanisms involves inactivation of FLC by histone deacetylation, like in the vernalization pathway (He et al. 2003). This is mediated by a locus FLD, which encodes a protein that forms part of an HDAC. Another gene product of the autonomous pathway, FVE, is probably part of the same HDAC (Amasino 2004; Ausı´n et al. 2004; Kim et al. 2004). In a series of elegant experiments He et al. (2003) were able to show that a specific region in the first intron of FLC acted as a binding site for the HDAC (Fig. 5.16). Mutations in FLD, as well as deletion of a 294 bp region from intron 1, prevented binding of HDAC to the FLC gene, causing continued transcription of FLC and late flowering.
192
INTRODUCTION TO ECOLOGICAL GENOMICS
Wild type
FLD
FLC expression
Flowering time
Low
Early
High
Late
High
Late
fld
294-bp deletion FLD
FLC chromatin
Acetylated histone tail
294-bp region of Intron 1
FLD
Proposed HDAC complex containing FLD
Figure 5.16 Regulation of FLOWERING LOCUS C (FLC), a floral repressor of Arabidopsis, by FLD (FLOWERING LOCUS D). In the wild type, FLC expression is suppressed by deacetylation of histones in the vicinity of FLC, conducted by an HDAC, of which FLD is a part. If FLD is mutated or if a 294 bp region in the first intron of FLC is deleted, HDAC is no longer able to deacetylate the FLC histones, alleviating FLC from transcription suppression and causing late flowering. Reprinted with permission from Bastow and Dean (2003). Copyright 2003 AAAS.
The second regulatory input on FLC from the autonomous pathway comes from the floralpromotion genes FCA and FY. The way in which these genes regulate FLC expression represents another complicated but beautiful example of gene regulation underlying life-history traits (Eckardt 2002; Macknight et al. 2002; Amasino 2003; MacDonald and McMahon 2003; Quesada et al. 2003; Simpson et al. 2003). The FCA gene includes 20 introns, which are spliced out during mRNA assembly; however, introns 3 and 13 are spliced alternatively, leading to four different transcripts, designated as a, b, g, and d. Only the g transcript
functions in the control of flowering time; it encodes a protein that, together with the FY protein, suppresses FLC mRNA and thus stimulates flowering. In addition, FY and FCA proteins feed back upon the activity of the FCA gene because they promote the formation of the inactive b transcript, by polyadenylation in intron 3. This negative-feedback loop is essential to maintain a low concentration of active transcripts of FCA. When the autoregulation breaks down, active FCA is formed, causing inhibition of FLC mRNA and induction of flowering (Fig. 5.17). The alternative splicing of FCA transcripts provides a mechanism
LIFE-HISTORY PATTERNS
FCA pre-mRNA Intron 3
WW PLPP
Intron polyadenylation
Intron splicing AAAAA
WW
AAAAA
FCA-β
FCA-γ PLPP
Active FCA + FY protein Repression of FLC mRNA levels
Non-functional FCA protein FCA/FY negativefeedback loop
Flowering
Figure 5.17 Scheme of the input from FCA and FY in the regulation of flowering time in Arabidopsis. Intron 3 of the FCA pre-mRNA transcript can be spliced out in two different ways, one of which is promoted by FY and FCA proteins, leading to intron polyadenylation and a non-functional b transcript. The other pathway leads to a fully functional g transcript, which in conjunction with FY represses FLC mRNA. Since FLC is a flowering repressor, this stimulates flowering. WW, a 35–40-amino acid protein domain engaging in protein–protein interactions; PLPP, amino acid motif of the FY protein, interacting with the WW domain of FCA. After Putterill et al. (2004), by permission of John Wiley & Sons.
by which FLC expression can be fine-tuned during development and limited to certain tissues. It is not known what endogenous signal is directing the autonomous pathway or triggers expression of FLD, FVE, FCA, and FY. Plants must pass through a juvenile phase before they can flower, but it is unclear how this is sensed internally. It might be that the pathway is not regulated dynamically, but functions constitutively to maintain high levels of FLC expression throughout early development (Simpson and Dean 2002). In addition, parts of the pathway may act to transfer information about environmental temperatures, as indicated above. The inhibitory effect of FLC on flowering is due its repressive effect on FT (FLOWERING LOCUS T; Fig. 5.15). Recently another gene suppressing FT has been identified, designated EBS (EARLY BOLTING IN SHORT
193
DAYS; Go´mez-Mena et al. 2001; Pin˜eiro et al. 2003). The sequence of this gene suggests that it is part of a chromatin-remodelling complex, and this suggests another case of epigenesis in floweringtime regulation. The fourth pathway acting upon flowering time is the gibberellin signalling pathway (Fig. 5.15). Gibberellic acid (GA) is a plant hormone with important effects on growth regulation, promoting germination, stem elongation, and fruit growth. Mutations in GA biosynthesis and GA receptors disrupt the floral transition, and have many other effects on plant development. One way in which gibberellins promote flowering is by increasing transcriptional activity of the floral meristemidentity gene LFY (LEAFY), through upregulation of a MADS transcription factor gene, SOC1 (SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1). It is not known which endogeneous or exogeneous signals are integrated by the GA input in the flowering-time network. Most of the insights discussed above have been obtained through analysis of mutants and naturally occurring varieties. Genome-wide expressionprofiling studies have confirmed the regulatory networks derived from single-gene mutants, but at the same time have suggested the involvement of even more genes. Schmid et al. (2003) used microarray-based transcription to obtain a genome-wide picture of floral transition in Arabidopsis. Plants mutated in different floweringtime genes were grown initially under short days and then transferred to long days, and geneexpression profiles determined over 7 days. Schmid et al. (2003) noted that many genes were repressed, rather than upregulated, by transition to long days. This is at variance with the scheme outlined above, because until then repressors had been identified only in the vernalization and autonomous pathways, not in the photoperiodic pathway (Fig. 5.15). Two of the repressor genes were identified and ¨ TZE (SMZ; meaning night cap) named SCHLAFMU and SCHNARCHZAPFEN (SNZ; meaning snoring uvula). Knockout mutants of SNZ and SMZ flowered normally, showing that the two genes have a redundant function, and could not have been detected by genetic screens using mutants. They
194
INTRODUCTION TO ECOLOGICAL GENOMICS
both encode a so-called AP2 domain, which makes them potential binding proteins for microRNAs, which are short, single-stranded, RNA molecules that can base-pair with complementary sequences in mRNA, blocking their translation. Regulation of mRNA by microRNA has been implicated as an important mechanism in plant morphogenesis. The study of Schmid et al. (2003) suggests that microRNAs can also play a role in the regulation of flowering responses to daylength.
5.3.5 Regulation of flowering time in other plants Is all the detailed knowledge about regulation of flowering time in Arabidopsis applicable to other plant species? Similarities are found in the Brassicaceae, the plant family to which Arabidopsis belongs (Kole et al. 2001). In Brassica rapa several flowering-time QTLs were identified and highresolution mapping showed that one of them, VFR2, was homologous to Arabidopsis FLC. It seemed to have the same phenotypic effect: late flowering, downregulated by vernalization in the biennual genotype of B. rapa. Kim et al. (2003) identified genes sharing strong homology with AGAMOUS-LIKE 20, a MADS-box transcription factor downstream of FLC in B. rapa as well as in two other Brassicaceae, Cardamine flexuosa and Draba nemorosa. The expression pattern of AGL20 in C. flexuosa during the floral transition was similar to Arabidopsis, which together with the data from Kole et al. (2001) suggests that at least some aspects of the regulation of flowering time are conserved between Arabidopsis and other Brassicaeae. It is likely that most of the flowering-time genes identified in Arabidopsis are also present in plants outside the Brassicaceae, but they do not necessarily have the same function. For example, Petersen et al. (2004) recovered MADS-box genes of perennial ryegrass, Lolium perenne, which were differentially expressed during transition from vegetative to reproductive growth induced by vernalization. They used a differential-display technique (see Section 2.1, Fig. 2.3) with one PCR primer targetting a monocotyledon-specific
conservative region in the MADS-box gene. After sequencing nine ryegrass MADS-box genes and studying their expression with quantitative realtime PCR the authors noted both similarities and differences with the Arabidopsis system. Genes with sequence homology to the Arabidopsis AP1 subfamily appeared to have a different expression pattern and possibly a different function in vernalization, compared to Arabidopsis. A more detailed comparison of flowering-time regulation is possible between Arabidopsis and rice (Hayama et al. 2003; Griffiths et al. 2003; Hayama and Coupland 2004; Putterill et al. 2004). Like many economically important crops Oryza sativa is a short-day plant; it promotes flowering when daylength falls below a critical threshold. Would this suggest that the mechanisms for regulation of flowering are entirely different from the long-day plant Arabidopsis? Recent genetic studies have elucidated part of the photoperiodic control of flowering time in rice. Several rice genes have been shown to be orthologues of Arabidopsis genes: a gene named Hd1 is homologous to CO, and Hd3a is an orthologue of FT. However, CO promotes expression of FT in Arabidopsis whereas Hd1 suppresses expression of Hd3a in rice (Hayama et al. 2003). So the photoperiodic response is reversed by using the same set of regulatory genes, regulated differently. Fig. 5.18 provides an overview of the similarities in the regulation of flowering time between the two plant species. Obviously, the usefulness of A. thaliana as a model for life-history investigation is limited by the fact that it represents only one type—a winter annual—out of the large variety of plant life histories. Biennuals, perennials, shrubs, and trees may have completely different ways of dealing with the problem of optimal timing of reproduction. Examination of the gene content of the recently completed Populus trichocarpa genome shows that most of the Arabidopsis floweringtime genes have counterparts in the poplar genome; however, a significant exception is the central floral repressor FLC which seems to lack an orthologue in poplar (Brunner and Nilsson 2004). The FLC subgroup of MADS-box genes seems to be specific to the Brassicaceae lineage. This raises
LIFE-HISTORY PATTERNS
(a)
195
(b)
PHYs DRYs
PHYA,B,D,E CRY1,2 ELF3 ZTL
Clock entrainment?
Clock entrainment
Clock + LHY CCA1 CR2 TOC1 ELF3
PHYA CRY2
FKF1 ELF3
SES (PHYs)
GI
GI CO activity
CO circadian expression
ELF3 ZTL Clock + Hd6 LHY TOC1
Hd1 activity?
Hd1 circadian expression
CO
Hd1
Long days FT SOC1
Long days
Short days Hd3a SOC1
Long day flowering
Arabidopsis
Short day flowering
Rice
Figure 5.18 Similarities and differences between the photoperiodic control of flowering in (a) Arabidopsis and (b) rice. Arabidopsis flowering is promoted by long days while rice flowering is promoted by short days but repressed by long days. Despite the different phenotypic responses many elements of the regulatory network are the same. After Putterill et al. (2004) by permission of John Wiley & Sons.
questions as to the function of the other floweringtime genes in poplar. Despite the fact that a large part of the flowering time network may be conserved across species the functions of the genes are not necessarily the same in species with different life histories.
5.4 Phenotypic plasticity of life-history traits Many life-history attributes do not attain fixed values but respond to environmental conditions in an adaptive fashion. Part of the variation in life histories over species stems from the fact that different species have adopted different ways of responding to environmental factors. The functional relationship between the phenotype and the
environment is called a norm of reaction (see Section 5.1). Life-history theory assumes that such a norm itself can be subject to natural selection and is optimized with respect to certain environmental conditions. We have discussed plant flowering time in the previous section as a life-history trait; however, its response to photoperiod and temperature can be seen as a reaction norm. In this section we will discuss more examples of phenotypic plasticity and its genomic underpinning. There is considerable confusion as to how the primarily ecological concept of a reaction norm should be interpreted on the genetic level. One view holds that reaction norms are no more than a set of life-history traits measured in different environments, and that one has to analyse each trait in each environment as a separate variable,
196
INTRODUCTION TO ECOLOGICAL GENOMICS
taking into account cross-environment correlations; this approach is also known as the character-state view of phenotypic plasticity (Roff 2002). Another approach emphasizes the continuity of the reaction norm across environments. This is especially appropriate if environments form a natural gradient, for example in the case of temperature. Plasticity is then defined by the response in the average environment, plus the slope of the reaction norm if it is linear. For non-linear reaction norms there is no obvious indicator of plasticity, although the first derivative of the reaction-norm value in the average environment may be used as a local measure of plasticity when that environment changes (De Jong 1995). This approach is known as the reaction-norm view of phenotypic plasticity (Roff 2002). It has been suggested that in addition to genes determining the average response, there should exist ‘genes for plasticity’; that is, genes which determine the slope of the reaction norm. Natural selection emanating from variable environments could promote such plasticity genes. In particular, plasticity is favoured (Schlichting and Smith 2002): if environmental change is frequent, if environmental cues are reliable, if environmental variation is fine-grained in space or time, in the case of coarse-grained temporal variation, if change is predictable, or in the case of fine-grained temporal variation, if there is a predictable sequence. The reaction-norm perspective is very much dominated by the terminology of quantitative genetics and by statistical analysis of phenotypic data across environments. Molecular data are changing this perspective (Pigliucci 1996; Schlichting and Smith 2002). The example of flowering time discussed above, as well as the cases discussed below, illustrate that it may be difficult to reconcile the quantitative-genetics views of plasticity with modern genomic insights. The concept of a plasticity gene does not have a clear interpretation on the molecular level. Rather, plastic life-history traits are determined by networks of gene expressions, which integrate multiple cues from the
environment with signals from the internal metabolism in such a way that the difference between genes for plasticity and genes for an average response cannot be seen. In this section we discuss three cases—polyphenism and body size in insects, and shade avoidance in plants—to illustrate this argument. As we will see, the genomic underpinning of life-history plasticity is less well developed than some of the other issues discussed in this chapter, so the section is phrased in terms of examples rather than a general theory.
5.4.1
Polyphenetic development
Many insects will develop not only one phenotype but several at the same time or different phenotypes in a temporal sequence, phenomena known as polyphenisms. Obviously, when the same genotype develops different phenotypes, there must be developmental switches that are sensitive to environmental conditions. Therefore, polyphenetic development can be considered a prime case of phenotypic plasticity, also called discrete phenotypic plasticity to differentiate it from the continuous phenotypic plasticity described by reaction norms. Functional genomic analysis should be able to reveal the expression programmes underlying development of alternative phenotypes. Spectacular examples of polyphenisms are found in insects that can develop different morphotypes in different seasons or in response to changes in the diet. Several examples are discussed by Nijhout (2003a), including spring and summer forms of nymphalid butterflies, gregarious and non-gregarious phases of locusts, soldier and worker castes in ants, and hornless and horned mating types in dung beetles. In all cases investigated, polyphenetic switching of the developmental pathway is triggered by a hormonal signal. Development is canalized into two or more alternative pathways, through an altered hormone titre, an altered threshold sensitivity to the hormone, an altered timing of hormone secretion, or an altered timing of the hormone-sensitive period. Often the environmental signal triggering an alternative condition falls considerably before the actual developmental switch itself; when a
LIFE-HISTORY PATTERNS
decision on a specific pathway has been made, development usually becomes irreversible after some time and the animal is destined to become a specific morph. Seasonal polyphenisms in Bicyclus butterflies (family Satyridae) have been investigated in detail. There are about 70 species in the genus Bicyclus, which inhabit a variety of habitats in Central Africa. Most species have a wet-season morph with brown-coloured wings, and conspicous eyespots and bands, as well as a dry-season morph with dull colours and cryptic wing patterns. This seasonal diphenism can be understood as an adaptation to seasonal changes in the habitat, expressing camouflage against a background of dead vegetation in the dry season, when the butterflies are less active, and predator deflection using eyespots in the wet season, when butterflies are more active. The two morphs can be produced in laboratory cultures maintained at different temperatures (Fig. 5.19). However, it is not certain whether temperature alone is the most important environmental cue determing the morphs, since
Figure 5.19 Seasonal polyphenism in Bicyclus anyana (Lepidoptera, Satyridae) includes a wet-season morph (top) and a dry-season morph (bottom). Courtesy of P.M. Brakefield, University of Leiden.
197
temperature can be negatively correlated with humidity in one place and positively in another (Roskam and Brakefield 1999). As Fig. 5.19 illustrates, a major difference between seasonal morphs lies in the eyespots on the wings. Butterfly eyespots are pattern elements composed of concentric rings of coloured scales. These rings develop around an organizing centre, a so-called developmental focus, which during metamorphosis induces the surrounding scalebuilding cells to produce a designated pigment (Brunetti et al. 2001; Beldade and Brakefield 2002; Carroll et al. 2005). Four stages can be recognized in the development of eyespots on butterfly wings. The first step already takes place in the imaginal disc of the last larval instar, when subdivisions (fields) of the wing are defined. In the second stage, foci are established within specific fields. The establishment of foci takes place in each field separately, which explains why mutants of butterflies with multiple eyespots on the wing can have one of the spots missing without any consequence to other spots (Monteiro et al. 2003). Specification of the eyespot focus is indicated by expression of a homeobox transcription factor, Distal-less (Dll), a Hox gene that has been cloned in Drosophila and many other species. Due to conservation of Hox genes throughout the animal kingdom, antibodies against the Drosophila Hox proteins also provide reactivity to the orthologous Hox proteins of other insects, which allows the expression of these developmental proteins to be localized in developing butterfly wings (Brunetti et al. 2001; Beldade et al. 2002). In the third stage, which takes place in the early pupa, a signal from the focus induces the surrounding cells to adopt a certain colour. The type of pigment that these cells adopt seems to depend on the sensitivity thresholds of the responding cells, whereas the strength of the signal determines the size of the eyespot. The fate determination around the focus uses the hedgehog signalling pathway, one of the major so-called toolkit genes of developmental genetics (Carroll et al. 2005). This pathway, like the insulin signalling pathway discussed in Section 5.2, translates the binding of an extracellular ligand into regulation of a transcription factor, which in
198
INTRODUCTION TO ECOLOGICAL GENOMICS
this case is cubitus interruptus. Finally, the fourth phase of eyespot formation is the pigmentation itself, which takes place in the late pupal stage. Which developmental switches are made to produce the alternative seasonal morphs of butterflies like Bicyclus is not known precisely. Given the knowledge about eyespot formation summarized above, it is likely that the switch will involve regulation of developmental genes such as Distal-less, or one of the genes in the hedgehog signalling pathway. The involvement of ecdysteroid hormones in seasonal polyphenisms has been demonstrated for several butterfly species, so it seems reasonable to assume that the upstream part of the regulation consists of an endocrine signal, which in some way or another is sensitive to an environmental cue. Seasonal polyphenism represents a fascinating area of research where genomics, through developmental genetics, can meet ecology and evolution in a fruitful manner. Another well-known case of polyphenism is represented by the castes of many social insects (termites, ants, wasps, and bees). The bestinvestigated caste system is that of the worker/ queen polyphenism in the honey bee, Apis mellifera. Experiments have shown convincingly that the development of a larva into a worker or a queen is completely under environmental control, rather than reflecting a genetic predisposition of some larvae to follow a distinct developmental pathway. Larvae are induced to develop into queens when fed a rich mixture of food throughout development, including royal jelly, a secretion from the mandibular gland of nursing workers which contains a higher concentration of sugar than worker jelly. As a consequence, queen larvae develop faster, grow larger, and have larger corpora allata, the source of juvenile hormone, which controls the differentiation of oocyctes and the production of vitellogenic proteins by the fat body. Levels of juvenile hormone are considerably higher in queen larvae than in worker larvae, especially in the fifth instar, the stage just before pupation. Up to the fourth instar (2.5–3.5 days old) the queen developmental pathway is reversible, but after entry into the fifth stage a change of feeding regime has no further influence on the phenotype appearing
after pupation. Obviously, the alternative developmental pathways are regulated by larval nutrition, mediated by endocrine signals, which in some way are translated into gene expressions. Are the castes of honey bees characterized by specific expression signatures? In an early study, Evans and Wheeler (1999) looked at differential gene expression between queen and worker larvae of Apis mellifera using an SSH protocol (see Section 2.1.2, Fig. 2.4); this was followed later by macroarray expression profiling using 144 cDNAs from enriched libraries (Evans and Wheeler 2000, 2001). Gene expressions were compared between early fourth instar (bipotential) larvae and fifth instar larvae destined to workers or queens. Several loci were confirmed to be differentially expressed and, interestingly, many of these were downregulated in queen larvae and the data showed that workers resemble the bipotential young larvae more than queens. So the suggestion is that the worker programme is the default pathway, which must be altered actively to produce a queen programme, and this latter programme includes switching off many genes and turning on a limited set of queen genes. Fig. 5.20 provides a summary of differential gene expression in honey bee castes. Young larvae (Y in Fig 5.20) overexpressed two heat-shock proteins and several proteins related to RNA processing. Among the genes specifically upregulated in worker larvae (W) is hexamerin 2, a member of a group of hexameric storage proteins, which serve as a source of energy during metamorphosis and adult life. Such hexameres also accumulate in the haemolymph of insects preparing for diapause (Denlinger 2002). A cytochrome P450 was also upregulated consistently in workers and this was also found in another bee species, Melipona quadrifasciata (Judice et al. 2004). The expression profile of queen larvae (Q) shows overexpression of ATP synthase and cytochrome oxidase I. This is consistent with earlier work by Corona et al. (1999) who, using differential display, identified three mitochondrial proteins, mitochondrial translationiniation factor, cytochrome oxidase subunit 1, and cytochrome c, that were upregulated consistently in queen larvae compared with worker larvae.
LIFE-HISTORY PATTERNS
RNA helicase
Hsp70
RNA binding
Hsp90
Hexamerin 2
Cyto P450
FABP-BH4
Apis 52A9
Cuticle protein 2
ATP synthase
Cytochrome oxidase
199
Elongation factor 2
(a)
Dihydrodiol reductase
(b)
Bromodomain
Pyruvate dehydrogenase
(c)
Y
W
Q
Y
W
Q
Y
W
Q
Y
W
Q
Y
W
Q
Figure 5.20 Overview of 15 genes of honey bee, A. mellifera, differentially expressed between fourth instar larvae (Y; young, bipotential), and fifth instar larvae destined to become workers (W) or queens (Q). Normalized expression levels are shown, with standard errors, estimated from non-competitive hybridization of cDNA samples with a macroarray of 144 probes, derived from SSH libraries. Shown are genes with high expression in (a) young larvae, (b) worker larvae, and (c) queen larvae. After Evans and Wheeler (2000), by permission of BioMed Central.
So, these limited data suggest that the worker larvae expression profile is characterized by allocation to storage and the queen larvae profile by genes reflecting higher mitochondrial respiration. Developmental genomics of caste determination in honey bees is in its infancy. The studies conducted so far on honey bees caste determination
are limited by the relatively small number of genes analysed. The recently completed genome sequence of A. mellifera will allow a significant acceleration of expression profiling. Several EST libraries have been developed for a more detailed analysis of the honey bee transcriptome (Whitfield et al. 2002; Nunes et al. 2004). Genome-wide
200
INTRODUCTION TO ECOLOGICAL GENOMICS
analysis of honey bee castes will not only shed more light on the developmental and metabolic aspects of caste differentiation, but also on the biological basis of differential behaviours. The approaches taken in the honey bee would also be applicable to other eusocial insects, including ants, a favourite object of study in ecology. Many ant species have a more complicated system of caste differentiation and task division than honey bees; castes may include workers as well as soldiers, males, and alate (winged) females. The intriguing variety of ant social behaviours would be a very rich source of genomic discovery; however, genome-wide studies on ants have not yet been attempted.
5.4.2
Body size
Body size is one of the most important life-history traits. Even though body size does not appear explicitly in demographic tables of fertility and mortality from which fitness is estimated (see Section 5.1), it is implicated in changes of these vital rates with age, for example because increasing size allows higher fertility and often entails a lower mortality (see Fig. 5.1). The adult body size of a species is also one of the few variables that predicts successfully a large number of ecological attributes, such as metabolic rate, and energy intake and assimilation. We saw in Chapter 3 that body size was also associated with population size, which is one the main determinants of genome size according to the neutral theory of population genetics (see Fig. 3.4). Body size is also tightly linked with questions of shape and form, because physical forces have essentially different impacts on small objects compared to large objects, including cells and organisms. In his marvelous book, On Growth and Form, D’Arcy Thompson (1917) expressed it succinctly: ‘Size of body is no mere accident.’ Despite the almost universal importance of body size, its determination by physiology and genes continues to be a formidable vexing problem (Nijhout 2003b). The mechanisms that determine body size are obviously contingent on the underlying framework for regulating cell size, cell
number, and the size of organs; however, if an organism is to attain a characteristic body size (which many animals do) there must be additional mechanisms, responding to information generated all over the body. One way of looking at body size is to see it as a consequence of halting growth. The question then becomes not so much how to attain a fixed size but when to stop growing. This point of view is particularly applicable to holometabolous insects, which only grow in the larval stage and whose body size depends entirely on the mass reached just before pupation. Entomological research has shown that one of the major factors determining adult body size of insects is a threshold reached in the larval stage, the so-called critical weight. This is defined as the minimal weight above which further feeding and growth are not strictly required for successful pupation (Davidowitz et al. 2003). The strength of this concept is that it is causally linked to a series of endocrine events inducing the onset of pupation in the last larval instar. At the critical weight, the corpora allata stop producing juvenile hormone, which removes this hormone’s suppression of prothoracicotropic hormone secretion, allowing the prothoracic glands to secrete ecdysone, which then sets into motion a cascade of events leading to metamorphosis. Larval growth stops when this sequence of endocrine events culminates in a peak of ecdysteroids, at which point the larva has grown to a size above the critical threshold, depending on the time delay for induction of ecdysteroid secretion and the photoperiod. Detailed research on the tobacco hornworm, Manduca sexta (Lepidoptera, Sphingidae), has shown that additive genetic variation exists for critical weight, and this has allowed selection for adult body size in laboratory cultures. In addition, two other determinants of body size contribute to genetic variation of body size in M. sexta, prothoracicotropic hormone delay time and growth rate (D’Amico et al. 2001). From research on Drosophila we know that growth itself is influenced by signals from the insulin/IGF-1 signalling pathway (Brogiolo et al. 2001; see Section 5.2). Inspired by mammalian research, another signalling pathway has shown to be involved in the regulation of
LIFE-HISTORY PATTERNS
growth rate of Drosophila, which centers around a protein called target of rapamycin (TOR). This protein was first discovered in yeast through mutants resistant to the cytotoxic effects of the fungicide, rapamycin. TOR is part of a signalling cascade that interacts partly with insulin/IGF-1 signalling, is sensitive to amino acids in the haemolymph, and influences metabolism and growth (Britton et al. 2002; Oldham and Hafen 2003). Fig. 5.21 provides a schematic overview of the various determinants of body size in insects. The physiological evidence reviewed makes it understandable that body size is both genetically determined and plastic. Indeed, numerous experiments with insects have shown that adult body size is affected by environmental conditions, the best-studied response being the effect of temperature. Rearing temperature has a consistent effect on body size: insects grow larger at low temperature and smaller at high temperature. This trend is also present in the field: populations at higher latitude attain a larger body size than tropical populations of the same species. In D. melanogaster, the latitudinal cline of body size
Photoperiod JH
JH esterase
PTTH Critical weight
Metamorphosis
Ecdysteroids
Growth
IIS, TOR, Ras
Nutrition Figure 5.21 Tentative schematic overview of relationships involved in the determination of adult body size in insects, inspired by research on tobacco hornworm, M. sexta. Adult size is determined by cessation of larval growth before pupation, which is triggered by ecdysteroids that appear when the titre of juvenile hormone falls upon reaching the critical weight. JH, juvenile hormone; PTTH, prothoracicotropic hormone; IIS, insulin/IGF signalling pathway; TOR, target of rapamycin signalling pathway; Ras, Ras signalling pathway. Based on Nijhout (2003) and other sources.
201
has a high heritable component and is accompanied by clines of allele frequencies, starvation resistance, and chromosome inversions (De Jong and Bochdanovits 2003). One of the few genomic approaches to the problem of body-size determination is found in the work by Bochdanovits et al. (2003) and Bochdanovits and De Jong (2004). Temperate and tropical fruit fly populations, each cultured at two temperatures, were examined in the third larval stage, just before pupation, by means of transcription profiling using an oligonucleotide microarray. Genes with differential expression were identified by analysis of variance and classified as differing between populations (45 genes), differing between rearing temperatures (200 genes), and showing a population–temperature interaction (31 genes). The data showed not only that a considerable part of the genome is modulated by temperature (18% of the genes detected in all treatments), but also that a fair number of them (16%) respond to temperature in a populationdependent manner. Expression of 19 genes showed a correlation with the adult body size of the isofemale line from which the larvae were collected; 16 of these showed a positive and three a negative correlation (Fig. 5.22). Assigning functions to these genes revealed that most of them fell into the category of cell growth and maintenance. Thus the gene-expression signature of body size in Drosophila is dominated by energy metabolism and morphogenesis. Another aspect of body size in Drosophila is that it is negatively correlated with larval survivorship; genotypes with high larval plus pupal survival have a small adult size. Bochdanovits and De Jong (2004) examined whether this trade-off could be due to antagonistic pleiotropy, thereby testing the model proposed by Stearns and Magwene (2003), illustrated in Fig. 5.2. This was done by analysing correlations between gene expression and body size and sifting genes whose expression was positively correlated with body size but negatively with larval survival, or the other way around. The authors found 34 of such genes, of which 15 were low weight/high survival genes and 19 high weight/low survival genes (Table 5.4). The joint
INTRODUCTION TO ECOLOGICAL GENOMICS
cr4-27.5 cr12-27.5 cr109-27.5 cr210-27.5 cr203-17.5 cr210-17.5 w27-27.5 cr12-17.5 w5-27.5 w25-27.5 cr4-17.5 w14-27.5 w29-17.5 cr109-17.5 w14-17.5 w5-17.5 w27-17.5 w25-17.5
202
Ann IX CG 10992 Alkaline phosphatase CG 13451 Mst84Da CG 9034 Sec61 gamma Sec61 beta ATP synthase-b CG 18316 eIF-4G dap eff nuf scb (scab) CG 6961 CG 30086 CG 3036 Talin Figure 5.22 Heat diagram of gene expression and cluster analysis of 19 genes in larval D. melanogaster, assayed using oligonucleotide microarray hybridization. The experiments were done with two populations, each reared at two temperatures. A total of 1134 genes were detected in all treatment groups; 19 of these showed a correlation with adult body size of the isofemale line and are displayed here. The individuals listed along the top are coded according to population (cr, tropical; w, temperate) and rearing temperature (17.5 and 27.5 C). The list on the right provides the identifiers of the genes according to FlyBase. Strength of expression is indicated by the darkness of the square; the darker the square, the stronger the expression. From Bochdanovits et al. (2003) by permission of Oxford University Press.
expression of these genes explained 86% of the trade-off. The analysis of Bochdanovits and De Jong (2004) illustrates that trade-offs between life-history traits may indeed be due to genes with pleiotropic effects, but how these genes may exert such effects on the phenotype is far from clear. Among the ‘trade-off genes’ listed in Table 5.4, particular interest is raised by the Ras protein CG9611. Ras proteins are part of the Ras/mitogen-activated protein kinase (MAPK) signalling pathway, which like the insulin/IGF-1 signalling and TOR pathways transduces signals from extracellular growth factors (in this case the so-called epidermal growth factor, EGF) into metabolic action in the cell (see
Fig. 6.3). The Ras/MAPK pathway is known for its role in regulating cell growth, cell proliferation, and survival. The repeated occurrence of genes from signalling pathways involved in transducing nutritional and growth factor information into cellular metabolism is probably indicative of a crucial role of these pathways in the regulation of life-history traits and possible trade-offs among them.
5.4.3
Shade avoidance
The last plastic life-history trait to be discussed concerns the remarkable flexibility seen in plant growth when exposed to different light intensities
LIFE-HISTORY PATTERNS
203
Table 5.4 Genes of D. melanogaster whose expression showed opposite signs of correlation with male body size and pre-adult survival Name or identifier (FlyBase)
Molecular function
Biological function
Low-weight/high-survival genes Lep1 CAH1 CG10622 CG7834 CG8145
Larval cuticle protein Carbonic anhydrase I Succinate-CoA ligase Electron-transport flavoprotein Nucleic acid binding
Structural integrity of larval cuticle Energy metabolism Carbohydrate metabolism Mitochondrial respiration Cell proliferation
High-weight/low-survival genes Smt3 CG14957 Arf51F CG3164 CG9611 Est-P CG3843 ImpE2 CG5171 CG33317
Ubiquitin-like protein Protein involved in mRNA splicing ADP ribosylation factor 51F ABC transporter Protein of Ras signalling pathway Esterase P Ribosomal protein L10A Ecdysone-inducible gene E2 Trehalose phosphatase Similar to RNA-binding protein
Cell growth and maintenance Cell growth and maintenance Cell growth and maintenance Nucleotide binding and transport Signal transduction Signal transduction Protein synthesis Imaginal disc morphogenesis Carbohydrate metabolism Unclear; incomplete sequence
Notes: In total 34 genes were found whose expression had a correlation falling into opposite tails (3.5 percentiles) of the correlation coefficient distributions; however, only 14 could be assigned a function and are listed here. Source: From Bochdanovits and De Jong (2004), by permission of the Royal Society.
or light spectra. Part of this flexibility can be understood as a mechanism to avoid shade and therefore this type of phenotypic plasticity is known as the shade-avoidance syndrome. Shade avoidance is observed when plants are exposed to low ratios of red to far-red light, such as would prevail during growth under a closed canopy. The response involves suppression of branching, emphasis on vertical elongation, and early flowering. This is assumed to contribute to plant fitness, since it allows completion of the life cycle and seed set before being overgrown by competitors. Plants have three groups of light-sensitive molecules that translate aspects of the light regime into metabolic action: phototropins, cryptochromes, and phytochromes (Chen et al. 2004). Phototropins are sensitive to UV-A and blue light; they are involved in the well-known phototropic responses of plants (roots grow away from light, stems bend towards light), and also in regulating chloroplast movements and stomatal opening. Cryptochromes are also sensitive to UV-A and blue light and are
involved in de-etiolation (the transition of darkgrown seedlings to phototrophically competent plants), photoperiod-dependent induction of flowering, and entrainment of the circadian oscillator. Phytochromes are sensitive to red and far-red light and are involved in seed germination and shade avoidance. Many of the lightdependent responses of plants are modulated by networks involving both cryptochromes and phytochromes (see the discussion of flowering time in Section 5.3), but the shade-avoidance response is regulated only by phytochromes and this is the reason for discussing them in a little more detail here. There are five different phytochrome genes in Arabidopsis, designated PHYA to PHYE. Similar families of phytochromes are known in species throughout the plant kingdom, from algae to angiosperms. The proteins encoded by these genes differ in their spectral properties and the rates of conversion between active and inactive states; consequently they have different physiological
204
INTRODUCTION TO ECOLOGICAL GENOMICS
roles. Mutants of Arabidopsis defective in one of the phytochrome genes have confirmed this differentiation of function. PHYB plays a predominant role in the shade-avoidance response, with redundant action of PHYD and PHYE (Schlichting and Smith 2002). How can phytochromes translate light signals into gene expression? A large amount of detailed knowledge is available on the first steps in this process (Chen et al. 2004; Schepens et al. 2004). The light-interception component of the system is not the phytochrome itself, but a chromophore called phytochromobilin. The role of this chromophore is similar to the role of retinal bound to proteorhodopsin, as discussed in Section 4.4: it triggers a state transition of the main molecule. The phytochrome protein may undergo a conversion between two relatively stable states: a red-light-absorbing Pr form and a far-red-absorbing Pfr form. The Pfr form is assumed to be the active configuration. Phytochromes are present as dimeric molecules in the cytoplasm. When at least one of the units is
activated to the Pfr form, the molecule as a whole can be imported into the nucleus (Fig. 5.23). In the nucleus, phytochromes are localized in so-called nuclear bodies. In general, nuclear bodies, also called speckles, are considered subcompartments of the nucleus that carry out specific functions, such as mRNA splicing. The nature of the nuclear bodies recruiting activated phytochromes is unknown. They seem to represent structures by which phytochromes can transfer a signal to transcription activators. Both subunits of the phytochrome must be in their active form before localization in these bodies can occur. Expression of a large number of genes is triggered by phytochromes. Transcription profiling using microarrays applied to Arabidopsis mutants defective in one of the phytochrome genes have revealed the genome-wide nature of the phytochrome signalling pathway (Ma et al. 2001; Quail 2002; Wang et al. 2002; Devlin et al. 2003). The first targets seem to be transcription factors, since these genes respond within 1 h of the light signal.
PrPr R
FR D.R.
R
Nuclear FR D.R. import
Nuclear bodies
PfrPr ?
PfrPfr
Cytoplasm
Nuclear-body compartmentalization
Nucleus
Figure 5.23 Relocalization of phytochromes in the cell, using PHYB as a model. Interception of red light by a chromophore attached to PHYB leads to activation of one or two of the subunits of the dimeric molecule (transition from Pr to Pfr). The activated molecule may be imported into the nucleus where it is compartmentalized into nuclear bodies. Localization into nuclear bodies is necessary for triggering gene expression. The PfrPfr form is incorporated preferentially into nuclear bodies over the PfrPr form. D.R., dark reversion (slow spontaneous decay of Pfr to Pr in the dark); R, red light; FR, far-red light. After Chen et al. (2004), reproduced with permission from Annual Reviews.
LIFE-HISTORY PATTERNS
Presumably, many of the other expression changes are downstream targets of transcription factors. No less than 26 different cellular pathways were found to be regulated by phytochrome signalling—some suppressed, others promoted— in a co-ordinated fashion (Ma et al. 2001). Devlin et al. (2003) proposed seven functional categories for the genes differentially regulated by shade in Arabidopsis. Genes related to photosynthesis, fatty acid metabolism, and redox metabolism were mostly downregulated. Genes acting upon the cell wall, including pectinesterases and pectate lyases, were mostly upregulated; these genes support loosening of the cell wall. Genes regulated by the plant growth hormone auxin made up a large proportion of the upregulated genes. These switches in the transcriptome are all understandable in light of the pronounced elongated growth and accelerated flowering shown by the shade-avoidance phenotype. Several studies have demonstrated the importance of plant hormones (auxins and gibberellins) in regulating the shade-avoidance growth response. A role of the volatile plant hormone ethylene is also suggested. In a study on tobacco, Pierik et al. (2004) showed that ethylene-insensitive plants had a reduced response to shade. The effect of ethylene requires GA because plants with inhibited GA production showed hardly any ethylene-dependent response to shading. The study of phytochrome-mediated shade avoidance, although far from complete, demonstrates that it is possible, in principle, to explain the process of phenotypic plasticity in terms of gene expression regulated by environmental signals (Schlichting and Smith 2002). With sufficient sophisticated knowledge of the signalling pathways and the expression programmes they trigger, it would be possible to account for the widely different plant phenotypes that may develop from the same genotype. On the other hand, in considering the large number of genes involved and the way their expression is organized into networks, rather than in linear causal chains, this could turn out to be an extremely difficult task. With this open-ended challenge we close our discussion of phenotypic plasticity.
205
5.5 Genomic approaches to life-history patterns: an appraisal Genomic analyses of life histories, as reviewed in this chapter, have revealed a number of molecular principles underlying regulation and determination of key life-history events. These can be summarized as follows. Environmental information (food, crowding, light, daylength, temperature) often modulates lifehistory traits and this is the basis of phenotypic plasticity. In animals, such information is typically processed by the nervous system, then translated into a hormonal signal, which acts upon signalling pathways to steer gene expressions in target cells. Signalling pathways consist of a membrane-bound extracellular receptor, connected to an intracellular system of kinases, able to trigger a cascade of biochemical events, finally leading to activation of a transcription factor, which then triggers gene expression. The involvement of the insulin signalling pathway in regulating growth, reproduction, and longevity is a prime example of this principle, but also the induction of insect diapause and the developmental switches in polyphenisms act similarly. In plants, phytochromes play a major role in the translation of light signals. Second, we may note that if an organism has the capacity to follow more than one developmental option, for example a dormancy stage in addition to an active stage, or flowering in addition to vegetative growth, the alternative pathway is often constitutively present throughout life but repressed until an environmental cue triggers its appearance. The execution of the alternative programme then becomes a question of simply removing a repression, rather than staging the whole programme anew. So-called resting stages (e.g. diapause) are not quiescent at all from a molecular point of view. Despite the fact that many genes are downregulated during diapause, the entry, maintenance, and exit of diapause involves active upregulation of several other genes. We have seen indications of such ‘hidden’ developmental programmes in nematodes (the dauer larva programme) and in Arabidopsis (the floral transition). Interestingly, mutations in
206
INTRODUCTION TO ECOLOGICAL GENOMICS
C. elegans show that it is possible to uncouple part of this programme (life extension) from the main pathway leading to dauer formation, and thus to confer increased longevity to the non-dauer adult. Third, we have seen that expression of life-history traits often comes with intricate mechanisms of regulation that go further than simple transcriptional regulation. We have seen four examples of this: alternative splicing, gene silencing, RNAi, and post-translational regulation of protein stability. Alternative splicing was seen in a Drosophila study showing that different splice variants of the same gene are expressed in different life-history stages, and in Arabidopsis, where one of the loci for flowering induction is suppressed by a feedback loop promoting an inactive splice variant of the gene. Alternative splicing seems to be a mechanism by which gene expression can be fine-tuned in time (developmental stage) or space (specific tissues). The second type of non-transcriptional regulation, gene silencing, was observed in the vernalization response of Arabidopsis, where histone deacetylation is employed to suppress floral suppression and allow bolting. Gene silencing was also involved in mutations conferring lifespan extension in yeast, nematodes, and fruit flies. Such epigenetic regulation seems to act as a memory of environmental events, which can trigger an adequate response in cells that do not witness the event themselves but are imprinted by their mother cell. The third type of non-transcriptional regulation is RNAi. Both microRNAs (implicated in the photoperiodic pathway of the Arabidopsis floral transition) and RNA-binding proteins (in the autonomous pathway) have been discussed above as means to selectively inhibit mRNAs. Finally, post-translational regulation was noted in the light-dependent stabilization of CONSTANS protein by phytochromes and crytochromes in the photoperiodic pathway regulating flowering time in Arabidopsis. The fourth molecular principle illustrated in this chapter is that life-history traits are underpinned by a complex network of gene expression and feedback loops. Networks are characterized by upstream and downstream functional units. In the upstream part, a simple trigger may act upon a
signalling pathway. If such upstream genes are mutated, this often has very large effects on the phenotype and may introduce a syndrome of correlated altered life-history traits (see the daf-2 mutants of C. elegans). Downstream of the network we often see a host of gene expressions, which are triggered by a limited number of transcription factors, acting upon all genes sharing a certain motif in their promoter. An obvious example of a downstream gene-expression cascade was the microarray analysis of longevity in C. elegans, in which a large number of genes upregulated as well as downregulated by the transcription factor DAF-16 were identified. Another characteristic of a network is the principle of convergence, which holds that different pathways are integrated by acting (some positively, some negatively) on a single integrator gene. The floral repressor FLC, which integrates the autonomous and the vernalization pathway in A. thaliana, is a clear example of this. A third property of networks is redundancy or parallelism. This is especially obvious in organisms with duplicated genomes, where more than one copy of the same gene exists and mutants do not have recognizable phenotypes due to another copy of the gene performing a similar ¨ TZE function. The recent discovery of SCHLAFMU and SCHNARCHZAPFEN in the photoperiodic pathway of Arabidopsis floral transition is a clear example of this. A final molecular lesson from the examples given in this chapter concerns the extrapolation of genomic information across species. As discussed in Chapter 3, comparative genomics has developed a whole gamut of instruments by which fine- and coarse-scaled comparisons of genomic sequences are made. In this chapter we have seen one example, the photoperiodic response of Arabidopsis and rice, where the genes themselves were conserved between species, but regulated in a different way, with the consequence that Arabidopsis flowering is stimulated by long days and rice flowering is stimulated by short days. If this principle of similar structure but different function in related species is common, homology of coding sequences is insufficient for extrapolating across species; rather, the basis for extrapolation should lie in
LIFE-HISTORY PATTERNS
functional comparative genomics. A similar disparity between the transcriptome and the genome was presented as an example in Chapter 1, when gene expression in different organs of H. sapiens and Pan troglodytes was compared (Fig. 1.7). In the present chapter we have seen that the first methodologies to analyse transcriptional profiles shared across species are now being developed. Is ecological genomics about to make a major contribution to life-history theory? Obviously the genomics revolution has already intruded into the analysis of life histories, but we see four major limitations. In the first place, the outcomes of microarray studies published so far sometimes differ widely between similar studies. This is especially obvious from the appallingly small overlap of genes reported in different studies to be regulated by age in Drosophila. Maybe what is lacking here is is a good definition of the conditions under which test animals are cultured or exposed. Animal physiologists know that physiological responses of animals are influenced by many environmental factors, some of them difficult to standardize, such as food quality, air humidity, microbial infection, pheromones from conspecifics, etc. Consequently, a genome-wide gene-expression profile may partly reflect such non-standardized aspects of the test organism. Only replication across studies and robust statistical analysis can reveal the universal responses among the ones that are just contingent on specific experimental conditions. A second limitation is that most of the studies conducted to date have focused on a few genetic model species. Although some generalities have been indicated in the sections above, the regulation of aging though the insulin/IGF-1 signalling pathway being a case in point, most of the work is concentrated on C. elegans, Drosophila, and Arabidopsis, species that represent only a tiny fraction of the array of life histories in nature.
207
Broadening the comparative basis will surely benefit a further integration of life-history theory and ecological genomics. A third limitation is the focus on laboratory observation. Because any life history, especially mortality, has an important component external to the organism (predation, microbial infection, competition, spatial heterogeneity), which is difficult to mimic in the laboratory, the relevance of geneexpression profiles and mutants only observed in the laboratory can be doubted. An example illustrating this argument is a study by Weinig et al. (2002), who demonstrated several QTLs for flowering time in Arabidopsis that are only expressed under certain field conditions and thus not found in laboratory mutants. A good strategy for ecological genomics may be to exploit the natural variation of genomic programmes in wild organisms and then to work out mutations and expression profiles relating to these ‘eco-variable’ loci. Finally, we note that many gene-expression studies have not yet left the descriptive stage. It is one step to draw up an inventory of transcriptional profiles associated with some life-history event, but quite another to explain the causal relationship between these profiles and the life history. Only in the cases of longevity in C. elegans and flowering time in Arabidopsis is such an understanding coming within reach. Despite these limitations we see a glorious future for a further merger between ecological genomics and life-history theory. This will involve establishing a link between crucial phenotypic phenomena, such as trade-off and plasticity on the one hand and gene expression, pleiotropy, and molecular signalling on the other. We expect that such bifaceted discussion about fundamental concepts of life-history theory will contribute to a smooth transition between evolutionary explanation, the underlying physiology, and molecular genetics.
CHAPTER 6
Stress responses
Stress is a fundamental aspect of life and a major aspect of natural selection in the wild. Ecologists have studied the responses of plants and animals to environmental stress factors since the 1960s. Previously known as physiological ecology or ecophysiology these studies are now often called stress ecology. The study of stress responses on the genomic level has produced new insights into the mechanisms that enable plants and animals to survive in harsh environments and that limit the distribution of species. Biochemical studies have shown that, on the cellular level, there is surprising degree of uniformity in the stress responses of different species, even to widely different environmental stress factors. Genomic studies have reinforced this idea while at the same time providing new insights into the coherence of the cellular stress response. Stress is evoked in an organism at the edges of its ecological niche. The extent to which the organism is able to deal with such stresses determines the limits of its ecological amplitude. There is therefore a logical link between genomic analysis of the stress response and the ecology of the species. In this chapter we aim to introduce the reader to the ecological genomics of stress analysis.
6.1
Stress and the ecological niche
Even the most casual observer of natural systems will note that many species tend to occupy a characteristic place in nature. The idea is demonstrated most vividly by gradient studies, for example the distribution of plants on a salt marsh, where each species tends to be limited to a certain zone by a combination of soil texture, redox 208
potential, salt, and lime. Ecologists have invented the concept of an ecological niche to organize their thoughts about the ways in which organisms fit into their environment. The inception of this concept in the ecological literature is attributed to the American ornithologist Joseph Grinnell with his now classical paper on the California thrasher published in 1917, but the most widely used and influential elaboration of the niche concept is due to Hutchinson (1957). Hutchinson defined the niche in terms of any number of conditions and resources that limit the distribution of a species. The niche was pictured as an n-dimensional hypervolume that envelops those values of continuously varying environmental factors that allow long-term survival of the species. As an illustration of the Hutchinsonian niche concept we reproduce a two-dimensional picture of fitness in the collembolan Folsomia candida as a function of zinc exposure and food density (Fig. 6.1; Noe¨l et al. in press). Hutchinson (1957) realized that a distinction should be made between the fundamental niche, which comprises all the conditions under which a species potentially may occur, and the realized niche, which is usually more narrow than the fundamental niche due to competition in the field. The fundamental niche is observed in laboratory experiments and in the field when competitors are absent. At the edges of its fundamental niche a species is less well equipped to face competition with others and so when competition is important, it will give away at the edges and occupy a smaller section of the gradient, the realized niche. The formal definitions of the ecological niche by Hutchinson (1957) have spurred a great variety of
Population density per microcosm, log scale
STRESS RESPONSES
209
–0.1 100
0.0
K 0.1
50
0.2 0.3
20
DD 0.4
10 0.5 5
H
T
A 2 50
100
200
500
1000
2000
5000
Zinc concentration (µg/g, log scale) Figure 6.1 Graph illustrating the niche concept in two dimensions. Contours of population growth rate of the soil-dwelling collembolan Folsomia candida are plotted as a function of dietary zinc concentration and initial population density per microcosm (reflecting food density). Four different ranges of effect are indicated. At high exposure levels zinc becomes toxic and suppresses fitness (T); with increasing population size fitness decreases due to crowding (DD, inverse density dependence; K, carrying capacity); at low exposure levels zinc supports fitness by a stimulatory effect on growth, a phenomenon known as hormesis (H); at low food density fitness decreases due to absence of inter-individual communication stimulating consumption (Allee effect; A). Courtesy of H. Noe¨l and R.M. Sibly, University of Reading.
studies aiming to explain community structure in the wild from the properties of individual species and their responses to environmental factors. The ecological niche concept touches the very heart of ecology—the relationship between species and their environment—but this has not prevented the proliferation of a great deal of confusion in the literature. Several reviews have pointed out the historical context of this confusion, which is partly due to independent elaboration by Joseph Grinnell and Charles Elton (Chase and Leibold 2003). On the one hand the concept emphasizes the requirements of species, but on the other hand it includes the species’ role or impact on its environment. This Janus-faced property of the niche has caused such confusion that some ecologists in the 1970s have suggested to avoid the term niche altogether. However, Chase and Leibold (2003) revisited the concept and after clearing the decks set the stage for a new synthetic approach, framed by the recent developments of ecology. Their new,
synthetic, definition of ecological niche runs as follows. The joint description of the environmental conditions that allow a species to satisfy its minimum requirements so that the birth rate of a local population is equal to or greater than its death rate, along with the set of per capita effects of that species on these environmental conditions.
This definition joins the two components of the niche mentioned above, and it recognizes that whenever resources and environmental conditions are altered by the organisms themselves, as in the case of predators depleting their prey or ecological engineers altering the physical structure of their environment, this aspect should be included in the niche concept. The definition by Chase and Leibold (2003) also recognizes that the difference between mortality and natality, in other words fitness, is the ultimate measure in which the requirements of the organism are to be expressed.
INTRODUCTION TO ECOLOGICAL GENOMICS
The niche concept has been highly instrumental in community ecology, as it allows explanations of community structure from the point of view of the placing of species along a gradient of resources or conditions according to their ecological niche. Various competition models have been derived that predict how niche overlap between species is minimized by competition and the maximum overlap between the niches of two adjacent species that will allow coexistence of both. However, less attention has been paid to the question of how the niche itself is shaped by underlying determinants founded in the physiology of the species. The science of environmental physiology, also called ecophysiology or physiological ecology, addresses these aspects. Several physiology textbooks have been written that reach out to ecology, including that by Larcher (2003) on plants, and that by Schmidt-Nielsen (1997) on animals. In this chapter we likewise aim to explore the reductionist path, from niche to genomics. Environmental physiology has a strong focus on studies of stress. The reason for this bias is that the regulatory mechanisms allowing homeostasis of the milieu interne are best seen when these mechanisms are put to the test by pushing the organism to the borders of its ecological niche. This is how we will approach the issue in this chapter; by studying responses at the edges of the ecological niche we aim to reveal the regulatory mechanisms that promote fitness both within and outside the niche. Like the niche, the concept of stress has a long and confusing semantic history in ecology. Some authors have argued that ecological stress should be defined by analogy to the physical concept of stress, which would imply that it is an external constraining or impelling force applied to an ecological system. Most biologists, however, consider stress as an internal state, brought about by a hostile environment or negative social interaction. Nowadays, there seems to be agreement on the fact that a distinction should be made between a stressor (an external factor), the stress (an internal state brought about by a stressor), and the stress response (a cascade of internal changes triggered by stress). Although the concept of stress can be defined at
various levels of ecological integration, stress is most commonly studied in the context of individual organisms, whereas stress responses are studied on the cellular, biochemical, and genomic levels. We need to realize that the concept of stress is not absolute; it can only be defined with reference to the normal range of ecological function; that is, with reference to the ecological amplitude or ecological niche of the species. What is an extremely stressful condition for one organism (e.g. the absence of free air) is quite normal for another organism (a fish). A definition of ecological stress that incorporates this idea runs as follows (Van Straalen 2003). Ecological stress is a condition evoked in an organism by one or more environmental factors that bring the organism near to or over the edges of its fundamental ecological niche.
This definition complies with the common physiological usage of the term, which is that stress is an internal condition, not an external factor. In addition, stress has the following properties: (i) it is usually transient, (ii) it involves a syndrome of specific physiological responses, and (iii) it is accompanied by the induction of mechanisms that counteract its consequences. Our niche-based definition of stress is illustrated schematically in Fig. 6.2. Performance
210
C Ecological niche
B
Stress A 2
Environmental factor
Figure 6.2 Graph illustrating a definition of stress based upon the ecological niche of a species. Ecological stress arises when the intensity of an environmental factor increases from 1 to 2 in such a way that in position 2 the organism is placed outside the niche (A). This will evoke stress and stress-response reactions, which fade away when the environmental factor relaxes and the organism returns to its niche (B). Another type of response is to move the border of the niche (C) by genetic adaptation in such a way that position 2 is not experienced as stress anymore. Reproduced from Van Straalen (2003), with permission from the American Chemical Society.
STRESS RESPONSES
The stress response can take different forms, depending on the timescale. Calow (1989) distinguished two main types, proximate and ultimate responses. The proximate response implies induction of physiological, biochemical, and genomic mechanisms (physiological adaptation) that allow survival while the stress prevails. Such mechanisms cannot be maintained forever without consequences for normal cell function and so a return to the niche is necessary for long-term maintenance of fitness. The ultimate response implies that genotypes with a greater than average innate capacity to resist the stress are favoured and replace the ones with lower resistance in the next generation. Then, after some generations, the whole population consists of resistant genotypes (genetic adaptation). The boundaries of the niche have been shifted to include the organism’s new position, and what was stress before is not stress anymore (Fig. 6.2). The existence of genetic adaptation makes us realize that the ecological niche is not a property of a species as a whole, but may show variation between populations of a single species. In that case, a species with wide ecological amplitude (a euryoecious species) may consist of several local populations, each with narrow amplitude (stenoecious populations). Consequently, what is experienced as stress for one population is normal for another population of the same species. Such genetically determined polymorphisms in response to stress have been investigated often in evolutionary ecology and provide some fascinating examples of microevolution in real time, such as pesticide resistance in insects and metal tolerance in plants. In addition, stress may lower the threshold for expression of traits and so increase phenotypic variation and accelerate evolution (Hoffmann and Hercus 2000). In our discussion of stress responses we will emphasize conditions more than resources. Resources are environmental factors that can be consumed and belong to the impact component of the ecological niche. Conditions are factors in the habitat, such as temperature, humidity, osmotic value, and oxygen tension, that are not consumed and can be altered only slightly by the organism. They can be plotted along an axis, as in Fig. 6.2,
211
and the ecological amplitude of the species can be marked by values that depend on the species’ physiology. We must add that our niche-based definition of stress does not encompass all stress phenomena. For example, stress may arise in animals upon sight of a predator, or when being chased away by a group member, or when witnessing an overwhelming natural event. These kinds of stress are difficult to relate to the concept of ecological niche, but many aspects of the internal state evoked by social and mental factors are similar to the ones imposed by a harsh environment. A considerable number of functional genomic studies have been conducted with model organisms under stress. Due to the early availability of a full genomic microarray a lot of work has been done on yeast, which has developed into a classical model for the study of stress responses. There are also a fair number of genomic studies on stress responses in Drosophila and Arabidopsis. As in previous chapters, we will discuss the studies on models even when taken out of the context of their ecology, to illustrate the principles. From there we will try to draw conclusions about the relationship between stress and the ecological niche, which may hold equally for other species.
6.2 The main defence mechanisms against cellular stress All organisms must deploy stress-defence systems with more or less specific tasks to cope with disturbances and restore normal physiological conditions after disturbance. These mechanisms are found in any cell and several systems are conserved throughout life, from prokaryotes to eukaryotes. The widespread occurrence of stress-defence mechanisms indicates that already very early in the evolution of life the defence against disturbances was a crucial problem to solve. Stress defence is thus closely linked to the idea of homeostasis, the tendency to regulate the internal state at a level independent from the changeable environment. Some systems that evolved in the early days of life have maintained their tasks mostly unchanged throughout evolution. We have already glimpsed some stress-defence systems in Chapter 5, when
212
INTRODUCTION TO ECOLOGICAL GENOMICS
discussing the issue of longevity. It was noted then that upregulated stress defence in the wide sense is one of the most obvious signatures of a long life. In this section we will discuss the various stressdefence systems in more detail. Korsloot et al. (2004) reviewed the cellular stressdefence responses with an emphasis on arthropods. In the book, the authors distinguished five different systems: (i) basal signal transduction systems, (ii) stress proteins, (iii) the oxidative stress response, (iv) metallothionein and associated systems, and (v) mixed-function oxygenase. It was also noted that there are many crosslinks between the different stress-defence systems. These crosslinks help to coordinate the cellular response, which is needed to maintain integrity. In addition, many genes of the stress-defence system have promoters responding to more than one challenge. For example, the metallothionein promoter has metal-responsive elements enabling induction by metal stress, but it also has antioxidant-responsive elements and steroid hormone receptor-binding sites. Korsloot et al. (2004) even went one step further and argued that the different systems cooperate as a single, integrated, cellular stress-defence system. In the course of this chapter, we will meet genomic evidence that this may indeed be the case. However, before presenting the genome-wide profiling studies we will shortly discuss the five bestinvestigated systems separately. Later sections will show that these five are by no means the only stressresponsive systems in the cell, but they serve to illustrate the most important principles of how stress-induced gene expression is brought about. A theme common to all stress-induced gene expression is that stress signals converge on the activation of transcription factors, which bind to specific DNA sequences in the promoters of stressinduced genes. More generally these factors are called trans-acting factors and the DNA sequences to which they bind are cis-regulatory elements. It is of considerable interest to know which sequences may act as transcription factor-binding sites and which genes have promoters with these sequences. Screening of the 5 0 region of a gene and identification of potential binding sites for transcription factors can help considerably to understand the
biochemical context and the function of a gene. Conversely, when groups of genes are up- or downregulated in concert, and the same transcription factor-binding site appears in their promoters, this may indicate that they are regulated by the same transcription factor. One can never be sure, however, that a certain sequence, even if it conforms to a cis-regulatory element consensus sequence, is acting as a transcription factorbinding site in vivo, because transcriptional regulation is an extremely complicated process and is very much context-dependent (Wray et al. 2003). TRANSFACÒ is a database on eukaryotic transcription factors, their genomic binding sites, and their DNA-binding profiles (www.generegulation.com/pub/databases.html). An overview of consensus sequences of transcription factorbinding sites appearing in this chapter is given in Table 6.1. The scientific literature on cellular stress covers an extensive territory of biochemistry. It would be a hopeless task to try and cover all this ground here; instead we aim to present those aspects of stress-defence mechanisms that we think are necessary to understand the genomic studies on stress responses in an ecological context. We pay special attention to the pathways by which stress is translated into gene expression.
6.2.1 Stress-activated protein kinase signalling pathways The principle of a signal transduction pathway was introduced in Chapter 5. An extensively discussed system in that chapter was the insulin/IGF receptor, which proved to be associated with the regulation of longevity in various animals. The insulin-signalling pathway relays a hormonal signal into a cellular response, via a cascade of molecular interactions, eventually leading to inactivation of a transcription factor. We saw the same principle in the TOR and Ras pathways acting upon body size in insects and in the phytochrome signalling pathway regulating shade avoidance in plants. The principle of signal transduction is also employed in one of the most elaborate stress-responsive systems, the mitogen-activated
STRESS RESPONSES
213
Table 6.1 Overview of stress-related transcription factors and consensus sequences of their DNA binding sites (http:www.gene-regulation.com/ pub/databases.html) Transcription factor
DNA-binding site
Consensus sequence (5 0 ! 3 0 )
Context
Activator protein 1 (AP-1)
AP-1-binding element Heat-shock-responsive element (HSE) Antioxidant-responsive element (ARE), electrophileresponsive element (EpRE) Metal-responsive element (MRE)
TGA(C/G)T(A/C)A
TGC(A/G)CNC
General stress response Heat shock, general stress response Induction of antioxidant enzymes and ROS-scavenging systems Induction of metallothionein
Heat-shock factor (HSF) Nuclear factor erythroid 2-related factor 2 (Nrf2) Metal-responsive-elementbinding transcription factor (MTF-1) Aryl hydrocarbon receptor (AhR)
NGAANNGAANNG AAN TGACNNNGC
Xenobiotic-responsive element (XRE), dioxin-responsive element (DRE), aryl hydrocarbon-responsive element (AhRE) Centromere DNA element 1 (CDE1)
TGCGTGAGAAGA (human, mouse, rat, guinea pig)
Induction phase I and II biotransformation enzymes
(A/G)TCAC(A/G)T G (yeast)
Msn2p, Msn4p
Stress-response element (STRE)
GATGACGTGT (Msn4) (yeast)
DREB family transcription factors Abscisic acid-responsive element binding factor (ABF) Hypoxia-inducible factor (HIF-1)
Dehydration-responsive element (DRE) Abscisic acid-responsive element (ABRE) Hypoxia responsive element (HRE)
CCGAC
Regulation of sulphur amino acid biosynthesis pathway, induced by exposure to heavy metals General stress defence and carbohydrate homeostasis in yeast Induction of defence against cold and drought in plants Water stress signalling in plants
Oestrogen receptor (ER-a)
Oestrogen-responsive element (ERE)
Centromere-binding factor 1 (CBF1)
(C/T)ACGTGGC TACGTGCT (human) AGGTCANNNTGA CCT (human, mouse, cattle, clawed frog, chicken)
Metabolic switches related to hypoxia Activation of processes related to oogenesis and other female functions
Notes: In some cases more than one name is given to the same factor or binding site. Some consensus sequences are specific to certain groups of organisms (where indicated). N, any nucleotide; ROS, reactive oxygen species.
protein kinase pathway (MAPK pathway; Chang and Karin 2001). The name MAPK derives from the action of mitogens, chemical substances that stimulate cell division and often have a tumour-promoting action. Several secondary metabolites from plants are notorious mitogens, the best known being phorbol esters from the family Euphorbiaceae (spurges), such as the tropical plant Croton tiglium. The mitogenic action of phorbol esters is due to their activation of the MAPK pathway; some of them are used as model compounds in studies of
cell biology. It became clear later that MAPK is also involved in transducing stress signals. The classical MAPK pathway is activated by binding of an extracellular signal molecule such as a mitogen to a receptor protein on the cell membrane (Fig. 6.3). In addition to mitogens, MAPK is sensitive to cytokines, hormones, and a variety of other molecules. These substances activate a receptor tyrosine kinase (RTK), a molecule with an extracellular part to which the signalling molecule can bind, and an intracellular domain with kinase activity. When the extracellular
214
INTRODUCTION TO ECOLOGICAL GENOMICS
Stress
Growth factors
MAP4K
PAK ?
Rac GTP
?
?
MAP3K
PLC
Src
JAK ?
MEKK5
Ras 14-3-3
PKC
Sos GTP P Grb2 ?
Y
P
PI3K Raf-1
STAT
B-Raf Mos
MAPKK
MEK5
MKK3/4
AKT
JUNKK SEK
MAPKK (MEK)
S6K
MAPK
ERK5
HOG (p38)
MAPK (ERK)
JNK (SAPK)5 Cytosolic targets
MAPKAP
MAPKAP kinase 2
p90nk
ATF2 Jun
GSK-3
Fos Nuclear targets
Elk
Figure 6.3 Scheme of the mammalian MAPK signalling pathway, illustrating the great complexity of reactions. The figure shows a portion of a cell with the plasma and nuclear membranes. The classical pathway (on the right) starts with binding of a growth factor to an extracellular receptor (Y, receptor tyrosine kinase), leading to three successive waves of kinase activity (MAP3K, MAPKK, MAPK) and activation of MAPKAPs. When activated, several of the downstream kinases can translocate to the nucleus and trigger transcriptional regulation of a variety of genes. Kinases can also influence cytoplasmic targets and contribute to translational control. Parts of the MAPK pathway are activated by stress signals (on the left), but the cascade of events is less well known than that triggered by cell growth factors. ATF, activating transcription factor; GSK, glycogen synthase kinase; JAK, Janus kinase; PAK, p21-activated kinase; PI3K, phosphoinositide 3-kinase; PKC, protein kinase C; PLC, phospholipase C; S6K, ribosomal protein S6 kinase; SEK, SAPK kinase; STAT, signal transducer and activator of transcription. Ó Sigma–Aldrich Co.
receptor is occupied, a conformational change is imposed upon the intracellular domain, which then becomes an attractive binding site for adapter proteins, and their binding triggers further molecular reactions. The cascade of reactions following on RTK activation is extremely complex. More than 100 different proteins have been described to participate in the MAPK network; many of them are kinases, enzymes that activate other proteins by phosphorylating amino acids critical for the threedimensional structure, resulting in activation or
inactivation of the target. The MAPK cascade involves three successive tiers of kinase activity, which—from downstream to upstream—are designated MAPK, MAPK kinase (MAPKK, MKK, or MEK), and MAPKK kinase (MAPKKK, MAP3K, MEK kinase, or MEKK). The upstream proteins associated with binding to RTK and activation of MAP3K are sometimes called MAP4K (Fig. 6.3). Downstream of the three-tiered cascade, MAP kinases activate effector kinases, also called MAPKactivated proteins (MAPKAPs).
STRESS RESPONSES
One way in which the MAPK proteins, and the effector kinases activated by them, exert their action is by translocation to the nucleus. An example is a kinase called extracellular signalregulated kinase (ERK), which when activated can pass through the nuclear envelope and there activate transcription factors. Important targets for ERK are c-Jun and c-Fos, which are components of the dimeric transcription factor activator protein 1 (AP-1), a protein which turns up as a downstream effector in various stress responses. The combination of two different proteins to a single active unity is called heterodimerization. Many of the transcription factors activated by MAPK are dimeric proteins, which only become active by combining the two components to one functional protein. Although transcription factors are important MAPK targets, MAPKs may also influence post-transcriptional processes in the cytoplasm, for example by contributing to mRNA stabilization. MAPK is also activated by stress (Fig. 6.3). The part of the pathway that is specifically associated with the stress response is called the stress-activated protein kinase (SAPK) signalling pathway. However, the chain of events in SAPK is less well known than in the case of the classical pathway activated by mitogens. The stress signal may be transduced along a distinct pathway, interacting with the classical pathway, but it may also affect enzymes of the classical pathway directly. Two important kinases which are activated by stress and can translocate to the nucleus to activate transcription factors are HOG (product of high osmolarity gene) and c-Jun N-terminal kinase ( JNK). Some of the MAPK proteins are known under different names in different organisms; for example HOG was first described in yeast but its orthologue in higher organisms is known as p38, whereas JNK is also known as SAPK5. As noted above, the action of protein kinases involves phosphorylation of certain amino acids in other proteins. The two stress-related effector kinases, HOG and JNK, can only transfer to the nucleus when phosphorylated. However, they may also be dephosphorylated by the action of protein phosphatases. Phosphatases specific for MAPK are called MAPK phosphatases (MKPs;
215
Tamura et al. 2002). The action of these phosphatases is very important for relaxation of the MAPK signal. There are four different MKP families; some of them act on specific effector kinases (e.g. only on JNK) and others have a broader action spectrum (e.g. they dephosphorylate three effector kinases— HOG, JNK, and ERK). Interestingly, MKP genes are among the many genes activated by MAPK signalling. Their activity thus constitutes a negative feedback, which attenuates the MAPK signal after being triggered by stress or a growth factor. One of the possible ways in which stress may activate SAPK signalling is by inhibition of MKPs. Oxidative stress in particular may lead to the oxidation of sensitive thiol groups in protein phosphatases and so allow SAPK signalling by removing the negative feedback (Korsloot et al. 2004). Direct activation of kinases is another possible mechanism (Fig. 6.3). The fact that different stimuli all activate MAPK signalling, yet can activate different genes, suggests the presence of a regulatory or coordinative system within the cascade. The existence of distinct but not mutually exclusive mechanisms, and the involvement of a large number of kinases, many of them acting upon each other, could contribute to the achievement of specificity in the responses to different stimuli.
6.2.2
Heat-shock proteins
Heat-shock proteins are the best-investigated components of the cellular stress response. The traditional way of studying them is by applying a heat shock: exposure of the organism or a cell culture for a period of 30 min to a few hours to supraoptimal temperature, such as 39 C. Later research has shown that heat-shock proteins are not only induced by heat but also by many other environmental stress factors, including cold, food depletion, osmotic stress, and toxicants, and so the term stress proteins is actually more appropriate. However, the term heat-shock protein is now so widely used and accepted that we retain it here. Heat-shock proteins have been found in all organisms in which they were sought (Feder and Hofmann 1999). In addition, essential features of
216
INTRODUCTION TO ECOLOGICAL GENOMICS
their molecular structure are conserved over the entire tree of life, from Archaea to mammals. This extremely wide occurrence and conservation suggests that heat-shock proteins must play a very fundamental role in the cellular defence against stress. The consensus view is that this role is due to support in protein folding and unfolding, which involves four aspects: (i) stabilizing essential structural proteins, especially around the nucleus and of organelles such as ribosomes and spliceosomes, (ii) assisting transfer of proteins across membranes, by unfolding and refolding, (iii) supporting refolding of proteins denaturated by stress, and (iv) supporting the degradation of aberrant proteins. On the basis of their ability to align with other proteins and facilitate changes in their threedimensional structure, heat-shock proteins are often called molecular chaperones. Possibly the conservation of heat-shock proteins throughout all living beings stems from the fact that a very specific threedimensional structure is required for conducting this chaperone function. The ability of heat-shock proteins to protect cells against the adverse effects arising from accumulation of denatured proteins can be seen as a logical extension of their normal function as molecular chaperones. The diversity of stress proteins varies per taxonomic group. As an example we discuss here the stress proteins of Drosophila (Table 6.2;
Korsloot et al. 2004). Four families may be discerned; Sp90, Sp70, small heat-shock proteins, and ubiquitin. The proteins themselves are named after their apparent molecular mass on an electrophoresis gel, so Hsp70 has a molecular mass of about 70 kDa. Another type of classification is between inducible and constitutive proteins. Proteins of the latter category are called heat-shock cognate proteins (e.g. Hsc70). They are always present in the cell during normal physiological function and are not usually induced by stress factors, although under certain circumstances they may be induced a little. Proteins of the former category, especially Hsp70, are known for their very strong inducibility. Induction of heatshock proteins was long used as a classical model of gene regulation, because the heat shock is so easily brought about and induction is very strong. Even nowadays, the promoters of heat-shock genes are often deployed in gene-expression studies, using genetic constructs in which the coding region of a gene of interest is fused with a promoter from an inducible heat-shock gene. Organisms may have more than one representative of the heat-shock proteins indicated in Table 6.2. For instance, D. melanogaster has two types of Hsp70, encoded by genes at different chromosomal loci. At each locus, two or more repeats of the same gene are present, depending on the fly stock. The organization of heat-shock
Table 6.2 Overview of stress proteins in D. melanogaster, following Korsloot et al. (2004) Family
Name
Location in unstressed cell
Location under cellular stress
Function
Sp90
Hsp83
Cytoplasm
Cytoplasm
Sp70
Hsp70
Nucleus (cytoplasm)
Nucleus, nucleolus, cytoplasm
Hsp68 Hsc70 Hsc70b Hsc71 Hsc72 Hsp22, Hsp23, Hsp26, Hsp27 Ubiquitin
Nucleus, cytoplasm Cytoplasm Cytoplasm Mitochondrion Endoplasmic reticulum Cytoplasm
Nucleus, cytoplasm Cytoplasm, nucleus Cytoplasm (nucleus) Mitochondrion Endoplasmic reticulum Nucleus (cytoplasm)
Nucleus, nucleolus, cytoplasm
Cytoplasm (nucleus)
Stabilizes specific receptor proteins and chaperones peptides to membranes Highly inducible, rescue of aberrant proteins during stress response Inducible; function unknown Protein binding in cytoplasm Protein binding in cytoplasm Protein binding in mitochondrion Protein binding in endoplasmic reticulum Participation in development and stress response Histone binding, tagging proteins for degradation
Small Hsps Ubiquitin
STRESS RESPONSES
genes varies both within and between species and this variation is possibly relevant for the ecological response to environmental extremes (Feder and Hofmann 1999). Each of the stress proteins mentioned in Table 6.2 has specific functions during normal cell metabolism. Members of the Sp90 family, including Drosophila Hsp83, are constitutively present, but heat, anoxic conditions, and glucose deprivation increase their level. They are sometimes referred to as glucose-regulated stress proteins. A specific role for Hsp83 lies in stabilizing steroid hormone receptors. As long as a steroid does not occupy the receptor, Hsp83 binding ensures a receptive configuration. Upon binding of the hormone, Hsp83 detaches from the receptor, which then takes another configuration; the receptor may then enter the nucleus to act as a transcription factor. This is a mechanism by which cells sensitive to steroid hormones translate a hormonal signal into gene expression. A similar function of Hsp83 lies in stabilizing the heat-shock factor, HSF, and the aryl hydrocarbon receptor (see below). Expression of Hsp83 varies with life-stage and tissue; Hsp83 is developmentally induced in gonad tissue during oogenesis, which is understandable from the steroid hormone-receptor-binding function. The Sp70 family includes the inducible heatshock proteins Hsp70 and Hsp68 (Table 6.2). These proteins are abundantly expressed within minutes after commencement of a heat treatment. After induction Hsp70 is mostly found in the nucleus and on cell membranes, where it ensures protection of essential proteins against denaturation. In the recovery phase after termination of a heat treatment, Hsp70 is translocated to the cytoplasm and participates in the degradation of damaged proteins. It is likely that Hsp68 fulfils a similar role, but its precise function is less well described. When the cell is not in stress, Hsp70 is hardly detectable, so the induction has the characteristics of a rescue operation, with Hsp70 turning out only in case of emergency. However, we know from Chapter 5 that a modest continuous upregulation of Hsp70 can have beneficial effects: it increases lifespan. A large continued increase in Hsp70 levels has detrimental effects, especially in tissues
217
with a high rate of cell division and growth. The reason is, as we will see below in more detail, that induction of Hsp70 is accompanied by a redirection of protein synthesis in which priority is given to heat-shock protein synthesis and degradation of aberrant proteins, while normal protein synthesis is blocked. The heat-shock cognate proteins Hsc70 and Hsc70b have roles similar to the inducible stress proteins, but they are constitutively present at high levels to assist in the folding of peptides. In particular, polypeptide chains that leave the ribosome after translation need assistance to assume the correct three-dimensional structure. It is assumed that negatively charged clusters in the Hsc bind to positively charged amino acid residues of the peptide; this binding changes the local conformation of the complex and causes a fold in the chain by forcing any neutral residues adjacent to the charged residues into the relatively hydrophobic environment inside the fold. The other two heat-shock cognate proteins, Hsc71 and Hsc72, are active in the mitochondrion and the endoplasmic reticulum, respectively. Both proteins are encoded in the nuclear genome, so Hsc71 must be transported across the mitochondrial membrane after translation in the cytoplasm. Low-molecular-mass heat-shock proteins vary considerably in molecular mass and number across species and they form a rather heterogeneous collection with limited sequence similarity to each other. Four different small heat-shock proteins have been identified in Drosophila (Table 6.2). The regulation and function of small heat-shock proteins are complicated. Some small heat-shock proteins are activated by phosphorylation in response to stimuli that also activate the MAPK signalling pathway (see above). These are constitutively present heat-shock proteins that play a role in protecting and chaperoning special proteins and enzymes in normal cell metabolism. However, other small heat-shock proteins are induced in large quantities without phosphorylation and these inducible heat-shock proteins seem to be directed mainly towards nuclear structures and RNA. The fourth family of heat-shock protein consists of the small globular protein ubiquitin, which like
218
INTRODUCTION TO ECOLOGICAL GENOMICS
the other heat-shock proteins is extremely well conserved; only three amino acids differ between yeast and H. sapiens. Ubiquitin can be conjugated to other proteins by a ubiquitin protein lyase and when proteins are ‘tagged’ in this way they are destined for ATP-dependent cytoplasmic protein degradation. The cytoplasmic proteolytic system promotes the turnover of proteins and increases availability of free amino acids for protein synthesis. Another regulatory role for ubiquitin is due to its binding to histones. In Chapter 5 we saw that active transcription of DNA requires histones to be acetylated; if not, histones will interact with each other and cause condensation of chromatin. A similar effect is due to ubiquitin: ubiquitination of histones prevents chromatin condensation. Under stressful conditions an enzyme, ubiquitin hydrolase, is induced, which removes ubiquitin from the histones (de-ubiquitination) and thereby causes a general decrease of DNA processing. The liberated ubiquitin moves to the cytoplasm and participates in tagging proteins for proteolytic degradation. The system can thus be understood as a shift of priorities under stress from DNA transcription to protein degradation. How is the activity of inducible heat-shock proteins regulated? One way in which the cell can increase the amount of heat-shock proteins is by transcriptional activation of Hsp genes. Inducible heat-shock protein genes all share certain conserved sequences in their promoter, so-called heat-shock elements (HSEs) see Table 6.1. These are the binding sites for a very important transcriptional activator, heat-shock factor (HSF). In yeast and Drosophila only one HSF has been identified, but in mammals there appear to be two, HSF1 and 2, where HSF1 is homologous to Drosophila HSF. Biochemical research has shown that HSF needs to undergo homotrimerization to become active as a transcription factor (Fig. 6.4). This means that three HSF molecules must bind together; the trimeric HSF can then bind to the HSEs in the promoter of heat-shock genes. In unshocked Drosophila cells, HSF is present in the nucleus in the monomeric form. Binding of heat-shock proteins, in particular Hsp83 and Hsp70, to HSF monomers prevents trimerization (Morimoto et al. 1994; Santoro 2000). When heat
shock leads to the appearance of aberrant proteins in the cytoplasm, heat-shock proteins are drawn to these proteins with an affinity greater than their binding to HSF. Consequently, HSF is no longer prevented from trimerization and the activated HSF may bind to the heat-shock elements in the promoter of Hsp genes. The binding itself is however not yet sufficient for maximum transcriptional activation; HSF must also be phosphorylated. This is brought about by a protein kinase, which by itself is activated by an external stimulus, transduced, for example, through the SAPK pathway. The activation of a transcription factor by phosphorylation while already bound to DNA is an example of transactivation. The complete model of HSF activation is shown in Fig. 6.4. The scheme illustrated in Fig. 6.4 illustrates how environmental stress regulates the induction of heat-shock protein at three levels: (i) translocation of protein kinases to the nucleus, (ii) removal of the inactivation conferred by heat-shock proteins on HSF, and (iii) transactivation of HSF by protein kinase. Even this rather complicated scheme is still a simplification. For example, trimerization of HSF is not only dependent on the appearance of aberrant proteins and heat-shock-protein detachment, it may also be directly triggered by changes in the cellular redox state and by a peak in Ca2 þ ions. In addition, the details are likely to differ from one species to another. Our scheme is mostly inspired by the situation in Drosophila, which is similar to the situation in mammals except that some heatshock proteins have different molecular masses; for example, Hsp83 of Drosophila is homologous to human Hsp90. The heat-shock factor of yeast differs considerably from animal HSF. It lacks one of the domains (a leucine zipper) that allows stabilization of the monomeric configuration. Consequently, it is not stored in monomeric form in the nucleus like the animal HSF, but is already bound to the DNA in its trimeric form, requiring only phosphorylation to be activated. The regulatory mechanisms depicted in Fig. 6.4 all relate to transcriptional processes; however, the stress response also includes regulatory mechanisms at the level of RNA processing, translation, and mRNA degradation. One of the processes that
STRESS RESPONSES
219
Stress
Proteolysis
Aberrant proteins
Monomeric HSF Trimerization
Normal proteins
Hsp83
SAPK signalling
Rescue Protein kinase
Hsp70
translocation
Heatshock protein
Active HSF
Translation
DNA binding
Phosphorylation TFIID
DNA
HSE
TATA
Transcription P TFIID
HSE
TATA Hsp coding region
Figure 6.4 Schematic representation of the chain of events leading to induction of heat-shock proteins as a consequence of stress. TATA, TATA box; TFIID, transcription factor IID, a TATA-box-binding protein facilitating the formation of a transcription-initiation complex.
is downregulated during severe heat shock is RNA splicing: the extrusion of intron sequences from the primary transcript, occurring at specialized bodies in the nucleus, the spliceosomes. The consequence is that all pre-mRNAs that have introns in their sequence cannot be processed and are not translated into functional proteins. Interestingly, the inducible heat-shock genes themselves lack any introns and so can circumvent the splicing block. Translation itself is not inhibited: it can proceed and produce a massive amount of heat-shock protein. In addition, as we saw above, stress may cause de-ubiquitination of histones, because ubiquitin moves to the cytoplasm where it is needed for tagging damaged proteins. The loss of ubiquitin from histones causes chromatin condensation,
which is another mechanism to suppress protein synthesis. Obviously, the inducible heat-shock genes must be exempt from inactivation by chromatin condensation, which is brought about by a basal promoter-binding element (known as a GAGA factor) being permanently bound to the Hsp promoter; this protein displaces the histonecontaining nucleosomes from the gene and so prevents chromatin condensation around the Hsp gene. The heat-shock response continues to act as a model par excellence of homeostatic mechanisms of the living cell. It illustrates a great variety of biochemical regulatory mechanisms, of which we have discussed only the most salient features. Later in this chapter we will see how important
220
INTRODUCTION TO ECOLOGICAL GENOMICS
heat-shock proteins are in the genome-wide responses to stress.
6.2.3
The oxidative stress-response system
Under the term oxidative stress come a variety of phenomena that are an unavoidable consequence of aerobic metabolism. By definition all aerobic organisms need oxygen, but at the same time they must avoid the inherently cytotoxic effects of oxygen. Toxicity of oxygen is not due to O2 itself but to reactive oxygen derivatives, generated by cellular processes. These derivatives are jointly referred to as reactive oxygen species (ROS). Several of these ROS are free radicals; that is, molecules or elements with one or more unpaired electrons in the outer orbital. The best-known ROS are the free radicals superoxide radical (O2–), hydroxyl radical (OH), and nitric oxide radical (NO; the lack of a paired electron is indicated by in the chemical formula). Non-radical ROS are hydrogen peroxide (H2O2) and singlet oxygen (1O2). Molecular oxygen itself has two unpaired electrons, so strictly speaking it is also a radical, but the reactivity of O2 is limited due to the fact that the two electrons have equal spin (the so-called spin restriction). In ROS the spin restriction is lifted, which is why these forms are called activated oxygen. ROS are produced at many places in the cell. Superoxide anion is produced abundantly in the respiratory chain of the mitochondria, the light-harvesting reactions of the choroplast, the reduction–oxidation reactions catalysed by cytochromes of the smooth endoplasmic reticulum, and the xanthine dehydrogenase pathway, which is involved with the degradation of purines to urate. Singlet oxygen is produced by so-called photosensibilization reactions, in which light energy is absorbed by molecules such as riboflavin, chlorophyll, and retinol, and transferred to molecular oxygen. Not all ROS are equally reactive. The most reactive species are hydroxyl radical and singlet oxygen, which react immediately with a suitable molecule and so inflict injury mainly on local cellular structures. H2O2 and superoxide anion are more stable and can move through the cell by diffusion; H2O2 can even pass cell membranes. The
damaging effect of these ROS is mostly due to their ability to generate hydroxyl radicals. These reactions are catalysed by transition metals, such as iron and copper. For example, OH is generated from H2O2 in the so-called Fenton reaction: Fe2þ þ H2 O2 ! Fe3þ þ OH þ OH Although the concentration of free iron in the cell is very low (most iron is bound in porphyrins and ferritin and not available for the Fenton reaction), some iron is bound to low-molecular-mass chelators such as citrate, and this can catalyse the generation of OH from H2O2. In Chapter 5 we saw that ROS are implicated in aging and senescence according to the free radical theory of aging. The cellular basis for this theory is that ROS may cause damage to many macromolecules in the cell, including proteins, DNA, and lipids. Protein damage may be caused by oxidation of free thiol (SH) groups, leading to loss of function. DNA damage may be due to thymidin dimers and strand breaks. Lipid damage is due to a process known as lipid peroxidation. This is a chain reaction in which an oxygen radical abstracts a hydrogen atom from an unsaturated bond in a fatty acid chain, which is followed by molecular rearrangement and uptake of oxygen, to form a lipid peroxyradical (LOO), which can abstract H from another lipid. Polyunsaturated fatty acid chains of membrane lipids are particularly sensitive to lipid peroxidation. Peroxidation causes loss of membrane flexibility, loss of activity of membrane-bound enzymatic processes, and, in the most severe form, lipid destruction followed by the appearance of volatile alkanes, alkenes, and aldehydes. Obviously, there are great advantages in the use of oxygen gas as an electron acceptor in cellular respiration; however, damage induced by ROS is an unavoidable side effect. Protection against ROS damage is an evolutionary neccessity that must compensate the disadvantage. A great variety of antioxidant systems is deployed, using two strategies: scavenging (neutralization of ROS by reaction with a reductant) and enzymatic transformation (dismutation or reduction) to a non-reactive form. Table 6.3 provides an overview of the major
STRESS RESPONSES
221
Table 6.3 Major antioxidant systems protecting the cell against injury from radical oxygen species Antioxidant system
Primary localization
Actions
Copper- and zinc-containing superoxide dismutase (Cu/Zn SOD) Manganese-containing superoxide dismutase (Mn SOD) Rubredoxin oxidoreductase
Cytosol, nucleus
Catalyses dismutation of O 2 to H2O2
Mitochondrion
Catalyses dismutation of O 2 to H2O2 Catalyses reduction of O 2 to H2O2
Catalase (CAT) Glutathione peroxidase (GSH-Px) Glutathione peroxidase (GSH-Px,m) Glutathione reductase Ascorbate peroxidase Thioredoxin (TRX)
Only found in anaerobic bacteria and Archaea Peroxisomes Cytosol, mitochondrion Lipid membranes Cytosol, mitochondrion Chloroplast (only in plants) Cytosol, mitochondrion, nucleus
a-Tocopherol (vitamin E) b-Carotenoid (vitamin A) Ascorbate (vitamin C)
Lipid membranes Lipid membranes Throughout the cell
Glutathione
Throughout the cell
Catalyses reduction of H2O2 to H2O Catalyses reduction of H2O2 to H2O Catalyses reduction of lipid Hydroperoxides Catalyses reduction of low-molecular-mass disulphides Catalyses reduction of H2O2 to H2O Restores redox state by reducing oxidized thiols, scavenges H2O2 and OH Scavenges H2O2, OH, and LOO; interrupts lipid peroxidation Scavenges O 2 and peroxyl radicals Scavenges O 2 and OH ; contributes to regeneration of vitamin E Scavenges O 2 and organic free radicals; substrate in enzymatic reduction reactions
Source: From various sources.
antioxidant systems. Scavenging and enzymatic systems to protect cells from oxidative stress are found in almost all organisms; however, anaerobic and microaerophilic bacteria and Archaea have an oxidoreductase not found anywhere else (Lumppio et al. 2001). Several antioxidant enzymes are localized in specific organelles of the cell (Table 6.3). Among the different protective systems listed in Table 6.3 we briefly highlight the role of glutathione, which acts both as a scavenger on its own and as a substrate in enzymatic reactions. Glutathione is a tripeptide, g-glutamyl-cysteinyl-glycine, which in reduced form (written GSH) has a free thiol group on the cysteine residue. In the transition to the oxidized form (GSSG) two thiol groups react with each other, losing two electrons, as in the reaction catalysed by glutathione peroxidase: H2 O2 þ 2GSH ! GSSG þ 2H2 O Oxidized glutathione is then again reduced at the expense of reduction equivalents from NADPH by means of glutathione reductase: GSSG þ NADPH þ Hþ ! 2GSH þ NADPþ
Since glutathione is responsible for the majority of ROS-protection reactions and it is also involved in conjugating lipophilic substances in xenobiotic biotransformation reactions (see below), the maintenance of a large pool of reduced glutathione is very important for the vitality of the cell. Cellular stress due to ROS, altered redox state, and xenobiotic metabolism may cause glutathione depletion. To be effective as protective mechanisms, the antioxidant systems listed in Table 6.3 must be upregulated when the cell perceives oxidative stress. This is indeed the case. Recent research has shown that genes encoding antioxidant protective enzymes all have a characteristic sequence in their promoter, designated the antioxidant-responsive element (ARE). This element is also called the electrophile-responsive element (EpRE), after researchers discovered that not only oxidative stress but also electrophile chemicals could activate the element. As in the case of heat-shock proteins, the sequence serves to bind a transcription factor which is activated by stress. The factor binding to AREs has been identified as Nrf2, also called NF-E2 (an
222
INTRODUCTION TO ECOLOGICAL GENOMICS
activation of protein kinase C (PKC) and other cytosolic factors. Phosphorylation of Nrf2 by PKC results in the release of Nrf2 from its repressor. Nrf2 may then translocate to the nucleus, and will bind to an ARE. However, before becoming fully active it needs to undergo heterodimerization. This is comparable to the formation of activator protein AP-1 by heterodimerization of c-Jun and c-Fos (see Section 6.2.1 on SAPK signalling). In the case of Nrf2, the partner protein is suggested to be a member of the family of Maf proteins. Maf proteins are nuclear factors that like Nrf2 may bind to ARE. In the absence of Nrf2, they exert negative control over ARE-mediated gene expression. How this negative control is lifted by Nrf2 is not known
abbreviation of nuclear factor erythroid 2-related factor 2; Nguyen et al. 2003, 2004; Jaiswal 2004; Kobayashi and Yamamoto 2005). Under normal physiological conditions, Nrf2 is continuously degraded under the influence of a protein known as Keap1 (Kelch-like ECH-associating protein 1). This protein supports the tagging of Nrf2 with ubiquitin, after which it is destined for cytoplasmic proteolysis. Degradation of Nrf2 is compensated by continuous synthesis, but under normal conditions the pool of Nrf2 in the cytoplasm is very small. Under conditions of oxidative stress Keap1 is inactivated and Nrf2 is stabilized (Fig. 6.5). Presumably, the oxidative-stress signal is transduced through the SAPK pathway leading to Antioxidant and xenobiotic
Cytoplasm
Degraded
Keap1
PKC
Nrf2 Nrf2 P P
Nrf2 Nrf2
Keap1
P Nrf2
X
Nucleus
Defensive gene expression
P Nrf2
X ARE
Maf G/K Maf G/K
c-Jun
c-Maf
Maf G/K
c-Fos Nrf2
c-Jun Maf G/K
Fra-1
?
Figure 6.5 Scheme of Nrf2 activation and induction of antioxidant genes by ARE binding. Nrf2 in the cytoplasm is bound to a protein, Keap1, which promotes its degradation by ubiquitination. An oxidative-stress signal, transduced via SAPK, activates protein kinases that may phosphorylate Nrf2 and liberate it from inactivation of Keap1. In addition, Keap1 may be destabilized by reactive chemicals, for example through alkylation of cysteine residues critical for its activity. Either mechanism allows Nrf2 to translocate to the nucleus. There it undergoes dimerization with an as-yet unknown partner (X) and triggers expression of genes with AREs in their promoter. A variety of nuclear factors (Maf G/K and others) normally inhibit ARE-mediated gene expression, but are removed by the Nrf2/X heterodimer. From Jaiswal (2004), with permission from Elsevier.
STRESS RESPONSES
precisely. Anyway, expression of the antioxidant system seems to be regulated by both negative and positive agents and this could allow fine-tuning to the physiological needs of the cell. Our present knowledge of the regulation of antioxidant systems is almost completely limited to human cells and Drosophila. One of the reasons for this is that the issue raises a good deal of interest in medical research: tumor cells are characterized by an upregulated oxidative-stress response. How the knowledge generated in the medical sector translates to an ecological context of animals and plants in the wild is difficult to evaluate at the moment; however, it may be expected that, like the stress-activated signalling pathways and the stress proteins, most of components of the oxidative-stress response are evolutionarily conserved. In the genome-wide studies discussed later in this chapter we will discuss some evidence supporting this statement.
6.2.4
Metallothionein and associated systems
Metallothionein is a peculiar protein with an extremely high affinity for free metal ions such as Zn2 þ , Cd2 þ , and Cu þ . In the presence of sufficient metallothionein the free concentrations of these metals in solution are reduced to the picomolar range. Interestingly, iron is not bound by metallothionein but instead has its own pathways of uptake and intracellular transport, involving ferrotransferrin and ferritin. As we will see below, changes in iron trafficking are part of the general stress response, but the regulation of these changes does not appear to interact with metallothionein and therefore we leave iron out of consideration here. As the name indicates, metallothionein contains not only a high amount of metal but also of sulphur. This is due to an extraordinarily high percentage of cysteine residues (around 30%). These cysteines participate in the formation of metal-thiolate clusters, in which the thiol groups of several cysteines coordinate with a group of metal atoms. In the metallothionein of mammals there are two clusters, one binding four metal ions using eleven cysteines, the other binding three metal ions with nine cysteines. These two clusters appear
223
as two separate protein domains, a C-terminal a-domain (four-metal cluster) and an N-terminal b-domain (three-metal cluster), which are separated by a short linker sequence (Fig. 6.6). There are no aromatic amino acids in metallothionein; the whole protein is very hydrophilic. The two-cluster structure of metallothionein has also been found in other vertebrates, invertebrates, and plants; however, in some species the a and b clusters are in reversed configuration with respect to their N- and C-terminal positions. Other species have two three-metal clusters. The metallothionein genes (Mts) of Drosophila are an oddity among animals. Drosophila has four Mt genes, each encoding a small metallothionein with one metalbinding domain (Valls et al. 2000; Egli et al. 2003). Such single-cluster Mts have not been found in other animals up to now, but they are present in fungi. In plants the Mt genes encode proteins in which the two metal-thiolate clusters are connected by a very long linker of non-cysteine amino acids (Cobbett and Goldsbrough 2002). So it appears that the evolution of metallothionein, quite unlike the stress proteins and the components
Figure 6.6 Model, based on crystallography data, of rat liver metallothionein with five cadmium and two zinc atoms, bound in two metal-thiolate clusters. The molecule can be viewed in three dimensions by stereoscopy. From Robbins et al. (1991), with permission from Elsevier.
224
INTRODUCTION TO ECOLOGICAL GENOMICS
of signalling pathways discussed above, has come with a considerable reshuffling of the molecule (Van Straalen et al. 2006). When metallothionein was first described, the function attributed to it was to regulate the cellular concentrations of essential metals. This was assumed to involve donating metals to specific metal-requiring ligands (enzymes, zinc fingers, structural proteins), while preventing aspecific binding to macromolecules by keeping the free concentrations of metals very low. In addition some metallothioneins turned out to be highly inducible by non-essential heavy metals (e.g. Cd) and this suggested a detoxification role. This classical, dual role of metallothionein has come under fire recently. The following issues describe the more complicated situation today. First, it turned out that metallothionein is induced not only by metal ions, but also by a variety of other stresses, including changes in redox state, oxidative stress and stress hormone signals. This suggests that the protein might be a member of the integrated stress response and has other roles as well. A function as a scavenger of free radicals is often suggested. Second, metallothionein should not be considered a single protein. Many organisms have more than one Mt gene; the human genome has no less than 16 Mt genes. Most invertebrates investigated so far have two genes, one strongly inducible by cadmium and encoding a cadmium-binding protein, the other not inducible and encoding a copper-binding protein. The presence of a specific zinc-binding metallothionein in invertebrates is doubtful; the copper- and cadmium-binding metallothioneins of Drosophila, nematodes, earthworms, and snails are not inducible by zinc. Third, other metal-chelating substances have been found; this happened initially in plants, hence the name phytochelatins. They are the main zinc-binding ligands in plant cytoplasm and could play a similar role in invertebrates. Phytochelatins are peptides of variable length with the general formula (g-Glu-Cys)n-Gly, where n varies from 2 to 5. The peptides are synthesized from glutathione by the enzyme phytochelatin synthase. The gene encoding this enzyme is not only found in plants but also in nematodes,
earthworms, and chironomids (Cobbett and Goldsbrough 2002). Phytochelatin synthase is also present in the genome of the tunicate Ci. intestinalis, as mentioned in Section 3.3.5, but it is absent from vertebrates. Induction of metallothionein by exposure to heavy metals has been studied extensively, but the mechanism is not yet clear. As in the case of antioxidant enzymes, inducibility is due to the presence of specific sequences in the promoter of the gene, which bind a transcription factor activated by metals. In the case of metallothionein these sequences are called metal-responsive elements (Table 6.1). Such elements are not only present in the promoters of Mt genes, but also in those of genes encoding membrane-bound zinc transporters and enzymes associated with glutathione synthesis (Andrews 2001). The best-characterized transcription factor binding to these sequences is metal-responsive element-binding transcription factor (MTF). Induction by metals takes place by activation of MTF in the cytoplasm, followed by translocation to the nucleus; however, how MTF is activated by metals is not clear. One model suggests that in uninduced circumstances MTF is inhibited by a factor called metallothionein transcription inhibitor (MTI). This MTI has possible binding sites for zinc, which if occupied would result in the release of MTF (Palmiter 1994; Roesijadi 1996; Haq et al. 2003). Under this model, activation of MTF by cadmium is explained by an increase in the free zinc concentration in the cell, brought about by cadmium displacing zinc from cellular binding sites (Fig. 6.7). The validity of the model for MTF activation by free zinc may be limited to mammals and cannot be extrapolated without modification to fish or invertebrates. In rainbow trout it was shown that silver could activate metallothionein expression without mediation by zinc (Mayer et al. 2003). In Drosophila, zinc itself does not activate MTF, although cadmium does. In earthworms and nematodes induction must involve an entirely different mechanism because metal-responsive elements seem to be completely absent; yet induction of the Mt gene by cadmium is possible (Stu¨rzenbaum et al. 2001). Another, non-MTF/ metal-responsive element-like induction mechanism
STRESS RESPONSES
225
Cd, Cu, Hg, or other metal Me
Oxidizing agent
Me MP
ROS MP
Oxidative stress
Zn
Me
Inactive enzyme
Zn Active Zn enzyme
MTF-1 Zn MTF-1 ARE
E box
Induced gene expression
MRE
Figure 6.7 Model for induction of metallothionein in mammals. Heavy metals such as cadmium, copper, and mercury can displace zinc from metal-containing ligands (MP), thereby increasing the free zinc concentration in the cell. Excess free zinc then activates metal-responsive element-binding transcription factor-1, MTF-1, which binds to metal-responsive elements (MREs) in the promoter of the metallothionein gene. Additional transcriptional activation is recruited from oxidative stress signals (activating AREs and adenomajor late transcription factor (MLTF), binding to the E box. After Haq et al. (2003), with permission from Elsevier.
is found in yeast. Here metallothionein (CUP1) is induced primarily by copper and the system is more direct than the one described above. A transcription factor has been isolated which binds to upstream activation sequences only when it contains copper; this, probably in combination with other transcription factors, results in enhanced transcription (Thiele 1992). There is a great deal of tissue specificity in metallothionein induction. Dallinger et al. (1997) isolated two metallothioneins from the snail Helix pomatia. One of these binds only copper and is present mainly in the mantle while the other binds only cadmium and is present in the midgut gland. In zebrafish, Mt2 is induced by methylmercury but only in the liver—not in muscle or brain—despite the fact that methylmercury accumulates mainly in the brain (Gonzalez et al. 2005). The metallothioneins of mammals are also tissue-specific. Among the four groups of iso-enzymes (MTI–IV), MTI and
MTII are inducible and expressed in nearly every cell; these proteins seem to qualify best as members of the stress-response. MTIII and MTIV are expressed constitutively and only in specific tissues: MTIII is expressed only in the brain and MTIV is found only in squamous epithelium cells. Metallothionein has many links with the stressactivated systems discussed above, especially with SAPK signalling and the antioxidant stress response. One of the interactions is due to the fact that after induction by metals MTF must still be activated by kinase activity (Zhang et al. 2001). Yu et al. (1997) showed that in mammalian cell lines metallothionein induction by metals can be suppressed by protein kinase C inhibitors, suggesting that MTF must be phosphorylated by stress signalling. In addition, sequencing of metallothionein promoters has revealed that they contain not only metal-responsive elements, but also antioxidant responsive elements. This explains why
226
INTRODUCTION TO ECOLOGICAL GENOMICS
metallothionein is also induced by oxidative stress. A model of metallothionein induction in mammals, involving both MTF and antioxidant signalling, is represented in Fig. 6.7. Finally, we note that the metal-scavenging function of metallothionein should be supplemented by other metal-handling systems, if it is to make any sense in the metabolism of the cell. Exactly how excess metal is removed after being bound by metallothionein is not completely known. One of the mechanisms suggested is that metallothionein donates excess metals to vesicles of the lysosomal system. Especially in invertebrates, tissues with an intestinal and hepatic function are full of these vesicles, which in electron microscope images become visible as electrondense granules (Hopkin 1989). These granules may be removed from the cell by exocytosis or apoptosis of the cell. This scheme is supported by Liao et al. (2002), who identified a cadmium-responsive gene (Cdr-1) in the genome of C. elegans, encoding a putative metal pump associated with the lysosomal membrane. A remarkable feature of this gene was that it was cadmium-specific and not induced by oxidative stress.
6.2.5
The mixed-function oxygenase system
Aromatic endogenous compounds such as steroid hormones, signalling molecules, vitamins, feeding deterrents, and anti-herbivore toxins are all metabolized in the cell by enzyme-mediated reactions covered under the general term biotransformation. Also, compounds coming from the environment, such as plant toxins, environmental pollutants, and drugs are subject to biotransformation. One of the most important enzyme families participating in these reactions is known by the name of the cytochrome P450s. The genes encoding these enzymes, which are designated with the prefix Cyp, can be found in all genomes, including those of most prokaryotes. About 200 different families of Cyp genes have been described; they represent probably the most diverse superfamily of enzyme systems known. Their evolutionary success story is due to frequent gene duplication, as well as gene conversion, genome duplication, gene loss, and
lateral transfer (Werck-Reichhart and Feyereisen 2000; Werck-Reichhart et al. 2002). Comparative genomic analysis has shown that cytochrome P450 diversification has occurred independently in different lines (Ranson et al. 2002). Many species have several tens of Cyp genes (D. melanogaster has 84 and C. elegans has 74), but their number has exploded into the hundreds in plants (A. thaliana has 249 and O. sativa has 323). The extreme diversity in plants is thought to result from the increased need for versatile defence mechanisms in sessile organisms, which cannot avoid stress factors by moving away. A complicated nomenclature is used for distinguishing the various cytochrome P450 families and higher groupings, designated as clans (http://drnelson.utmem.edu/ CytochromeP450.html). In eukaryotes cytochrome P450 is anchored in the membrane of the smooth endoplasmic reticulum, which can be isolated by differential centrifugation as a fraction containing microsomal vesicles; that is why P450 activity is also called microsomal monooxygenase. Other designations are aryl hydrocarbon hydroxylase, aromatase, and mixed-function oxidase. The latter term obviously relates to the huge diversity of substrates that can be attacked by cytochrome P450 enzymes. Most of the biotransformation reactions are oxidations introducing a hydroxyl group on to an aromatic ring, according to the following overall reaction: RH þ O2 þ NADPH þ Hþ ! ROH þ H2 O þ NADPþ where R is any substrate. This scheme shows that molecular oxygen is split into two oxygen atoms, one of which is introduced into the substrate and the other of which reacts with two hydrogen atoms to form water. The reactive centre, which is responsible for the binding of oxygen, contains an iron atom in a porphyrin ring structure. The introduction of a hydroxyl group on to an aromatic ring makes the substrate more polar and therefore more water-soluble, which is important if it has to be excreted. Cytochrome P450 usually conducts its biotransformation reactions in conjunction with conjugation enzymes such as glucuronyl transferase,
STRESS RESPONSES
sulphotransferase, and glutathione S-transferase. These enzymes transfer a polar endogenous compound (glucuronic acid, sulphate, or glutathione, respectively) to the product of the oxidation catalysed by cytochrome P450. Because of the sequence of events, the initial oxidation by cytochrome P450 is called phase I biotransformation, and the conjugations thereafter are called phase II biotransformations. Interestingly, the phase II enzymes seem to have diverged to nearly the same degree as cytochrome P450; for example the Drosophila genome has 27 annotated genes encoding a glutathione S-transferase. The importance of biotransformation reactions is well recognized in ecological biochemistry (see Harborne 1997). In plants no less than 15–25% of protein-encoding genes may be involved with biotransformation reactions of secondary metabolism. The evolution of novel secondary compounds presents a fascinating illustration of how metabolic diversity may be generated by gene duplication, repeated evolution, and convergence (Pichersky and Gang 2000; Wittstock and Gershenzon 2002). In animals, biotransformation is often deployed to detoxify plant toxins and excrete them in water-soluble form. Some specialist herbivores sequester plant-derived toxins in their bodies to support their own defence against predators; others metabolize them to reproductive pheromones (Nishida 2002). It is often assumed that the great diversity of plant secondary compounds to which herbivores are exposed was an important selective force in the evolution of biotransformation mechanisms. In pharmacology and toxicology biotransformation is studied intensively because it determines the half-life of drugs and environmental pollutants in the body. In the context of the stress response we must pay special attention to biotransformation reactions directed towards plant toxins and xenobiotics. Such reactions are usually considered as detoxifications, which increase the water solubility of the compound and assist its elimination. However, depending on the chemical, phase I reactions may give rise to intermediate compounds that are more reactive than the parent compound. Such compounds may react with macromolecules (DNA,
227
proteins) before phase II metabolism can detoxify them. This process is called bioactivation. A wellknown example is the activation of certain polycyclic aromatic hydrocarbons (a group of chemicals occurring in crude oil, diesel exhaust, and tar) to very reactive intermediates that are highly mutagenic and carcinogenic. The production of such very reactive compounds with obvious negative metabolic effects can be seen as an unavoidable evolutionary trade-off against the capacity to metabolize toxins and xenobiotics. In addition, with some substrates cytochrome P450 produces large amounts of ROS as a by-product. These two negative side effects of biotransformation may explain why upregulated monooxygenase is often accompanied by upregulation of antioxidant enzymes and heat-shock proteins. Fig. 6.8 provides an overview of the different possibilities for the fate of a foreign compound that undergoes biotransformation. Many biotransformation enzymes are greatly inducible; that is, their activity can increase by several orders of magnitude when they are exposed to certain chemical compounds. However, not all isozymes of cytochrome P450 are inducible to the same degree and not all chemical compounds induce the same set of enzymes. Traditionally, toxicologists have made a discrimination between two types of inducer: phenobarbital-type inducers (PB-type inducers) and 3-methylcholanthrene-type inducers (3MC-type inducers). The two compounds, phenobarbital and 3-methylcholanthrene, are used as model substrates. The distinction is important because only the 3MC-type inducers act according to a mechanism of receptor-mediated transcriptional regulation. The common property of 3MC-type inducers is a planar molecular structure, such as is present in certain dioxins, certain polychlorinated biphenyls and polycyclic aromatic hydrocarbons such as benzo(a)pyrene and 3-methylcholanthrene itself. 3MC-type more than PB-type induction is associated with cytotoxic effects. The most potent inducer in this class, and at the same time the most toxic anthropogenic chemical, is 2,3,7,8-tetrachlorodibenzo(para)dioxin (TCDD), a compound which arises as a by-product of the manufacture of chlorinated pesticides and other organochlorines.
228
INTRODUCTION TO ECOLOGICAL GENOMICS
Toxicity
Lipophilic compound
Phase I metabolism
Toxicity
Toxicity
Cytochrome P450
Oxidized metabolite
Phase II metabolism
Storage
Excretion
Conjugating enzymes
Conjugate
Excretion
Figure 6.8 Overview of the fate of lipophilic compounds subjected to two phases of biotransformation. Phase I metabolism is conducted by cytochrome P450; phase II metabolism consists of conjugation enzymes such as sulphotransferase (transferring a sulphate moiety to the activated product of phase I metabolism), uridinediphosphate glucuronyl transferase (transferring glucuronic acid), and glutathione S-transferase (transferring glutathione). In several cases the product of phase I metabolism is very reactive and more toxic than the original compound. This also happens sometimes with phase II reaction products.
Induction of cytochrome P450, especially the genes known as Cyp1a1 and Cyp1a2, is initiated by binding of the inducer with a cytosolic receptor, the aryl hydrocarbon receptor (Ah receptor). In the uninduced state this receptor is stabilized by heatshock protein Hsp83 (Hsp90 in mammals). This role of Hsp83 is very similar to its stabilization of the heat-shock factor HSF and the steroid hormone receptor (see Fig. 6.4 and Table 6.2). If a 3MC-type inducer binds to the Ah receptor, the protein is activated and can translocate to the nucleus, where it is phosphorylated by protein kinase C and forms a transcriptional activator complex with another protein, Ah receptor nuclear translocator (also known as ARNT). The complex then binds to sequences known as xenobiotic-responsive elements. The elements are also called dioxin-responsive elements because of the use of dioxin as a model compound; the term Ah receptor elements is also
used. Such sequences are present in the promoters of both phase I and phase II genes. Genes activated by the Ah receptor are jointly referred to as the Ah battery (Nebert et al. 2000). The group involves at least two P450 genes (Cyp1a1 and Cyp1a2) and four genes involved with phase II biotransformation and the antioxidant stress response. Interestingly, the promoters of phase II biotransformation enzyme genes in the Ah battery contain not only xenobiotic-responsive elements but also AREs. There is a close link between xenobiotic biotransformation and oxidative stress (Nebert et al. 2000; Kong et al. 2001; Fig. 6.9). Some xenobiotics such as dioxins and polychlorinated biphenyls are very potent inducers of Cyp1a1, but are themselves hardly metabolized by the cytochrome P450 enzymes. Instead, upregulated enzyme activity generates a lot of ROS and induces prolonged oxidative stress. In addition, some metabolites
STRESS RESPONSES
generated by P450 activity are very electrophilic, which means that they react easily with other compounds to compensate their shortage of electrons. Electrophiles and oxygen radicals induce antioxidant enzymes by the mechanisms discussed above. The presence of AREs in the promoters of phase II biotransformation enzymes ensures that these genes are also induced. The chronic toxicity of compounds such as dioxin is ascribed to a situation of sustained oxidative stress in the whole organism. Compounds of the PB-type predominantly induce cytochrome P450s of the IIB group and to a certain extent also members of the III family, which are normally induced by steroid hormones. PB-type induction is not as specific as 3MC-induction and
it does not depend on the Ah receptor. The precise mechanism is not known. One possibility is that PB-type inducers activate cytochrome P450 by binding to a cytosolic repressor, causing derepression of Cyp genes. However, the great structural variety of PB-type compounds makes it unlikely that this mechanisms holds for all inducers. Another possibility is that BP-type inducers introduce a change in redox state, upon which SAPK signalling is triggered, leading indirectly to transcriptional upregulation of Cyp genes. A comprehensive summary of the various pathways that may lead to induction of biotransformation activities, based on Nebert et al. (2000) and Korsloot et al. (2004), is given in Fig. 6.9.
Oxidative stress
PB-type compound
Cytochrome P450 activity
3MC-type compound
Cytochrome P450 activity
SAPK signalling
Electrophile metabolite
Electrophile metabolite AP-1 activation
Repressor inactivation
Ah receptor activation
Transcription
P450II genes
229
Transcription
?
ARE XRE
Non-P450 genes
XRE
P450I genes
Figure 6.9 Summary of the various pathways leading to induction of biotransformation enzymes. Three inducing agents can trigger activity, PB-type inducers, oxidative stress, and 3MC-type inducers. The first type of inducer presumably activates transcription of cytochrome P450 II genes by binding to a repressor. The latter type of substance induces cytochrome P450 I genes via activation of the Ah receptor, which binds to a xenobiotic-responsive element (XRE) in the promoters of P450 I genes. In addition, P450 activity generates electrophilic metabolites and ROS and this may, through SAPK signalling, induce antioxidant genes and non-P450 genes from the Ah battery.
230
INTRODUCTION TO ECOLOGICAL GENOMICS
6.3 Heat, cold, drought, salt, and hypoxia
6.3.1 Responses to abiotic stress factors in yeast
Most of the genome-wide stress analyses concern model organisms exposed to stress factors in the laboratory. The aim of such studies is usually to reveal biochemical regulatory mechanisms in the cell or to identify genes that act as targets of signalling cascades. The most extensively studied organism in this respect is baker’s yeast, S. cerevisiae. There is also a lot of work on stress responses in mammalian cell lines conducted in the context of tumor cell biology. Hardly ever are cellular stress studies aimed at explaining the performance of organisms in the wild. It must be noted, however, that genomic studies in ecologically relevant systems are only just beginning. It is to be expected that essential insights obtained from the work on model organisms can be translated to ecologically relevant contexts, since, as we have seen above, several aspects of the stress response are conserved over large parts of the tree of life. In this section we address a number of physical factors of the environment that elicit stress responses when they attain extreme values. Among these factors, temperature stands out as a major determinant of the niche, because the great majority of species—prokaryotes, ectothermic animals, and plants—cannot regulate the temperature of their internal environment. In these organisms the rate of all metabolic processes is ultimately determined by the ambient temperature. The importance of temperature is easily demonstrated by the fact that numerous species exhibit a distribution range that is bounded by some aspect of temperature, for example a winter frost isotherm. Other major conditions that determine niche boundaries are humidity, salinity, oxygen tension, and redox potential. Responses to drought have received a lot of attention in plant studies, because water deficit is often the most severe limiting factor for crop productivity. In this section we will explore what kind of stress responses are triggered by abiotic factors at the niche edge.
S. cerevisiae has been called the vanguard of a truly integrative biology, because with its limited number of protein-encoding genes (around 6000), the availability of mutants deleted for each of these genes, and the early development of tools such as microarrays, it seemed possible to capture all interactions, including the transcriptome, proteome, and metabolome, into an integrative approach of the living cell. Stress-response studies are an important part of yeast integrative biology, because by removing the cell from its normal operating range the various compensatory and regulatory mechanisms are forced to reveal themselves. Two pioneering studies of whole-genome responses to stress in yeast were published at around the same time: Gasch et al. (2000) and Causton et al. (2001). These authors studied the transcriptome of yeast under a variety of stress factors: temperature shocks, chemicals generating ROS, osmotic shock, and nutrient depletion. The profiles were studied in time and for some agents as a function of the dose. Interestingly, no two expression programmes were precisely the same in terms of the genes affected, the magnitude of expression alteration, and the changes in time. Gasch et al. (2000) introduced the term choreography of expression to describe the sequence of events occurring after a specific stimulus. Each stress factor seemed to trigger its own choreography; the uniqueness of each programme highlights the precision by which yeast responds to environmental change. Despite the specific choreographies, the studies also showed that a large fraction of the yeast genome responded to stress in a stereotypical manner. Gasch et al. (2000) identified two clusters, one upregulated and one downregulated, of 900 genes in total—more than 14% of the yeast genome—which demonstrated similar responses across the various stress factors. These genes together were designated as the environmental stress response. In a similar manner, Causton et al. (2001) identified 499 genes, corresponding to 10%
STRESS RESPONSES
of the yeast genome, which were common to most of the transcriptional changes observed when yeast cells were exposed to a number of different environmental changes. They called these genes the common environmental response (CER). Table 6.4 lists the functional categories to which the genes of the environmental stress response belong. The genes of the environmental stress response fit into a syndrome of changed priority from protein synthesis to protective mechanisms. Almost all repressed genes have something to do with translation at the ribosomes, whereas many upregulated genes relate to stress-defence mechanisms, such as scavenging of ROS, antioxidant defence, and repair of aberrant proteins. A major fraction of the upregulated genes is due to heat-shock proteins and other stress proteins discussed in Section 6.2. Another group of upregulated genes with a less obvious stress-defence function involved enzymes of sugar metabolism, especially in the pathways of trehalose and glycogen. The genome-wide regulation of carbohydrate metabolism under stress seems to be specific to yeast and may reflect the pervasive importance of carbohydrates in the natural environment of yeast. Interestingly, both synthetic and catabolic enzymes of carbohydrate metabolism were upregulated under stress. Gasch et al. (2000) suggest that these apparently conflicting functions may reflect the need for the cell to increase its capacity for regulated flux of carbohydrates so as to rapidly buffer energy reserves and manage osmotic instability.
The coherent induction and repression of genes belonging to the environmental stress response would suggest that they are all regulated by a single master process. Earlier research had suggested a key role for the yeast transcription factors Msn2p and Msn4p. These important transcription factors are associated with changes of nutritional state and diauxic shift; they regulate many genes related to carbohydrate metabolism, but are also involved in the stress response. Translocation of Msn2p to the nucleus under the influence of SAPK and other signalling pathways is a characteristic feature of the yeast stress response (Go¨rner et al. 1998). Msn2p and Msn4p exert transcriptional control of stress-responsive genes by binding to a specific stress-response element in the promoters of these genes. However, the genomic work by Gasch et al. (2000) showed that not all stress responses were dependent on these transcription factors. For example, genes of the thioredoxin cluster were induced in msn2; msn4 mutants to the same degree as in the wild type, suggesting that there must be alternative regulators of environmental-stressresponse gene expression. In fact, it seems to be more a rule than an exception that genes are regulated by more than one transcription factor, depending on specific environmental conditions. A possible additional group of stress-responsive gene regulators are the yeast activator protein (Yap) factors. There are eight Yap genes in the yeast genome and for five of them a function in some aspect of the stress response has been established (Rodrigues-Pusada et al. 2004).
Table 6.4 List of functional categories containing genes regulated in the environmental stress response of yeast Functional categories of genes repressed
Functional categories of genes induced
Growth-related processes RNA processing, RNA splicing Translation initiation and elongation Nucleotide synthesis Secretion Ribosomal proteins
Carbohydrate metabolism Cellular redox reactions and antioxidant defence Protein folding Protein degradation and vacuolar functions DNA-damage repair Intracellular signaling
Source: From Gasch et al. (2000).
231
232
INTRODUCTION TO ECOLOGICAL GENOMICS
Numerous other studies have been published on genome-wide responses to stress in yeast (see Gasch and Werner-Washburne 2002 for an overview); however, since their focus was mainly biochemical, discussing them all would lead us too far away from the ecological focus of this chapter. From the sample studies discussed above we may conclude that yeast cells respond to environmental stress factors by means of a number of essentially independent pathways that are integrated in an overall genomic expression programme. When cells are exposed to two or more stress factors simultaneously the resulting expression programme largely approximates the sum of each individual stress response. Coherence is brought about by plenty of crosstalk between the various pathways and the presence of different transcription factor-binding sites in the promoters of stressresponsive genes. It is also obvious from the yeast studies that stress responses elicited by sudden changes of abiotic conditions are essentially transient. The remodelling of the transcriptome reflects an adaptation phase in which the cell adjusts its metabolic machinery to the new conditions. Transcript levels turn back to normal even when the stress factor persists. In accordance with this model, the time over which the genome shows altered transcription is correlated with the seriousness of the disturbance. Finally, the discovery of a common set of genes (the environmental stress response) being involved with defence against a variety of physical and chemical stressors is an important lesson that is equally applicable to other organisms.
6.3.2 Plant responses to drought, cold, and salt Plants have a remarkable ability to cope with environmental stress factors, including extremes of temperature, humidity, and salinity. The genomic responses to such stresses are of potential importance to agriculture, because a better understanding of abiotic stress tolerance may improve the basis for breeding of crop plants. In some parts of the world cultivation of stressresistant crops under marginal conditions is the
only way to increase food production. Whereas people have selected plant species for 10 000 years to grow under a variety of climatic conditions, breeding for stress tolerance has proven difficult because the traits involved are determined by multiple genes. Using a genome-wide approach it might be possible to identify factors upstream in a stress signalling cascade and so increase the likelihood that determinants of genome-wide stress tolerance can be identified, manipulated, and possibly introduced into crop plants. It may be assumed that the fundamental aspects of stress tolerance are present in all plants, but what distinguishes species, it seems, is how fast and how persistent the stress-tolerance machinery is engaged (Bohnert et al. 2001). Extremes of temperature, humidity, and salinity are most often studied in plant stress-response studies, but a shortage of nutrients (nitrate, sulphate, etc.) is an equally important factor that may limit the ecological niche of a species. Responses to nutritional stress are, however, more specific than responses to physical stress and the two hardly interact with one another. Therefore we leave nutritional stress out of consideration here. A recent thorough overview of the various molecular aspects of plant responses to drought and salt stress is given by Bartels and Sunkar (2005). Genomic studies of Arabidopsis have shown that there is a great deal of commonality in the responses to drought, cold, and salt. Seki et al. (2001, 2002) developed a cDNA microarray of Arabidopsis genes and monitored the expression of 7000 genes when plants were desiccated, exposed to 4 C, or grown in hydroponic solution with 250 mM NaCl. In total, 277 genes were upregulated more than 5-fold by drought, 53 were coldinducible, and 194 were induced by high salinity (Fig. 6.10). Among these genes, 22 responded to all three stress factors. A large number of genes overlapped between drought and salinity, and fewer between either of these factors and cold. The fact that the greatest number of genes is induced by drought suggests that tolerance to drought requires the largest transcriptional alteration in plant cells and that water deficit may be considered the most severe limiting factor of
STRESS RESPONSES
Cold
Drought
21
8
128
22 2
119 51
NaCI Figure 6.10 Venn diagram of gene expression in A. thaliana Columbia exposed to three stress factors: cold, drought, and high salinity (NaCl). In each intersection the number of genes is specified whose expression ratio showed more than 5-fold upregulation compared to unstressed plants. From Seki et al. (2002), by permission of Blackwell Science.
plant growth. However, as Seki et al. (2002) admit, this result may also be due to the intensity of the stress factors applied; dose-dependence of gene expression was not investigated in this study. The various Arabidopsis genes induced by drought, cold, and high salinity may be classified into two functional groups. The first group includes proteins that play a direct role in combating stress. These genes include heat-shock proteins, osmoprotectants, water-channel proteins, sugar transporters, and potassium transporters. Each of these proteins is targeted to solve a specific aspect of the stress condition. For example, KIN proteins induced by cold have a unique ability to prevent freezing of fluids by neutralizing ice nucleators. Aquaporins (members of a larger family of major intrinsic proteins, MIPs) regulate the flux of water across the membrane. A group of proteins called late embryogenesis-abundant (LEA) proteins have a role similar to heat-shock proteins and protect macromolecules from denaturation. Table 6.5 provides an overview of the various upregulated genes involved directly in stress tolerance. The second group of drought-, cold-, and high-salinity regulated genes contains mainly regulatory proteins.
233
These are transcription factors, protein kinases, protein phosphatases, and genes associated with plant hormones and signalling molecules. No fewer than 40 genes, which is 11% of all stress-regulated genes in the study of Seki et al. (2002), encoded transcription factors. In a similar study Chen et al. (2002) found 57 transcription factors in the Arabidopsis genome to be regulated by one or more stress factors (cold, salt, wounding, pathogens). Both studies illustrate the importance of transcriptional control in the tolerance to stress. One specific group of stress-inducible transcription factors in plants is the DREB family, which belongs to the larger group of AP-2/ERFtype transcription factors. DREB proteins bind to the so-called dehydration-responsive element (DRE), a 9-bp conserved DNA sequence which is found in promoters of several stress-responsive plant genes (see Table 6.1). The element is assumed to exert an important cis-acting influence on stress-responsive gene expression. DREB1s are involved in coldresponsive gene expression, whereas DREB2s are associated mainly with drought. Altering the expression of such master genes can be a simple lever for increased stress tolerance. For example, overexpression of DREB1A in transgenic Arabidopsis results in enhanced tolerance to drought, cold, and salt (Kasuga et al. 1999). Another control mechanism regulating the stress response in plants goes via the plant hormone abscisic acid (ABA). ABA is an important stressresponsive plant hormone that triggers a signalling pathway ultimately converging on a cis-acting DNA sequence known as abscisic-acid-responsive element (ABRE). Transcription factors binding to ABREs belong to the large group of basic leucine zipper (bZIP) proteins. The seemingly awkward name derives from a DNA-binding domain rich in basic residues adjacent to a leucine zipper domain which supports dimerization of the protein (required for DNA binding). Among the 22 genes that were upregulated by all three stress factors in the study of Seki et al. (2002), 16 contained a DRE in their promoter and 15 contained an ABRE, illustrating the importance of both abscisic acid-dependent and -independent gene regulation. The presence of different transcription
234
INTRODUCTION TO ECOLOGICAL GENOMICS
Table 6.5 List of gene categories associated with genomic responses to drought, cold, or high salinity in A. thaliana Group of genes Proteins involved directly with stress tolerance Late embryogenesis-abundant (LEA) proteins and heat-shock proteins Cold-inducible (KIN) proteins Osmoprotectant biosynthesis-related proteins Carbohydrate metabolism-related proteins and sugar transporters Water-channel proteins (aquaporins) Potassium transporters Detoxification enzymes Proteases, protease inhibitors, and senescence-related genes Ferritin Lipid-transfer proteins Regulatory proteins Transcription factors Protein kinases and protein phosphatases Plant hormone-related genes
Functional significance
Protect macromolecules from denaturation Inhibit ice-crystal growth and neutralize ice nucleators Production of sugar and proline as osmolytes protecting cells from dehydration Transport of sugars through plasma membrane and tonoplast to adjust osmotic pressure Regulate water flux over plasma membrane and tonoplast in relation to osmotic homeostasis Control potassium and sodium uptake in relation to salinity tolerance Protection against ROS and electrophiles Increase protein turnover and availability of amino acids; accelerate leaf scenescence Protects cells from iron-catalysed oxidative damage through the Fenton reaction Repair of stress-induced membrane damage, alteration of lipid composition of membranes 40 different genes encoding DNA-binding proteins regulating stress-inducible genes Transducing stress signals and regulating stress-inducible genes Biosynthesis, regulation, and action of ethylene, jasmonic acid, and auxin
Notes: Two main categories are shown; one group that is involved in direct combating of stress, another that is involved in signal transduction and transcriptional regulation. Source: After Seki et al. (2002).
factor-binding sites in promoters of the same gene may explain the partial overlap between transcriptional profiles of different stress factors. In section 6.2 it was mentioned that the expression of several stress-related genes (e.g. metallothionein) shows a high degree of tissuespecificity. This is also applicable to the transcription profiles of plants exposed to abiotic stress factors. In particular, roots and leaves may show diverging transcriptional profiles. Kreps et al. (2002) monitored expression of 8100 Arabidopsis genes using an oligonucleotide gene chip and identified 2409 genes with a greater than 2-fold change over controls when plants were exposed to salt, osmotic, and cold stress. However, expression of many genes was specific for either roots or leaves, especially in the response to cold. Less than 14% of the cold-specific changes were shared between roots and leaves. Some transcripts had different tissue-specific temporal dynamics; for example, a gene was expressed initially in both
roots and leaves but the transcript in the root disappeared quickly and only in the leaves was it observed as a sustained and consistent change. The importance of time-specific responses was also underlined in a study by Kawasaki et al. (2001) on salt stress in rice: genes for general stress defence were induced within 15 min, and most genes reached a peak after 1 h, but some only subsided after 7 days. In the real life of plants, abiotic stress factors often occur simultaneously. This is especially valid for drought and heat in semi-arid or desert environments. The question is, can the common environmental stress response provide protection against two such factors at the same time? Interestingly, this does not seem to be the case, at least not for heat and drought in plants. Rizhsky et al. (2004) showed that to combat both heat and drought, plants deploy a partial combination of two multigene defence pathways, plus an additional 454 genes that are expressed specifically
STRESS RESPONSES
during a combination of drought and heat. As shown in Fig. 6.11, there is actually very little similarity between the responses of Arabidopsis to drought and heat. Only 29 genes were found to overlap. The largest overlap was between the responses to heat and a combination of heat and drought. This suggests that large portions of the defence programme against heat are also turned
(a)
Drought
Heat
596
108 29 450
124
454
Drought + heat (b)
Drought
Heat
169
100 48 279
131
318
Drought + heat Figure 6.11 Venn diagrams showing genes regulated by drought (decrease over 6 days of plant water content to 70–75%), heat (38 C for 6 h), and a combination of the two treatments in A. thaliana Columbia analysed using an oligonucleotide gene chip. (a) Upregulated genes, (b) Downregulated genes. After Rizhsky et al. (2004). Copyright American Society of Plant Biologists.
235
out in defence against drought, but in addition new genes are activated to deal with the combination. The combined response is characterized by enhanced respiration, suppressed photosynthesis and accumulation of sucrose and other sugars. It was particularly striking that the amino acid proline, which is a common osmoprotectant accumulating under drought stress, was not accumulated when plants were exposed to both drought and heat. This suggests that the combination of drought and heat imposes a different kind of stress to plant cells compared to drought alone. Perhaps proline is avoided and sucrose favoured because heat ameliorates the toxicity of drought-induced proline. The study of Rizhsky et al. (2004) suggests that there is an element of ‘collision’ in the defence pathways to different stress factors. The presence of antagonism in gene-expression programmes was also suggested by Tamaoki et al. (2003). These authors investigated the role of three plant hormones—ethylene, jasmonic acid, and salicylic acid—in the regulation of gene expression of Arabidopsis exposed to ozone. By studying the stress responses of mutants disturbed in each of the hormone signalling pathways, it became obvious that ethylene regulated the ozone response of 73 genes, jasmonic acid regulated 62 genes, and salicylic acid regulated 24 genes; however, there was a considerable over lap between these genes. Many defence genes induced by ethylene and jasmonic acid signals were suppressed by salicylic acid signalling, suggesting that the salicylic acid pathway acts as an antagonist to the other two pathways. Such interactions in gene-expression programmes of plants are in contrast with the additive nature of stress responses assumed for yeast (Gasch and Werner-Washburne 2002; see above). Although most of the mechanistic knowledge on stress tolerance comes on the account of A. thaliana, plant biologists are also very interested, for obvious reasons, in the stress responses of crop species such as rice and barley (Kawasaki et al. 2001; Ozturk et al. 2002). In addition, the study of species growing naturally under extreme conditions might add insights that cannot be attained
236
INTRODUCTION TO ECOLOGICAL GENOMICS
from mesophilic plants. Models for the study of halotolerance are the ice plant, Mesembryanthemum crystallinum, and the green alga Dunaliella salina (Cushman and Bohnert 2000; Bohnert et al. 2001). The resurrection plant, Craterostigma plantagineum, which shows a remarkable ability to restrict cell damage during desiccation and rehydration of its tissues, is a promising model for xerotolerance. Gene-discovery programmes in such naturally tolerant models have focused on EST sequencing of stressed and unstressed libraries. Such studies have demonstrated that ESTs related to stress are under-represented in the current genomic databases, which suggests that there may still be unknown mechanisms involved in plant stress tolerance. Comparative genomics of the type discussed in the context of aging in Section 5.2 has an important role to play here. Comparisons among stress-tolerant species from different evolutionary lineages may help to identify the universal gene complement underlying stress tolerance in plants.
6.3.3
Abiotic stress responses in animals
In addition to yeast, fruit flies have been widely used as a model for studying genome-wide responses to elevated temperature. As expected, supraoptimal temperature induces heat-shock proteins, but it also causes a great variety of other changes in the transcriptome. As an example, consider the study of Leemans et al. (2000). These authors found that 74 genes were affected significantly in D. melanogaster embryos exposed to a mild heat shock (36 C for 25 min). Among these 74 genes, 36 had increased and 38 had decreased expression levels (Fig. 6.12). A very strong induction was seen for the small heat-shock proteins Hsp22, Hsp26, Hsp27, and Hsp23; this induction was many times greater than the fold regulation found for other genes. No induction was seen for the heat-shock cognate proteins Hsc70-1, Hsc70-4, and Hsc70-5; however, a small degree of upregulation was noted for Hsc70-3. Two signal transduction genes were also upregulated, Shark and Rabgap1. Shark encodes a protein kinase involved in the JNK cascade and Rabgap1 is a Ras GTPase activator; both proteins are part of signalling
transduction pathways regulating cell growth (see Fig. 6.3). Finally, many changes were seen in genes encoding proteins involved with transcriptional regulation and metabolism, and these changes included both up- and downregulation (Fig. 6.12). The study of Leemans et al. (2000) illustrates that the transcriptional change induced by heat shock may be more complicated than suggested by the biochemical work discussed in Section 6.2. Although the strong upregulation of heat-shock proteins is in accordance with the earlier theory, the many changes seen in other functional categories suggest that there is no simple downregulation of overall protein synthesis, but a more complicated adjustment to the metabolic needs of the cell. Some of the responses documented by Leemans et al. (2000) may be specific to the life stage (embryos); for example, the abundance of small heat-shock proteins, which are known to be developmentally expressed. Also we must remember that the heat-shock response involves post-transcriptional regulatory mechanisms, so not all transcriptional changes depicted in Fig. 6.12 need to be expressed at the protein level. Although the heat-shock response has become the most widely used model for studies on stress-induced transcriptional change, other stress responses may sometimes be more closely linked to an environmental context. An example illustrating this point is the response to hypoxia (low oxygen levels) in fish. Dissolved oxygen is a limiting factor for many fast-swimming, active fish species. Fish species inhabiting sediment burrows in estuarine ecosystems are particularly tolerant of hypoxic conditions and the study of such naturally tolerant species is expected to shed light on cellular responses to hypoxia in general. From mammalian research it is known that gene expression induced by hypoxia is controlled by hypoxia-inducible factor 1 (HIF-1) in a manner which is very comparable to the action of Nrf2 in the oxidative stress response (see Section 6.2). HIF-1 comes in two subunits, HIF-1a and HIF-1b, which are both expressed constitutively at high levels (Wenger 2002; Schulte 2004). HIF-1b is identical to the Ah receptor nuclear translocator, a protein that we met in Section 6.2 as a dimerization partner of
STRESS RESPONSES
Heat-shock proteins Hsp22 Hsp26 Hsp27 Hsp23 DnaJ-1 Hsp67Bc Hsp83 Hsp70Ab Hsp70Bb Hsc70–3
19.2 13.9 12.4 10.1 6.1 5.2 4.3 3.4 3.2 1.8
Unknown function anon–23Da ref(2)P bam C901 –1.7 Eip71CD –1.8 anon-66Da –2.2 anon-Pen15EF –4.0 anon-X
Transposable elements 412 orf2
–1.6
Cytoskeleton / structural proteins Lcp65Ad Ote –1.8 –1.8 ncd –1.9 Dlc90F –2.1 gammaTub23C
Signal transduction Shark Rapgap1 Arf84F
3.2 2.4 1.7 1.6
Transcriptional regulation Awh kay dl sima Dif ovo Snrf –1.6 disco –1.8 dre-4 –2.2 knrl –2.6 cad –2.8 E(spl) –2.9 salr –3.0
Metabolism Pgi kiwi alpha-Est3 rut NUCB1 mtacp1 FK506-bp2 Pp1beta-9C ImpL3 Cyt-c2 scu Gpdh Pbprp5
237
2.2 2.1 1.7 1.7 1.6 1.5
2.0 1.8 1.7 1.6 1.6 –1.5 –1.5 –1.6 –1.6 –1.7 –1.8 –1.8 –2.8
2.1 Chromatin structure –1.5 Cap
3.4 2.9
Cell cycle Cdc37 dap Cdc27
1.6 –1.6 –1.7
–2.0
Transcription / replication / repair mus209 –1.5 –1.8 Rpl135 –1.8 Rrp1 –3.1 mus210
Cell-surface receptors / CAMs / ion channels 2.2 dig1 1.8 Ten-m 1.6 sax –1.6 nAcRalpha-7E –1.7 DebB –2.1 put –2.6 Nrk
Proteolytic systems / apoptosis mas Ubp64E UbcD2 –1.5 Ser99Da –1.7
RNA binding BicD tra
1.7 1.5
1.6 1.6
Avg diff for heat-shocked embryos: <100
100–1000
>1000
Figure 6.12 Overview of differentially expressed genes in D. melanogaster embryos exposed to heat shock, in comparison with non-heat shocked embryos. The genes are grouped according to functional class; bars represent fold regulation. CAM, cell-adhesion molecules. In the key, the darkness of the bar indicates the extent to which expression in heat-shocked embryos differs (on average) from the standard condition. Avg Diff is the ratio of the two expressions. After Leemans et al. (2000) by permission of the National Academy of Sciences of the United States of America.
238
INTRODUCTION TO ECOLOGICAL GENOMICS
the Ah receptor. Bound to HIF-1a, it promotes translocation of HIF-1 to the nucleus. However, under normal physiological conditions HIF-1a is degraded rapidly through ubiquitin-mediated cytoplasmic proteolysis. Degradation is initiated by enzymatic hydroxylation of two proline residues, a process that is sensitive to the oxygen concentration in the cell. Under low oxygen conditions prolyl hydroxylase is inhibited, with the consequence that HIF-1a is no longer degraded and the heterodimer can translocate to the nucleus. A second hypoxia-dependent regulatory mechanism is located in the nucleus. To act as a transcription factor, HIF-1a must bind to nuclear factor p300, which is prevented by another enzymatic hydroxylation, in this case of an asparagine. Under hypoxic conditions this hydroxylation is also impeded, allowing HIF-mediated transcription to occur. Interestingly, HIF-1 is also required for heat acclimation and contributes even to metal resistance (Katschinski and Glueck 2003; Treinin et al. 2003). Such cross-tolerance phenomena present another illustration of the interconnectedness between the various stress-response pathways. In an pioneering genomics study Gracey et al. (2001) documented transcription profiles of the long-jawed mudsucker, Gillichthys mirabilis (Perciformes, Gobiidae), exposed to hypoxic conditions (0.8 mg/l at 15 C). SSH was used to generate cDNA libraries enriched with hypoxiaregulated genes (see Section 2.1). More than 5000
PCR-amplified cDNA clones were printed on an array, which was then used to monitor transcriptional change in liver and muscle tissue of fish under hypoxic conditions. Clones that were differentially expressed by 2.5-fold or greater were sequenced and their putative function was established by homology to database sequences. A total of 126 distinct hypoxia-regulated cDNAs were found, of which 75 could be identified by homology. Gracey et al. (2001) were able to interpret many of the changes in gene expression in terms of an ecophysiological strategy employed by the fish to allow its survival under hypoxic conditions (Table 6.6). The transcription profile suggested a metabolic switch in which very rapidly after the onset of hypoxia the major energy-requiring processes like protein synthesis and locomotion were repressed. Then, after about 24 h, the metabolic machinery was directed towards anaerobic ATP production and synthesis of glucose from non-carbohydrate sources (gluconeogenesis). The changes in genes for amino acid metabolism indicate that amino acids are the main source for gluconeogenesis. At the same time, cell growth and proliferation is repressed by means of binding circulating IGFs and by attenuation of MAPK signalling. Among the genes with unclear function was an inducible pseudogene encoding an antisense mRNA matching the 5 0 end of retinoblastoma-binding
Table 6.6 Summary of transcriptional change observed in long-jawed mudsucker, G. mirabilis, exposed to hypoxic conditions Functional category
Tissue
Examples of genes
Possible functional significance
Energy metabolism
Liver
Locomotion and contraction
Muscle
Maintenance of glucose homeostasis by gluconeogenesis Decreased locomotory activity
Translation, protein synthesis Iron metabolism Cell growth and proliferation
Muscle Liver Liver
Lactate dehydrogenase ( þ ), enolase ( þ ), trisephosphate isomerase ( þ ) a-Tropomyosin ( ), myosin heavy chain ( ), myosin regulatory light chain 2A ( ) Elongation factor 2 ( ), several ribosomal proteins ( ) Haem oxygenase-1 ( þ ), ferritin ( þ ), transferrin ( ) IGF binding protein 1 ( þ ), MAPK phosphatase ( þ )
Amino acid metabolism
Liver
S-Adenosylmethionine synthase ( þ ), tyrosine aminotransferase ( þ )
Notes: The direction of change is indicated with þ or . Source: After Gracey et al. (2001).
Reduced protein synthesis Increased production of erythrocytes Suppression of cell growth by attenuating MAPK signalling Catabolism of amino acids used for gluconeogenesis
STRESS RESPONSES
protein 2 (RBP2). An antisense RNA is a sequence complementary to a certain mRNA, the translation of which is suppressed by binding to the 5 0 end. The production of antisense RNA in response to stress is a means to antagonize the expression of other genes, which may contribute to the fineregulation of metabolic processes. That this type of mechanism was involved in the response to hypoxia was not known before. The long-jawed mudsucker study is remarkable because it illustrates several of the points raised in Chapter 1 as dilemmas of ecological genomics: (i) it is possible to explore the transcriptional profile of an organism about which no sequence data existed before, (ii) cDNA microarrays can be developed from SSH libraries without prior knowledge of the genome, (iii) microarrays are useful as exploratory instruments, (iv) even with a limited sequencing effort, a great deal of insight into the ecophysiology of a species can be reconstructed, and (v) the study of species adapted to extreme conditions can reveal new insights into homeostatic mechanisms that may be relevant for many other species.
6.4
Herbivory and microbial infection
Not only abiotic conditions, but also biotic factors may limit the ecological niche and can elicit specific stress responses in plants and animals. Such biotic factors can be other organisms that decrease the fitness of plants or animals by consumptive action. Ecologists distinguish herbivores (animals consuming plants or parts of them), predators (animals consuming other animals after catching and killing them), parasites (organisms living inside or on the surface of plants or animals, diverting resources from the host to themselves), and parasitoids (animals living inside other animals but killing the host to complete the life cycle). The initial contact between the two players in such interactions is invariably accompanied by stress and specific defence responses, especially in the victim being preyed upon, being consumed, or acting as a host. In this section we will review studies dealing with stress responses associated with attack by herbivores and pathogenic
239
microorganisms. The importance of both processes in regulating the abundance of species in the wild stands beyond doubt; however, herbivory has received much more attention from ecologists than parasitism and disease. Genomic responses to microbial infection of plants is a major topic in plant pathology, but this is mostly studied in an agricultural context and therefore not discussed here. Predation, although a popular subject among ecologists, has not been studied at the genomic level and so is also not considered.
6.4.1
Plant defence against insect herbivory
Plants respond to herbivore attack with a wide array of defence mechanisms. One of the strategies employed is to synthesize secondary compounds such as alkaloids and terpenoids that are toxic to herbivores and pathogens. Such compounds are called secondary because they do not belong to the metabolism of primary cell constituents (carbohydrates, proteins, and lipids). Secondary compounds can be synthesized after initial damage by the herbivore (damage-induced defence), or they may be synthesized at all times (constitutive defence). The first strategy has the advantage that the costs associated with biosynthesis only burden the plant when actually under attack; however, the disadvantage is that the defence may not be rapid enough, or the initial damage may be too severe (Wittstock and Gershenzon 2002). The second strategy is more effective, but obviously costs of biosynthesis are incurred for as long as the plant grows. The costs of anti-herbivore defences can indeed be considerable, especially under competitive growing conditions, and so inducibility is assumed to have evolved as a cost-saving mechanism (Zavala et al. 2004). We will focus on damage defence induced by insects in this section. Induced defence against herbivores can be direct or indirect. Direct responses aim at preventing further feeding of the herbivore by some kind of toxic action such as sensory irritation, gut convulsion, or paralysis. Indirect responses involve the use of volatile alarm chemicals to attract predators and parasitoids of the herbivore. There is a great deal of specificity in these responses,
240
INTRODUCTION TO ECOLOGICAL GENOMICS
involving chemical communication between plants, herbivores, and natural enemies, which has led to the concept of tritrophic interaction (Price 1980). A better understanding of the genomics of herbivore defence by plants may thus have important ramifications outside the plant proper and benefit community ecology (Dicke et al. 2004). Over the last decade, significant progress has been made in identifying the nature of volatile chemicals that are produced by plants when attacked by insects (Kessler and Baldwin 2002; Dicke et al. 2003). Three groups of chemicals can be distinguished: (i) so-called green leaf volatiles, C6 alcohols and aldehydes which are synthesized quickly after damage and are not very specific to the plant species or the type of leaf damage, (ii) terpenoids from the octadecanoid pathway, commonly called oxylipins, which are emitted slowly, typically 24 h after the damage and are more specific, and (iii) derivatives of the aromatic amino acid precursor shikimate, such as methyl salicylate, which are emitted after herbivore damage but not after mechanical wounding. Volatile chemicals are not only released locally from damaged leaves but also from undamaged parts of the plants in distinct temporal patterns (a systemic response). Some constituents of the volatile releases are just a passive consequence of damage to cell compartments, notably vacuoles and trichomes; however, many are due to de novo biosynthesis under control of three plant hormones: ethylene, jasmonic acid, and salicylic acid. The question is, how is the signal emitted from herbivore-induced damage transduced into regulation of these biosynthetic pathways? Studies on Arabidopsis provided the first cues on the nature of transcriptional changes induced by herbivory in plants. Reymond et al. (2000) prepared an array with 150 EST probes of genes that were known to be involved in stress defence. Temporal change of gene expression was analysed in response to mechanical wounding and feeding by cabbage white caterpillars, Pieris rapae (Lepidoptera, Pieridae). Mechanical wounding of the leaf induced a clearly recognizable stress response in Arabidopsis. Upregulation was seen for many genes from the stress-responsive pathways
discussed in Section 6.2, including several MAPKs, a metallothionein, two glutathione S-transferases, and a cytochrome P450. A cluster of 17 genes was regulated in a coherent fashion; this cluster included general stress genes as well as genes implicated in the synthesis of the plant hormone jasmonic acid, and known to be induced by this hormone (Fig. 6.13). Earlier research had shown that three key enzymes in the jasmonate biosynthetic pathway (lipoxygenase (LOX), hydroperoxidaselyase (HPL), and allene oxide synthase (AOS)) can be used as indicators for wounding and these three enyzmes were also responsive in the microarray study (Fig. 6.13). There was a very good correlation between expression of the inducible gene cluster and leaf concentrations of jasmonate, while the metabolic precursors of jasmonate, OPDA and dnOPDA, rose more slowly, peaking 6 h after wounding. The observations suggest strongly that the transcriptional response to wounding is triggered by a burst of jasmonate within 1 h, followed by jasmonate synthesis. The availability of Arabidopsis mutants insensitive to jasmonate allowed the role of this trigger to be assessed in more detail. About one half of the genes regulated by wounding were no longer induced or repressed in a jasmonate-insensitive mutant, demonstrating that for a significant number of genes the plant response to wounding depends strictly on the action of jasmonate. The other half of the genes responded independently of jasmonate and this group included many genes that were also activated by water stress. So it seems that the transcriptional profile of wounding includes signatures triggered by jasmonate signalling, which are specific to wounding, as well as water stress signalling, which, as we have seen above, is regulated by abscisic acid. Further experiments by Reymond et al. (2000) have demonstrated that the transcriptional profile of wounding is not the same as the profile induced by herbivory. Feeding by cabbage white caterpillars induced many transcripts that were also induced by mechanical wounding, but additional genes were induced that mainly responded to feeding. Interestingly, there was an under-representation of water stress-induced
STRESS RESPONSES
(a) LOX2, AOS, HPL, FAD7, JR3,
Expression ratio (log10)
ASA1, TSA, COMT, CYP83B1, 0.9
GST1, GSTS, CM1, TCH1, OPR1, ACX1, PR34JV, ERS
0.6
0.3
0.0 0
2
4
6
8
10
8
10
Time (h) (b)
Jasmonate family member (nmol/g FW)
14 12
JA
10 OPDA 8 dnOPDA
6 4 2 0 0
2
4
6
Time (h) Figure 6.13 Temporal changes of gene expression in Arabidopsis after mechanical wounding of leaves. (a) Average expression of 17 genes with similar temporal change; dashed lines indicate the standard deviation. LOX2, lipoxygenase; AOS, allene oxide synthase; HPL, hydroperoxide lyase; FAD7, fatty acid desaturase; JR3, aminohydrolase; ASA1, anthranilate synthase a subunit; TSA, tryptophan synthase a subunit; COMT, O-methyltransferase; CYP83B1, cytochrome P450; GST1 and GST5, glutathione S-transferases; CM1, chorismate mutase; TCH1, calmodulin; OPR1, OPDA reductase; ACX1, acyl-CoA oxidase; PR3AIV, chitinase; ER5, late embryonesis-abundant (LEA)-like protein. (b) Temporal change of leaf concentrations of jasmonate (JA), 12-oxo-phytodienoic acid (OPDA) and dinor OPDA (dnOPDA). The open symbols represent control measurements without wounding. After Reymond et al. (2000). Copyright American Society of Plant Biologists.
241
genes in the herbivore-induced transcriptional profile. These observations suggest that insects in some way or another can minimize the dehydration stress experienced by the plant while damaging the leaf. Behavioural mechanisms can possibly explain these observations. Many herbivorous insects remove tissues only from the edge of the leaf and make semicircular holes without cutting the midvein. In doing so they will cause less damage than most mechanical-wounding operations. It must be noted that transcriptomic changes following wounding and herbivory are not restricted to those triggered by jasmonate and abcissic acid; they involve many other effects that indicate a major metabolic switch, as in the case of abiotic stress responses. Transcripts related to photosynthesis and ribosomal processes are found to be downregulated by wounding, whereas expression of genes associated with protein turnover, carbohydrate metabolism, cell-wall modification, and antimicrobial defence was increased (Moran et al. 2002; Hui et al. 2003; Zhu-Salzman et al. 2004). The genome-wide nature of these changes suggests that in addition to jasmonic acid signalling, which is specific to wounding, other signalling pathways are also activated, for example those triggered by salicylic acid, ethylene, and abscisic acid. The changes can be summarized as a metabolic switch from growth priority to stress-defence priority. The fact that some aspects of the transcriptional changes to herbivory are specific to insect feeding and do not occur after mechanical wounding suggests that certain chemical cues emanating from the insect are recognized by the plant. Two classes of these so-called stress elicitors have been identified (Kessler and Baldwin 2002; Korth 2003). The first class includes digestive enzymes present in the saliva of the herbivore, such as b-glucosidase, glucose oxidase, and alkaline phosphatase. The second class comprises amino acid conjugates of fatty acids, fatty-acid-amino acid conjugates (FACs), which are present in the digestive tract, frass, and regurgitate of insects (Schittko et al. 2001; Roda et al. 2004). The fatty acid moiety in these compounds derives from the plant itself; FACs
242
INTRODUCTION TO ECOLOGICAL GENOMICS
probably represent products of phase II biotransformation in the insect, aimed at solubilizing and excreting lipophilic compounds (see Section 6.2). Recognition of chemical cues that are specifically associated with insect feeding allows plants to fine-tune their defence to certain herbivores and to attract natural enemies of the herbivore by releasing specific volatiles. An interesting complication is that some herbivores are able to express detoxification enzymes of the cytochrome P450 family even before the plant has been able to produce defensive toxins. Herbivores do this by responding to the jasmonate and salicylate burst of the plant. This would provide protection in the critical window between accumulation of plant defence compounds and production of enzymes that can metabolize them. This eavesdropping on plant defence signals is especially advantageous in polyphagous herbivores such as the noctuid Helicoverpa zea, for which this mechanism was first described (Li et al. 2002). The interaction between herbivore-induced damage and chemical signalling has been investigated in great detail in a system consisting of wild tobacco, Nicotiana attenuata (Solanaceae), and its specialist herbivore, tobacco hornworm, M. sexta (Lepidoptera, Sphingidae; Fig. 6.14). Wild tobacco is an interesting model because it is diploid, exhibits a large amount of phenotypic plasticity, and evolved in a habitat that can be considered primordial to the agricultural niche, the environment created by wildfires in woodlands (Baldwin 2001). N. attenuata uses two different defence mechanisms against herbivores; the production of nicotine and the production of terpenoid volatiles. The level of nicotine, a potent neurotoxin, is greatly induced by mechanical wounding under the influence of jasmonate signalling. Nicotine production seems to act mainly as a direct defence against browsing mammalian herbivores. Specialist herbivores such as M. sexta can store nicotine in their tissues without any toxicity and may even use it to defend themselves against avian or mammalian predators. Consequently, the plant must rely on other chemical defences, such as oxylipins, to combat such specialist herbivores. Oxylipins are also assumed to support indirect
(a)
(b)
Figure 6.14 Tobacco hornworm, M. sexta (Lepidoptera, Sphingidae), a specialist herbivore of wild tobacco and used as a model for genomic studies of plant responses to insect herbivory. (a) Adult; (b) larva. From Gillot (1980), with permission from Springer.
defence by attracting natural enemies of the herbivore. The ecological importance of jasmonateinduced oxylipins in the defence against insect herbivores was demonstrated elegantly by Kessler et al. (2004). These authors used transformed lines of N. attenuata which were planted outdoors in an experimental field. Mutants in which key enzymes of the jasmonate pathway (LOX, HPL, and AOS) had been silenced were not only more vulnerable to damage by sphingid caterpillars but also attracted new herbivores such as leaf hoppers and a chrysomelid beetle. Genomic investigations into the tobacco– herbivore interaction have used a microarray which was developed from cDNAs identified by pre-genomic differential screening techniques such as differential display, cDNA-AFLP, and subtractive hybridization (see Chapter 2 for a discussion of these techniques; Halitschke et al. 2003; Hui et al. 2003). Despite the small number of genes on the array (initially 241), which precludes a truly genome-wide inventory of expression change, the use of a targeted approach proved to be quite succesful. Development of small boutique
STRESS RESPONSES
arrays, encompassing a focused selection of cDNAs from genes relevant in a certain context, is a good strategy for ecological laboratories working with incompletely sequenced organisms (Held et al. 2004). Later the herbivore stress array was extended to 789 probes, represented by 50-mer oligonucleotides (Heidel and Baldwin 2004). The studies on the tobacco herbivore community have revealed interesting patterns of herbivorespecific gene expressions (Heidel and Baldwin 2004; Voelckel et al. 2004; Voelckel and Baldwin 2004). Comparisons were made between transcription profiles induced by different species of chewing lepidopteran: M. sexta (Sphingidae), a specialist herbivore, and two generalists, Heliothis virescens and Spodoptera exigua (both Noctuidae). Chemical analysis had shown that the composition of stress elicitors (FACs) in the regurgitate of these species is varied. The M. sexta regurgitate is dominated by a FAC named N-linolenoyll-glutamate. This is absent in the other two species, which both have a compound known as volicitin, or N-(17-hydroxylinolenoyl)-l-glutamine. The reason for these specific-specific FAC profiles is unknown; maybe they relate to different substrate specificities of biotransformation enzymes of the insects’ xenobiotic metabolism. The FAC profiles were correlated with herbivore-induced gene expression in the plant; there was a large overlap between the transcriptional profiles of the two noctuids, whereas the overlap between either of the noctuids and M. sexta was much smaller (Voelckel and Baldwin 2004). Other differences between herbivore-elicited transcriptional profiles were observed in a comparison of diverging herbivore-feeding guilds. Chewing herbivores such as sphingid and noctuid caterpillars consume pieces of leaf tissue completely; however, mirid bugs (Heteroptera, Miridae) puncture holes in the tissue and feed on the cell contents, while aphids insert their stylet between the cells and suck only the phloem. Comparing M. sexta, Tupiocoris notatus (Heteroptera, Miridae), and Myzus nicotianae (Homoptera, Aphididae) Voelckel et al. (2004) observed that the aphids elicited only weak responses, both in a qualitative sense (fewer genes affected) and in a
243
quantitative sense (fold regulations were lower). An overview of the differences in terms of numbers of genes is given in Fig. 6.15. Thus the herbivore-induced transcriptomic changes could be proportional to the degree of damage caused by the herbivore. It is also relevant to note that FACs or other elicitors have never been isolated from aphids (Moran et al. 2002). Interestingly, Voelckel et al. (2004) found a plant gene encoding the enzyme glutamate synthase to be induced by aphid feeding, but not by the other two herbivores. This could indicate an alteration of the plant amino
(a) M. sexta 7
23
1 3 M. nicotianae
T. notatus 1 11
3
(b) M. sexta 32
26
1 6 M. nicotianae
T. notatus 2 11
2
Figure 6.15 Venn diagram of the number of cDNAs showing differential expression in N. attenuata in response to three herbivorous insects, M. sexta (Lepidoptera, Sphingidae), Tupiocoris notatus (Heteroptera, Miridae), and Myzus nicotianae (Homoptera, Aphididae). The different feeding modes employed by these herbivores induce distinct but overlapping gene expression, with the largest overlap between M. sexta and T. notatus. (a) Upregulated genes; (b) downregulated genes. After Voelckel et al. (2004), by permission of Blackwell Science.
244
INTRODUCTION TO ECOLOGICAL GENOMICS
acid metabolism imposed by the aphid. Amino acids are a limiting resource for aphid growth and any upregulation of their concentration in the phloem would greatly benefit the aphid. These data added to an earlier study by Moran et al. (2002) suggest that plant responses to aphids are fundamentally different from responses to chewing herbivores. The response to aphids has less of a wounding signature and includes facilitation of the host plant by the herbivore. Our short account of the defence mechanisms associated with plant–herbivore interactions demonstrates that there are still important gaps in our knowledge. On the mechanistic side, the source of stress elicitors in the plant-feeding insect is not known and also the plant receptor upon which these elicitors act remains to be elucidated. On the ecological side, the tritrophic aspect of herbivore defence needs more attention, as well as the way in which the different stress responses interact with different feeding groups of herbivores. These questions indicate that genomic analysis of plant–herbivore interaction represents a highly promising research area, where genomics meets ecology, with pay-offs to both sides.
6.4.2 Genomics of the immune response in Drosophila In Chapter 3 we saw that the genomes of invertebrates, including the tunicate Ci. intestinalis, do not encode proteins of the adaptive immune system, which only evolved in the vertebrate lineage, to supplement the older innate immune system. The adaptive immune system is to be considered as a major evolutionary innovation: it is specific to particular antigens, it shows an extremely large diversity, partly inherited and partly acquired during maturation of the system, and it builds up a memory of previous antigen encounters. The latter property implies that when an antigen reacts with a clone of cells with specificity for that antigen, these clones expand greatly and adapt to give the highest possible specificity for the antigen. All these properties are lacking in the innate immune system, which constitutes a general first-line defence with low specificity.
The organization of the innate immune response of invertebrates shows many similarities with the vertebrate innate response, suggesting that they have a common origin, and that defence against microorganisms was already a priority in the first metazoans (Hoffmann and Reichhart 2002). Research on the innate immune response has greatly benefitted from the use of Drosophila as a model and some important molecules involved, such as the antifungal compound drosomycin, were first isolated from Drosophila. Studies in Drosophila can reveal aspects of the human innate immune response that may otherwise be obscured by the adaptive response (Govind and Nehm 2004). In addition, the evolutionary conservation of the innate immune system implies that the principles discovered in Drosophila have a general validity for all animals. The link between between immunology and ecology is only weakly developed at the moment. Without doubt, pathogens are a very important aspect of ecological functioning, in both plants and animals. Diseases can limit the distribution of species or prevent their establishment in newly colonized habitats. Lee and Klasing (2004) therefore called for a role of immunology in invasion biology. Disease and parasitism are also potent evolutionary driving forces. Continued adaptation to parasites was implicated in Van Valen’s (1973) Red Queen hypothesis, which holds that evolution is very much in line with the remark made by the Red Queen, whom Alice met in Lewis Carroll’s famous book Through the Looking Glass, saying ‘Here you see, it takes all the running you can do to keep in the same place’. Still, the number of studies that bridge the two fields, ecology and immunology, is limited. An interesting target of investigation in ecological immunology is the major histocompatibility complex (MHC), a large cluster of genes encoding proteins involved in the adaptive immune response of vertebrates. MHC proteins bind to specific recognition sites of antigens and present them on the surface of leucocytes. A part of the molecule, a cup-like structure responsible for the recognition of a specific topographical structure of the antigenic molecule (the epitope), shows an
STRESS RESPONSES
extremely high degree of sequence polymorphism. The MHC genes are therefore interesting markers for resolving population structure and dispersal (Beebee and Rowe 2004). Beebee and Rowe (2004) also discuss the possibility that the striking polymorphism of the MHC complex is maintained partly by selective mate choice. Obviously, genetic variation of MHC genes may be the cause of differential susceptibility to disease, although not many studies have actually demonstrated this in an ecological context. A case in point is a study on Atlantic salmon, Salmo salar (Salmoniformes, Salmonidae), in which an association has been found between allele frequencies at the MHC IIB locus and susceptibility to bacterial infection (Langefors et al. 2001). One of the alleles had a particularly high frequency among fish resistant to the enteric pathogen Aeromonas salmonicida (Deltaproteobacteria). The innate immune system, although less specific than the adaptive system, nevertheless shows considerable transcriptional change upon infection. This has become obvious from studies in Drosophila, which we discuss here to illustrate the genome-wide nature of immune responses and the signalling pathways involved (De Gregorio et al. 2001; Irving et al. 2001; Dionne and Schneider 2002; Govind and Nehm 2004). Microbial infection in Drosophila activates a number of processes. One cascade leads to blood coagulation at the site of infection followed by the production of melanin, which is toxic to microorganisms. This process of melanization is accompanied by encapsulation of the pathogen. Another reaction is a massive synthesis of antimicrobial peptides by the fat body; these peptides bind to specific surface molecules of bacteria and other invaders. Third, blood cells analogous to mammalian macrophages become active as microbe engulfers. The responses of the innate immune system are controlled by two signalling pathways, Toll and immune deficiency (Imd; Fig. 6.16). The Toll protein is a membrane-bound system with an extracellular receptor that recognizes a cytokine called Spa¨tzle. However, the Spa¨tzle protein must first be cleaved to become active, and this is achieved by means of a proteolytic cascade originating from the
245
infection. Activation of Toll triggers an cytoplasmic signalling pathway converging on two transcription factors of the nuclear factor-kB family called DIF and DORSAL, which translocate to the nucleus and promote transcriptional activation of a number of antimicrobial peptides. The Toll cascade is mainly directed towards pathogenic fungi and Gram-positive bacteria and it includes the antifungal protein drosomycin. Compared to Toll, the Imd pathway is less well described and the extracellular cascades triggering the receptor remain undefined at the moment. Imd signalling may activate caspases leading to apoptosis of the cell, but it may also act upon a protein complex called IKK signalosome, where a transcription factor called RELISH is activated. RELISH promotes transcription of genes encoding peptides directed towards Gram-negative bacteria (Fig. 6.16). Infection of Drosophila with the Gram-negative bacterium E. coli, the Gram-positive Micrococcus luteus, and the entomopathogenic fungus Beauveria bassiana (Hyphomycetes) leads to a transcriptional response in genes from many different functional classes, including actin-associated proteins, calcium-binding proteins, cell-adhesion proteins, heat-shock proteins, and many others. Also the Toll and Imd genes were induced. In total 543 genes were found to be differentially expressed (Irving et al. 2001), which nevertheless seems a modest number in comparison to some of the abiotic stress responses discussed above. Irving et al. (2001) could not find specific signatures for infection by Gram-positive bacteria, Gram-negative bacteria, or fungi; however, bacterial infection seemed to regulate a larger number of genes than fungal infection. De Gregorio et al. (2001) selected a set of 400 Drosophila genes as immune-regulated, of which 230 were induced and 170 repressed. Among these genes a large number had not previously been associated with the immune response and only 34% could be assigned a designated immunological function. An overview of functional classification of immune-regulated genes of Drosophila is provided in Table 6.7. Several genes had already been identified as immune-regulated in previous studies, but many more were added to the list.
246
INTRODUCTION TO ECOLOGICAL GENOMICS
Fungi GNBP3 NECROTIC PERSEPHONE
TOLL1
dMyD88 DD
DIF
DD TUBE DD PELLE
Drosomycin and other immune-response genes
Gram-positive bacteria Apoptosis
Cytoplasm
dIKK-γ dIKK-β
dTAB2 dTAK1
REL
PGRP -LC IMD (RIP) DD dFADD
Nucleus
REL
Gramnegative bacteria
RELISH
Relish processing
DREDD caspase
DORSAL
CACTUS
DIF
DORSAL
Spätzle
SEMMELWEIS
Nucleus
Cytoplasm
Diptericin and other IKK signalosome immune-response genes
Figure 6.16 Scheme of two signal transduction pathways of the innative immune response in Drosophila. (a) The Toll pathway, which is characterized by a proteolytic cascade, cleavage of Spa¨tzle, activation of transcription factors DIF and DORSAL, and production of peptides directed against fungi and Gram-positive bacteria. (b) The Imd pathway, converging on the transcription factor RELISH and the production of peptides directed against Gram-negative bacteria. DD, death domain; this is a heterodimerization domain present in several proteins involved in signal transduction, originally described for proteins involved with cell death. PGRP-LC, peptidoglycan-recognition protein LC, where LC stands for low complexity, a certain class of bacterial surface proteins. d before a protein name indicates Drosophila; e.g. dMyD88 is the Drosophila homologue of MyD88, a macrophage differentiation marker. For more information on the other protein identifiers, the reader is referred to Flybase (http://flybase.bio.indiana.edu). Reproduced from Govind and Nehm (2004).
A surprising aspect of the genomic inventory was the large number of trypsin-like serine proteases and the many antimicrobial peptides of unknown function. Maybe these induced proteins represent new classes of antimicrobial action. Another unexpected property of the genomic immune response was that it involved sequestration of extracellular iron. What the immune response has to do with iron metabolism is difficult to see, but maybe the role of iron as a catalyst of ROS is relevant in this respect. A change in cellular iron trafficking was also seen in the response of plants to abiotic stress (see Section 6.3). The two pioneering genomic studies on the immune response of Drosophila leave many questions unanswered (Dionne and Schneider 2002). For
example, it is unclear to what extent the responses are due to wounding alone. The plant studies discussed above have demonstrated that damaging a tissue can already activate some 50 genes. In addition, the large number of genes with unclear function in the immune response makes interpretation difficult. Further work on mutants may help to resolve these issues. It is also expected that the knowledge on innate immune responses in Drosophila will be an important guide to explore the immune system of vectors of human disease, such as the malaria mosquito, An. gambiae (Dimopoulos et al. 2000; Osta et al. 2004). In addition, the conclusion regarding the ecological relevance of immunogenomics must come from field studies assessing genome-wide immune responses in wild animals.
STRESS RESPONSES
247
Table 6.7 List of functional categories of genes induced by septic injury (Gram-positive and Gram-negative bacteria) and fungal infection in D. melanogaster Gene categories
Functional significance
Recognition and phagocytosis Peptidoglycan-binding proteins Imaginal-disc growth factor proteins Thiolester proteins
Bind to cell envelope of Gram-positive bacteria Stimulate cell growth required for wound healing Forming a complement by binding to invader surface
Serine protease cascades Trypsin-like serine proteases Serpins Serine protease inhibitors of the Kunitz family Melanization and coagulation Pro-phenoloxidase activating enzymes
6.5
Extracellular signalling molecules of the Toll pathway Inhibition of trypsin-like serine proteases Possibly similar to serpins, but not previously implicated in immune response
Fibrinogen-like protein
Proteolytical activation of phenoloxidase from its precursor, conversion of dopamine to melanin Possible role in blood clotting
Antimicrobial peptides Drosomycin IM-2
Protein toxic to fungal metabolism Small antimicrobial protein, precise function unknown
Signalling pathways Cytokine-like small peptides Genes of the Toll pathway Genes of the Imd pathway Proteins of JNK signalling pathway
Activation of stress signalling pathways Regulation of antifungal peptide production Regulation of antibacterial peptide production General stress response (see Section 6.2)
Iron metabolism Transferrins and iron transporters
Sequestration of extracellular iron
Toxic substances
The study of ecological effects of toxic substances in the environment is designated as ecotoxicology (Walker et al. 2001). This multidisciplinary science is a meeting place of environmental chemists, toxicologists, and ecologists. Chemists determine the concentration of substances in the environment and study their distribution over environmental compartments and chemical ligands; toxicologists analyse uptake kinetics, biotransformation, and metabolic effects of toxicants; ecologists study the effects of toxic insults at the population, community, and ecosystem levels. Ecotoxicology traditionally has a strong link with environmental policy. Through this link, scientific support is provided for decisions about issues like standard setting, remediation of contaminated sites, and pesticide registration. In industrialized countries new substances are produced continuously, but
their application in society is regulated by safety requirements concerning human and environmental health. Most legislatory systems require that new substances must be tested for their possible adverse effects on ecological receptors before they are admitted to the market. A well-known principle in toxicology is that toxicity is not an absolute property of a substance, but that the effect of a substance depends on the dose given to the organism. The classical poison is effective in very low amounts, but in principle all substances can be toxic if dosed highly enough. This was recognized already by the Austrian alchemist and physician A.P.T.B. von Hohenheim (1493–1541), better known as Paracelsus, who wrote (Koeman 1996): Alle Ding sind Gifft . . . allein die Dosis macht das ein Ding kein Gifft is (Everything is a poison . . . it is only the dose that makes it not a poison).
248
INTRODUCTION TO ECOLOGICAL GENOMICS
Following the Paracelsus principle, an important activity of toxicologists is the establishment of dose–effect relationships, which in ecotoxicology usually take the form of a graph in which some aspect of the performance of a tested organism (e.g. growth or reproduction) is plotted as a function of the concentration of a given toxicant in water, soil, or air. From such a graph two important benchmarks are estimated, the exposure concentration at which a 50% effect is observed (EC50) and the highest exposure at which still no effect is seen (NEC, no effect concentration). Ecotoxicologists are usually concerned with effects that show up after chronic (long-term) exposure and, unlike human toxicologists, study end points that are important for the ecological functions of an organism. In the case of animals, many ecological functions are associated with feeding and behaviour—for example, macroinvertebrates grazing to suppress algal blooms, or earthworm burrowing to improve soil structure—that is why end points in ecotoxicology can be different from those in human toxicology. The application of genomic technology in toxicology is called toxicogenomics (Lovett 2000; Pennie et al. 2000; Burczinsky 2003; Waters and Fostel 2004), and its ecological counterpart as ecotoxicogenomics (Snape et al. 2004). An important aim of toxicogenomics is to characterize the mode of action of toxicants on the basis of expression profiles. When two toxicants induce the same set of genes in a target organ, they are likely to have the same mode of action (Hamadeh et al. 2002). New substances, such as drugs, industrial chemicals, or pesticides, can be screened for their transcription profile and when the profile is compared with a database of earlier-investigated chemicals any similarities may provide an indication of the hazardous properties of the compound. The first commercial microarrays, designed to screen induction of enzymes in the human liver, were developed at the end of the twentieth century. It is likely that such tools will also be developed for environmental applications, but standardized assays are not yet available. In this section we will address the question of how genomic technology can improve our insight
into ecotoxicity of environmental chemicals. Out of the huge number of chemicals that may cause environmental problems we have selected three classes of toxicant: heavy metals, pesticides, and endocrine disrupters. These three groups have very different environmental effects and serve to illustrate the principles of ecotoxicogenomics.
6.5.1
Heavy metals
Under the term heavy metal fall all elements in the Earth’s crust with a density of greater than 5 g/cm2 in their metallic form. Thus defined, a large proportion of the periodic table of elements belongs to this category; however, many heavy metals are very rare or extremely unavailable and are of no environmental concern. The toxicity of heavy metals is not due to the metal itself, but to ionic forms and other chemical species (e.g. Pb2 þ , 2 HgCHþ 3 , and Cr2O7 ). The active and toxic form of a metal usually constitutes only a small proportion of the total concentration in an environmental compartment, and depends on properties of the environment as well as the metal. One of the most important influences is due to environmental pH: a low pH promotes dissociation of metal complexes and may increase the fraction of metal present in ionic form without changing the total concentration. The dynamic processes occurring at the interface of environmental ligands and biotic surfaces are studied under the heading of bioavailability. Unfortunately, bioavailability is usually ignored in laboratory toxicity experiments, and many of the toxicity data reported in the literature refer to artificial media in which the speciation of metals is biased towards a high fraction of free, ionic metal forms. Total concentrations in such studies cannot be extrapolated easily to the environment. This also holds for most of the toxicogenomic studies using heavy metals. Studies in yeast were the first to reveal the genome-wide effects of exposure to heavy metals (Gross et al. 2000; Momose and Iwahashi 2001; Vido et al. 2001; Eide 2001). Many yeast genes are induced by cadmium, including obvious genes such as heat-shock proteins, but also unexpected genes, such as genes related to the synthesis of
STRESS RESPONSES
249
understandable since cadmium is a sulphurseeking metal and its detoxification requires the sulphur-containing amino acid cysteine. In addition, cadmium introduces oxidative stress, which,
methionine. In fact, the whole sulphur-salvage pathway, including sulphate uptake, sulphate reduction, methionine synthesis, and glutathione synthesis, was upregulated (Fig. 6.17). This is all
Extracellular sulphate SUL1 SUL2
MET4 MET31 MET32 Transcriptional activator CBF1 MET28 MET4
SCF(MET30)
Aspartate
Asparatic-βsemialdehyde NADH HOM6 NAD+ Homoserine
Sulphate uptake
Intracellular sulphate SO42– ATP MET3 PPi
5⬘-Adenylylsulphate(APS) ATP MET14 ADP Phosphoadenosive phosphosulphate (PAPS) NADPH MET16 PAP+NADP+ Sulphite SO 2– 3 MET5(ECM17) 2NADPH MET10 2NADP– Sulphide S2– MET17(MET15,MET25)
MET2
Acetyl-CoA
O-Acetylhomoserine Homocysteine
CoA MET6
Serine CYS4(STR4)
methionine
S-Adenosylhomocysteine SAM2 CH3 S-Adenosylhomocysteine
CH3
Cystathionine
ATP PPi+ Pi
S-Adenosylmethionine
CYS3(STR3) O-acetyl Cysteine homoserine
Glutamic acid ATP GSH1 ADP + Pi
MUP1 MUP3 Methionine uptake
γ-Glutamyl cysteine Glycine ATP
GSH2 ADP + Pi Glutathione(GSH) Chemicals GTT2 GTT1
NAD(P)+
H2O2 HYR1 O2
TTR1 NAD(P)H Detoxification
GSSG
Figure 6.17 Effects of cadmium on the sulphur-salvage pathway of yeast (S. cerevisiae). The pathway starts with uptake of sulphate, followed by the formation of phosphoadenosine phosphosulphate (PAPS), sulphate reduction, synthesis of cysteine, methionine, and glutathione (GSSG). Genes found to be upregulated by cadmium are indicated with an oblique arrow next to the name. After Momose and Iwahashi (2001) by permission of the Society of Environmental Toxicology and Chemistry.
250
INTRODUCTION TO ECOLOGICAL GENOMICS
as we have seen above, is counteracted by means of enzymes such as glutathione S-transferase, which again requires reduced sulphur. Interestingly, Momose and Iwahashi (2001) as well as Vido et al. (2001) did not find induction of metallothionein when yeast cells were exposed to cadmium. Yeast has a copper-binding metallothionein (CUP1) that is induced by copper, but not by cadmium. Instead, cadmium in yeast follows a glutathione-dominated pathway, comparable to the phytochelatin pathway of zinc in plants and invertebrates. This is consistent with the finding that among the strongly upregulated genes was a transporter of metal-glutathione, which translocates metals to the vacuole. Metallothionein in yeast is more strongly induced by oxidative stress than by cadmium; however, at higher doses cadmium also causes oxidative stress, so the two effects are difficult to separate in practice. When analysing the promoter sequences of genes affected by cadmium, Momose and Iwahashi (2001) noted that many of them had a sequence motif known as centromere DNA element I, CDEI. This element binds a transcription factor Cbf1, which is known to regulate the sulphur amino acid-biosynthesis pathway. The results of Momose and Iwahashi (2001) suggest that this pathway is also activated under cadmium stress, maybe through the depletion of glutathione. It is well known among toxicologists that glutathione depletion is a common consequence of oxidative stress and metal stress (see Section 6.2). All in all, the yeast study is a nice example of how the results of a transcription-profiling exercise can be understood from mechanistic knowledge of the underlying processes.
6.5.2
Pesticides
Pesticides, also called crop-protection products, represent a wide range of chemical substances, most of them organic, often with very complex structures, designed for a specific target in the pest organism. Despite the intention of combating only pests, no pesticide is 100% selective against the pest and almost all pesticides have greater or smaller side effects on non-target organisms. Such
side effects can be manifested in places far away from the site of application if the pesticide is persistent and transported easily by air or water. Modern pesticides are short-lived and effective in very low doses. It is expected that genomic analysis will contribute to a more sensitive assessment of possible side effects and to an ever increasing precision in the development of new products. This expectation is reflected by the interest in toxicogenomics shown by the pesticide industry. In contrast to heavy metals, pesticides are designed to affect a specific biochemical target, such as a single photosynthesis protein, a specific ion channel in the nervous system, or a key enzyme in a biosynthetic pathway. The biochemical damage caused by reacting with such a specific target is called the primary lesion. An example is the reaction of organophosphate insecticides with the enzyme acetylcholinesterase, which when inhibited will cause accumulation of acetylcholine, a neurotransmitter, in the synaptic cleft, leading to uncoordinated behaviour, spasms, and mortality in insects. From this fundamental toxicological principle one would expect that gene-expression profiles induced by pesticides would be limited to a small fraction of the genome. This appears not to be the case. Most pesticides, when administered to organisms outside of the context of agriculture, are less selective than expected. We discuss a few examples to illustrate this point. Paraquat (1,1 0 -dimethyl-4,4 0 -dipyridilium dichloride) is a herbicide used to kill weeds prior to emergence of the crop and to destroy foliage of crops such as potatoes in preparation for harvesting. Under the influence of UV light paraquat enters into a redox-cycling process, producing large amounts of ROS that destroy the surface of leaves in an aspecific manner. Such redox cycles are also triggered easily inside organisms once paraquat is activated by cytochrome P450. Because of this bioactivation, paraquat is rather toxic to humans, with lung damage being the first apparent effect. Due to its ability to generate ROS, paraquat is often used as a model agent to impose oxidative stress on animals in the laboratory. Girardot et al. (2004) exposed D. melanogaster to paraquat and two other oxidative stress agents,
STRESS RESPONSES
H2O2 and tunicamycin, and assessed gene expression using the Affymetrix Drosophila Genome Array. No fewer than 1111 genes (12% of the probes) were found to be up- or downregulated in flies exposed to the highest dose, illustrating the genome-wide nature of oxidativestress defence. The genes included many representatives of the general stress response, such as cytochrome P450s, glutathione S-transferases, peptidases, and triacylglycol lipases. These expressions are all indicative of increased effort towards detoxification, removal of damaged proteins, and repair of membrane lipids. A notable aspect was that iron-binding proteins were specifically induced by paraquat. As noted above, effects on iron metabolism are observed in many different contexts (drought stress in Arabidopsis, hypoxia in fish, and microbial infection in Drosophila), suggesting that changes in iron metabolism are a part of the general stress response. A striking feature revealed by the paraquat study was that some of the expression was highly
251
specific to a family of isoenzymes. This was very obvious in the cases of the cytochrome P450s and the glutathione S-transferases. As illustrated in Fig. 6.18, Cyp9b2 was hardly affected by paraquat, Cypb18a1 was repressed, and Cypb4e3 was greatly induced. Similarly, glutathione S-transferase E10 was downregulated, but glutathione S-transferase D5 was upregulated. A similar gene-specific inducibility was found among the cytochrome P450s of C. elegans (Menzel et al. 2001). Among the 10 CYP35 genes of the nematode, four were found to be induced strongly by a few specific substrates, four were induced weakly by a wide range of substrates, and two were not inducible at all. This variation reflects the different modes of cytochrome P450 induction, as highlighted in Fig. 6.9. Monitoring gene expression in organisms in the wild is often proposed as a strategy to evaluate exposure to pollutants in the environment (e.g. Snell et al. 2003). The observations of Girardot et al. (2004) make it very clear that such measurements need to be specific to a particular isozyme to be of
4 Q-RT-PCR
3
Microarray
Ln2 (Fold change)
2 1 0 –1
P15 P5 H1 T12
–2 –3 –4 –5
Cyp9b2
Cyp18a1
Cyp4e3
GstE10
GstD5
Figure 6.18 Fold regulation of five D. melanogaster genes observed when male adults were exposed for 24 h to 15 mM paraquat in the medium (P15), 5 mM paraquat (P5), 1% H2O2 (H1), or 12 mM tunicamycin (T12). Data are shown for two methods of differential expression screening: quantitative PCR applied to reverse-transcribed mRNA (Q-RT-PCR) and microarray hybridization. Cyp, cytochrome P450 (three isoenzymes are shown); Gst, glutathione S-transferase (two isoenzymes). After Girardot et al. (2004) with permission from BioMed Central.
252
INTRODUCTION TO ECOLOGICAL GENOMICS
any indicative value. This means that the probes on a microarray must be able to discriminate between the various isoforms within gene families. Such specificity is easier to achieve with quantitative PCR (see Section 2.3) than with cDNA microarrays; in the study of Girardot et al. (2004) there was a very good correspondence between Q-RT-PCR measurements of expression and microarray hybridizations (Fig. 6.18). Whereas the study on paraquat was a typical mechanistic laboratory analysis without direct relevance to environmental exposure, similar transcription-profiling protocols are being developed with the aim of applying them to animals exposed to pesticides or other pollutants in the wild (Sultan et al. 2000; Fredrickson et al. 2001; Bultelle et al. 2002; Miracle et al. 2003; Perkins and Lotufo 2003; Azumi et al. 2004; Sansone et al. 2004; Straub et al. 2004; Miracle and Ankley 2005). Most of these studies are still at the stage of method development: the major activities are collection of differentially expressed clones and checking of the reproducibility of microarray screening. Studies in the coastal marine environment have progressed furthest at the moment, because the application of physiological and molecular markers in monitoring programmes, such as ‘mussel watch’, was started earlier there than in other environmental compartments. We will discuss one marine study to illustrate the direction that the field is taking. Pacific oyster, Crassostrea gigas (Bivalvia, Ostreidae), live in coastal marine habitats and are exposed to pesticides from surface run-off and river discharge. In particular water-soluble and persistent herbicides such as atrazine, diuron, and isoproturon (Fig. 6.19) can reach estuarine and coastal environments from agricultural run-off and river discharge. To assess the stress response of oysters exposed to herbicides, Tanguy et al. (2005) developed forward and reverse SSH libraries (see Section 2.1) from the gills and digestive glands of animals exposed to a cocktail of the three herbicides shown in Fig. 6.19. Some 137 sequences were retrieved as showing differential expression and the genes could be assigned to six major metabolic functions: (i) xenobiotic detoxification, (ii) nucleic acid and protein regulation,
(a)
H
H2 C
N
H 3C
H 3C
CH-CH3
N N
N N
H
CI (b)
CI O C
CI
(c)
H 3C
CH3
N
N
H
CH3
O
N
CH3
C
N
H 3C H
C
H
CH3
Figure 6.19 Structural formulae of three water-soluble and relatively persistent herbicides: (a) atrazine (6-chloro- N-ethylN-isopropyl-1,3,5-triazine-2,4-diamine), (b) diuron (3-(3,4dichlorophenyl)-1,1-dimethyl ureum), and (c) isoproturon (3-(4-isopropyl)phenyl-1,1-dimethyl ureum).
(iii) respiration, (iv) cell communication, (v) cytoskeleton maintenance, and (vi) energy metabolism. Among the genes consistently upregulated by herbicide exposure was a glutamine synthetase. The enzyme encoded by this gene plays an important role in detoxification of ammonia, synthesis of glutamine, and clearance of glutamate as a neurotransmitter. How these functions relate to pesticide exposure is unclear; however, induction by a wide variety of compounds suggests that glutamine synthetase is part of a general stress response rather than a specific detoxification pathway. It is also interesting to note from this study that even at relatively low and environmentally relevant exposure concentrations (0.5–2 mg/l) many genes are regulated by herbicides, even though herbicides are not known for their great toxicity to animals. The altered transcriptional profile
STRESS RESPONSES
indicates a broad metabolic effect including a general upregulation of energy production. What the long-term effects of this alteration may be remains uncertain; however, the gene-expression changes seen by Tanguy et al. (2005) are consistent with earlier physiological measurements on mussels, in which energy metabolism, often expressed as scope for growth, is one of the most sensitive indicators of pollution (Bayne 1989). The data suggest that bivalves in the marine environment possess great flexibility to respond to xenobiotic exposure with adequate transcriptional change, but that this change could alter their filtration capacity and so their ecological functioning in the long term.
6.5.3
Endocrine disrupters
Towards the end of the 1990s environmental scientists began to realize that a wide variety of chemicals in the environment could disrupt endocrine functions of animals. The initial discovery was made by Soto et al. (1991), who reported that breast cancer cells sensitive to oestrogen responded to a then-unknown compound leaching in very low amounts from laboratory plasticware made of polystyrene (Colborn et al. 1996). The compound was identified as p-nonylphenol, one of a family of synthetic chemicals called alkylphenols, which are added to polystyrene and polyvinylchloride to improve stability of the plastic. Alkylphenols are also produced as biodegradation products of alkyl polyethoxylate detergents, and are therefore found in sewage effluent and wastewater from septic tanks. The effect of nonylphenol on oestrogen-sensitive cells appeared to be due to its binding to the oestrogen receptor, one of several steroid hormone-binding proteins present in the cytoplasm. When activated by oestrogen the receptor undergoes homodimerization, translocates to the nucleus and binds to oestrogen-responsive elements, regulating transcription of a great variety of genes. Although endogenous steroid hormones such as 17b-oestradiol have the greatest affinity for the oestrogen receptor, numerous compounds, of which some are very abundant in the environment, have been shown to
253
interfere with steroid hormone receptors, either as agonists (mimicking the effect of natural hormones) or antagonists (suppressing the natural action of a steroid by blocking its receptor). In addition, several environmental chemicals influence hormone metabolism by inhibiting certain forms of cytochrome P450 that metabolize steroids, for example the conversion of testosterone into oestradiol, an activity known as aromatase. Endocrine-disrupting chemicals may be pesticides or metabolites of pesticides, as well as industrial and household chemicals. Oestrogenactive compounds are also found naturally in plants, and are called phytoestrogens. A well-known case of phytoestrogen action is the occurrence of isoflavonoids in Australian clover, Trifolium subterraneum (Leguminosae), which was identified as the cause of impaired sexual performance in sheep. Phytoestrogens from soybean (Glycine max, Leguminosae) are considered as an alternative to oestrogen therapy for menopausal symptoms. Why plants would produce compounds that affect the endocrine system of vertebrates is not clear. Maybe it is just a side effect, while the main function of these compounds lies elsewhere. For example, isoflavonoids are also implicated in signalling between plants and microorganisms in the rhizosphere. Still, it is often assumed that plants have evolved phytoestrogens as a defence strategy against herbivory. If this is the case, one would expect that effects of endocrine disruptors to be more severe in carnivores than in herbivores, because herbivores have had ample opportunity to adapt to plant-derived endocrine disrupters. This prediction, forwarded by Wynne-Edwards (2001), still needs to be evaluated. Endocrine disruptors are associated with a range of adverse effects observed in terrestrial and aquatic wildlife (almost exclusively vertebrates), varying from developmental disorders to decreased fertility. One of the effects which has attracted a lot of attention is the occurrence of intersex fish due to the feminization of males. An indicator of feminization is expression of the gene Vtg, which encodes an egg-yolk protein, vitellogenin, which is normally only expressed in the female gonad. The levels of vitellogenin in male
p, (fe p ⬘ m -DD al es E )
p, (m p ⬘-D al D es E )
trout, caged in rivers at several distances from sewage-treatment facilities in the UK, were found to decrease with increasing distance from the sewage outlets (Harries et al. 1997). Following the discovery of such effects, many industrialized countries have started programmes to screen all existing chemicals for their possible endocrinedisruptive properties. That many chemicals can be labelled as potential endocrine disrupters is now beyond doubt. Laboratory studies have demonstrated that anticonception oestrogens, alkylphenols, phthalates, and some organochlorine pesticides can cause reproductive disorders in fish in the nanogram and lowmicrogram per litre range (Mathiessen 2000; Mills and Chichester 2005; Sumpter 2005). However, evidence that these chemicals actually impair populations of fish in the wild is less convincing. One of the problems is the lack of reliable and sensitive methods to assess the reproductive status of wild fish. Against this background, endocrine disruption recently became a favourite model for studies in ecotoxicogenomics. Because steroid hormone receptors are regulators of gene expression, any agonistic or antagonistic impact on such receptors should be clearly visible in transcription profiles. Larkin et al. (2002) developed a screening method for profiling 132 genes in largemouth bass, Micropterus salmoides (Perciformes, Centrarchidae). Their ‘boutique’ gene array was used subsequently to assess transcriptional profiles in fish exposed to p-nonylphenol and DDE (2,2-bis(p-chlorophenyl)1,1-dichloroethylene), a degradation product of the insecticide DDT (2,2-bis(p-chlorophenyl)-1,1,1trichloroethane) and a suspect hormone disrupter. Oestradiol was used as a positive control. As Fig. 6.20 shows, there was considerable overlap between the expression profiles of nonylphenol and oestradiol. Four vitellogenin genes were induced, plus two choriogenins. These effects were expected because it is known that oestradiol induces the production of yolk proteins as part of the process of oogenesis. Induction of aspartic protease may also be related to this process, since work on zebrafish has suggested that this enzyme plays a role in post-translational processing of vitellogenin in the liver prior to secretion into the
4N P
INTRODUCTION TO ECOLOGICAL GENOMICS
E 2
254
Transferrin 53-1 107-1 Chemotaxin 50-1 118-1 Androgen receptor 128-1 120-1 71-1 Signal peptidase 47-2 Aldose reductase 24-1 34-1 23-1 136-1 132-2 PDI 92-1 101-1 Vtg. 3 Aspartic protease Choriogenin 3 Choriogenin 2 Vtg. 2A Vtg. 1 Vtg. 2
Figure 6.20 Summary of gene-expression changes in largemouth bass (Micropterus salmoides) exposed to oestradiol (E2), p-nonylphenol (4-NP), and p,p 0 -DDE, a stable degradation product of DDT. Genes upregulated are shown by dark-grey shading; genes downregulated are shown by light-grey shading. Vtg, vitellogenin; PDI, protein disulphide isomerase. Genes with unknown function are indicated by codes. After Larkin et al. (2002) with permission from Elsevier.
bloodstream. The role of the other genes in the steroid hormone response is less clear. Interestingly, some genes were regulated by nonylphenol but not by oestradiol. This suggests that nonylphenol cannot be considered a pure oestrogen mimic but must have additional modes of action that are independent of the oestrogen receptor. The same conclusion was reached in a proteomics study on zebrafish by Shrader et al. (2003; see Fig. 1.8). The compound DDE downregulated several oestrogenresponsive genes and a number of others (Fig. 6.20). It was striking that DDE had a much stronger effect
STRESS RESPONSES
on females than on males. This compound obviously interferes with fish reproduction but its mode of action requires further investigation. A synthetic view of the mode of action of endocrine disrupters such as nonylphenol is not yet available. It may be expected that the picture will be quite complicated. There are several different steroid hormone receptors in the cell that can be activated by steroids such as testosterone, oestradiol, cortisol, progesterone, and others. Endocrine disrupters may activate but also inactivate these receptors; in addition, some endocrine disrupters also interact with the receptors for thyroid hormone and retinoids and the cascades triggered by these receptors may interact with steroid hormone transcriptional activation. This suggests that hormone disruption is not to be considered as a simple linear process. A genomewide understanding of endocrine disruption in fish will probably only come from species with completely sequenced genomes, such as zebrafish. This example of endocrine disruption completes our short overview of ecotoxicogenomics. It is obvious that this subdiscipline of ecological genomics is lagging behind considerably in comparison with other areas of stress ecology, such as abiotic stress in plants. A question specific to ecotoxicogenomics is what would be the role of genomics techniques in the risk assessment of chemicals? Bishop et al. (2001) analysed the situation and made three recommendations that we endorse: (i) risk assessors must be proactive and involved in identifying research issues that ecotoxicogenomicists should address, (ii) risk assessors must assist genome investigators in finding ways of interpreting gene-expression data that support insights into hazards and dose–effect relationships, and (iii) there must be a continuing and effective dialogue in both directions, so as to maximize information exchange in a way that can inform policy decisions.
6.6 Genomic approaches to ecological stress: an appraisal We started this chapter by framing stress responses in the context of the ecological niche. Have the genomic insights reviewed in this chapter
255
deepened our insight into what constitutes the boundaries of the ecological niche? It seems fair to admit that, more than in the case of community ecology (Chapter 4) and life-history analysis (Chapter 5), genomics and niche theory still seem to exist on different planets. It may be that our charge for this chapter was a bit too ambitious; however, some general principles have emerged that can help us to connect the two disciplines. We have seen that stress factors in the environment can impinge on many aspects of the metabolism of cells. Outlines were given for several pathways that translate stress signals into gene expression. Although the details vary per pathway, some common properties emerge: (i) in the case of physical stress, deviation from normal conditions is noted by a stress-specific sensing system, (ii) in the case of chemical stress, there is a specific interaction with a cytosolic receptor protein, (iii) some stress pathways have a system of double-negative control—that is, stress removes the degradation of an activator, (iv) the stress signal is transduced via a more or less complicated network, often involving protein kinases, (v) there is a lot of interaction (crosstalk) between the pathways triggered by different stress signals, (vi) most stress-transduction systems converge on a transcription factor that is translocated to the nucleus, (vii) additional nuclear factors are often needed for activation of the transcription factor, (viii) gene expression is promoted by binding to specific DNA sequences, which are present in a battery of genes, and (ix) many genes have more than one transcription factor-binding site and thus are activated by more than one stress signal. We have also seen that there is both commonality and divergence in the stress response. Some aspects of the stress response, for example induction of heat-shock proteins, are very general and can be found in nearly every cell under nearly every stress. Other aspects are specific for the stressor and trigger a limited number of genes addressing the stress factor; for example, the induction of proteins preventing the growth of ice crystals in body fluids. Despite the great increase in knowledge represented by the genomic studies reviewed in this
256
INTRODUCTION TO ECOLOGICAL GENOMICS
chapter the biological significance of stressinduced transcription profiles still needs further examination. It is not impossible that environmental stress induces groups of genes that are not functionally related. In Chapter 1 we discussed a study by Spellman and Rubin (2002), who noted the presence of transcriptional territories in the genome of Drosophila: sets of physically adjacent but functionally unrelated genes that are expressed jointly in association with chromatin remodelling. Some of the unusual gene expressions observed in transcription profiles may be due to these effects. The lesson could be that it is always necessary to frame gene expression in terms of a biological scheme, such as the stress-transducing systems and transcription factor cascades discussed in this chapter. Ecological studies applying genome-wide approaches to assessing physiological stress in animals or plants under natural conditions have not yet been published. The most commonly analysed single-gene indicator of stress is Hsp70 (Feder and Hofmann 1999). Expression of heatshock proteins is used to obtain an indication of physiological stress and this may explain ecological interactions in the field. For example, Burnaford (2004) showed that a species of chiton, Katarina tunicata (Mollusca, Polyplacophora), was experiencing temperature stress during low tide on a rocky shore under unshaded conditions, and this could explain its association with a species of kelp, Hedophyllum sessile (Phaeophyta, Laminariales), under which it finds shelter. The author showed that it was abiotic stress, not predation risk or lack of food, that limited the animal’s habitat use on exposed rock surface. In this study stress was measured by Hsp70 expression; one can easily imagine how transcription profiling could further deepen the insight into explaining habitat choice and niche dimensions of organisms in the wild. The question may be asked, does the transcription profile of an organism under stress contain all the information needed to identify the nature of the stress factor? That is, can we read the cause of
stress from the transcriptome? This inverse approach to transcription profiling seems particularly relevant in an applied context, when genomics is used to assess the quality of the environment. Although it seems reasonable to assume that this question can be answered in the affirmative, up to now a proof of principle is lacking. Problems facing the inverse approach are 2-fold. In the first place, antagonism in mixtures may mask gene expressions. If one stress factor suppresses the inducing action of another a combination of the two will not be noted in the transcription profile. Studies on plant responses to abiotic stress reviewed in this chapter have shown that such antagonistic interactions may be realistic. Secondly, the inverse approach only works if there is a monotonic relationship between the intensity of the stress and the degree of gene expression. At low stress intensities this may indeed be the case, but under severe stress some genes induced by low stress may be repressed due to toxicity or other disturbing factors. In that case a low level of gene expression found in a transcription profile does not have an indicative value because it may have two different causes. In general, the student of stress responses can learn from toxicology that biological responses are always dose-dependent. Toxicologists are trained to characterize intensity and duration of exposure carefully and to always include several exposure levels in an experiment. A similar attentiveness to the exposure side of stress is often lacking in biochemical stress studies. In conclusion we note that the large gap between niche theory and genomics is fed by the fact that almost all genomic studies on stress responses are conducted in the safe environment of the laboratory. We may expect that genomic studies will now be expanded quickly to include profiling of organisms under natural conditions, in gradients of environmental stress, in extreme environments, or as a function of their distributional range. This chapter has illustrated that the genomic tools and their biochemical interpretation are ready for ecologists to take and apply.
CHAPTER 7
Integrative ecological genomics
As indicated in Chapter 1, a large part of genomics can be qualified as a science of discovery. An impressive amount of new and often unexpected information comes from sequencing genomes and analysing transcriptomes. In this book we have seen many examples of surprises that have arisen from discovery. There is, however, another side to pure discovery science: sequencing of genomes and cataloguing gene expressions are basically descriptive processes and not hypothesis-driven. We do not argue that descriptive activities are always unscientific. Every science includes an inductive phase; unprejudiced exploration is a wealthy source of new hypotheses. In fact, a large part of ecology can be characterized as mainly descriptive, especially the painstaking work conducted by field biologists who document the whereabouts of species in the wild. The point is, in good ecology this type of research is only one phase in the scientific cycle, and is followed up by hypothesis-driven research, either in the laboratory or in the field again. In the same spirit, molecular biologists are convinced that the discovery science of genomics must be followed up by integrative, hypothesis-driven, new activities. In this chapter we discuss some of the postgenomic, integrative approaches and evaluate their relevance to ecology.
7.1 The need for integration: systems biology Systems analysis has been a part of ecology for a long time. It originates in the work of Eugene P. Odum, who in his classical book Fundamentals of Ecology in 1953 made a plea for considering the
ecosystem as a unit in its own right, with characteristics that refer to the whole and that are amenable to investigation in the same way as a physiologist investigates a single organism. Odum also recognized that an ecosystem had properties that were not measurable at the levels of populations or communities but were characteristic of the system as a unitary whole. Such properties were called emergent properties. From the beginning, systems ecology relied strongly on mathematical analysis of energy fluxes and nutrient cycles, using differential equations and computer simulation. Systems ecology remained an integrative but limited part of ecology, next to the much larger fields of community and population ecology, but in the 1990s it saw a renaissance, spurred by research programmes on acid rain and climate change, which called for large-scale approaches (Schindler 1987). It is interesting to see how around the year 2000 the developments in ecology were mirrored by similar developments in molecular biology, leading to the birth of a new field, systems biology (Ideker et al. 2000; Kitano 2002). In molecular biology, the immediate cause was a feeling that the trend towards more and more reductionism was reaching its limits and in some respects was even impeding progress (Van Regenmortel 2004; Strange 2005). According to the reductionist paradigm, understanding is to be gained from studying processes underlying, and thus determining, the phenomenon of interest. Therefore biological processes should be deconstructed into their component parts and the physicochemical properties studied to achieve understanding. Reductionism argues that any biological process ultimately finds 257
258
INTRODUCTION TO ECOLOGICAL GENOMICS
its foundation in the laws of chemistry and physics. What is missing in this description is that many biological phenomena do not only depend on the properties of the component parts, but also on other biological phenomena. Gene expression takes place in a certain cellular context, which is moulded by expressions of other genes. Even the expression of a single gene may require gene products from at least 10 other genes; for example, components of the polymerase complex, transcription factors, enhancers, and modifiers. Recognizing the complexity of gene expression, molecular biologists started to analyse the network of interactions between the expression of different genes. Despite the explosive use of the term systems biology in the biochemical literature since 2004, according to Cornish-Bowden and Ca´rdenas (2005) not all activities grouped under this heading can be regarded as true systems biology. Systems biology is not to be considered as a way of integrating information from diverse components into a model of the system as a whole, it must be seen as a view on the whole to understand the parts. So systems
DNA the genetic material
DNA structure
1944
1953
Recombinant technology
biology argues from the whole to the components, not the other way around. Seen in this way, systems biology and reductionism are not necessarily in conflict with each other. Westerhoff and Palsson (2004) give an historical perspective on the origin of systems biology. These authors recognized two independent lines of development: one originating in the discovery of DNA, followed by recombinant technology, and large-scale sequencing, the other originating in non-equilibrium thermodynamics, followed by Jacob and Monod’s work on the lac operon and molecular kinetics (Fig. 7.1). The second timeline was dominated by modelling of molecular processes but this was often seen as rather theoretical and not based in ‘real’ biology due to the lack of adequate data. The quantum leap of data acquisition in the first timeline, brought about by the genomics revolution, caused a sudden convergence of the two developments and marked the birth of systems biology. The structure of systems biology can also be viewed as an activity in which the two lines of Haemophilus influenzae first genome Automated sequenced Human genome sequencing sequenced 1995
1960
1970
1980
1990
2001 2000
High-throughput at genome scale, ‘data-rich’ biology Systems analysis critical to molecular biology ‘Data poor’ in silico biology, models of viruses, red blood cell
Feedback regulation in metabolism 1931
Non-equilibrium thermodynamics
1952
1957
Selforganization
1970
1980
Large-scale simulators of metabolic dissipative structures, energy coupling Analogue simulation, MCA and BST bioenergetics, lac operon
1990
2000
Genome-scale models and analysis, large-scale kinetic models
Figure 7.1 Scheme showing how systems biology emerged at the end of the twentieth century from the convergence of two lines of enquiry that had remained separate for several decades. MCA, metabolic control analysis. From Westerhoff and Palsson (2004), by permission of Nature Publishing Group.
INTEGRATIVE ECOLOGICAL GENOMICS
inquiry delineated in Fig. 7.1 are fused into a circular process (Fig. 7.2; Kitano 2002). In this cyclic view, hypothesis-driven modelling, computer simulation, and predictions follow up genomic experiments. This part of the cycle is also called in silico biology (Palsson 2000). A tremendously important role is played by systematic perturbation of the genome using high-throughput genetic manipulation. For instance, a collection of deletion mutants is now available for essentially all genes in the genome of S. cerevisiae and tools exist for systematic manipulation of numerous genes via different constructs in many strains simultaneously. Analysing the phenotypic consequences of such genetic manipulations provides a vast and rich experimental basis on which hypotheses from computer simulation can be tested. One way in which the complexity of genomic interactions can be analysed is by considering gene expression as a network. Indeed, a great deal of systems biology is concerned with network C
cs
om
mi
o en
G
Experiment data analysis
pu
ta
Biological knowledge and contradictory issues
tio
n
Data- and hypothesisdriven modelling
‘Wet’ experiments Experiment design and experimental device development
‘Dry’ experiments (simulation)
ys
is
c Te
al
o hn
Predictions
An
lo
gy
System analysis and theory formation
Figure 7.2 Illustrating the structure of systems biology. The cycle of research is characterized by construction of models based on genomics data, followed by computer simulation (in silico or dry experimentation), which leads to prediction about the function of specific parts of a genomic network. These predictions are then tested using ‘wet’ experiments, for example genetic manipulations in the network of interest, which leads to renewed biological knowledge and refinement of models. Reprinted with permission from Kitano (2002). Copyright 2002 AAAS.
259
analysis. A first logical step in such an analysis is to group genes, proteins, and metabolites into functional units. According to the concept of modularity, the functions of a cell can be partitioned into a number of modules where membership of a module is defined by a specific task, which is separable from those of other modules. Four different types of functional module may be discerned: (i) physically delineated molecular machines such as the ribosome or the flagellum, (ii) signalling cascades, in which membership of the module is defined by initial binding of a signal molecule such as in insulin/IGF-1 signalling (Section 5.2) or MAPK (Section 6.2), (iii) collections of genes that are all regulated by the same transcription factor, such as the Ah battery (Section 6.2; these are called transcription modules), and (iv) networks defined by the processing of a substrate or a group of metabolites, for example glycolysis, Krebs cycle, or nutrient salvage (see Fig. 6.17). The greatest advances in metabolic network analysis have been made in E. coli and S. cerevisiae. One of the lines of investigation focuses on classification of genes according to regulatory modules defined by common responses to environmental conditions. Segal et al. (2003) analysed a large number of microarray experiments and proposed a classification of the yeast genome into 50 distinct modules, where each module showed a specific response to a set of conditions, while all the genes of a module were regulated in concert. For example, a ‘respiratory module’ was defined as consisting of 55 genes, of which 39 encoded respiratory proteins and six encoded enzymes of glucose metabolism. The module was primarily regulated by the transcription factor Hap4, and 29 of the 55 genes had a known Hap4-binding site in their promoter. In addition, 32 genes had an STRE element, which is recognized by the stressresponsive transcription factor Msn4 (see Section 3.2). This type of classification is an important step towards an integrative understanding of responses to environmental conditions in yeast and eventually also in models of ecological relevance. In addition to classifying genes according to their transcriptional regulation, systems biologists also
260
INTRODUCTION TO ECOLOGICAL GENOMICS
map entire sets of genes in a genome (Featherstone and Broadie 2002; Tong et al. 2004; Zhang et al. 2005). To decide whether two genes interact with each other a technique known as synthetic genetic array (SGA) analysis is used. The availability of deletion mutants for many genes in the genome is a crucial element in this technique and this condition is satisfied in yeast. An SGA screen starts with a viable mutant that has a query gene deleted. That mutant is crossed into an array of viable deletion mutants for many other genes to generate double mutants which are isolated automatically and scored for loss of fitness or lethality. Double mutants with reduced fitness are indicative of interaction between the two genes, because if each of the single mutants is viable while the double mutant is not, this suggests that the gene products buffer each other in the wild type. Interactions thus defined are often found between genes belonging to the same gene ontology category, which confirms the validity of the interpretation.
Analysis of genetic networks in yeast has revealed that most of them have a structure characterized as scale-free topology (Featherstone and Broadie 2002; Tong et al. 2004). This structure implies that the distribution of links over the nodes of a network is not random but biased towards a few highly connected nodes (‘hubs’), which participate in a large number of metabolic reactions, while the majority of nodes is hooked on only via a single link. Technically speaking, in a scale-free network the probability P(k) that a node interacts with k other nodes (the degree distribution of the network) follows a power law, where P(k) kg. The parameter g approximates a value of 2.2 for all organisms. When this relationship is plotted on a graph (Fig. 7.3), the horizontal axis represents the degree of interaction that a gene has in the genome (highly interactive genes are on the right), whereas the vertical axis represents the number of genes that is found for each degree. In an SGA screen conducted by Tong et al. (2004) 132 different yeast
400 1000 350
Gene count
300
100
250 10 200 1
150
1
10
100
100 50 0 0
5
10
15
20
25
30
35
Degree Figure 7.3 Degree distribution of interactions between yeast genes established through SGA analysis. A frequency distribution is shown of the number of interactions (degree) that yeast genes have with other genes. The shape of the distribution is suggestive of a power law, which is confirmed by the linear relationship obtained when the two axes are expressed logarithmically (inset). Networks with a power law distribution of degrees are called scale-free. An example of the topology is shown in Fig. 7.4a. Reprinted with permission from Tong et al. (2004). Copyright 2004 AAAS.
INTEGRATIVE ECOLOGICAL GENOMICS
genes were queried and each of these genes was tested for interactions with 4700 other genes. As expected, genes with only one interaction were most abundant but some had interactions with 32 other genes (Fig. 7.3). The scale-free property of genetic-interaction networks is in conflict with the idea of modularity referred to above. The existence of modules implies some degree of organization and a more or less uniform distribution of links over nodes. These two seemingly opposing tendencies are reconciled in the concept of hierarchical modularity, introduced by Ravasz et al. (2002). In a hierarchical modular network there are many small, highly connected modules that combine into larger units according to a power law. The hierarchical network has a scale-free topology with embedded modularity (Fig. 7.4c). Ravasz et al. (2002) conducted an extensive analysis of the metabolic networks of 43 different organisms and found that in all species investigated there was significant evidence for hierarchical modularity. Network analysis in yeast is becoming more and more comprehensive. Drawing together information from SGA screens, protein–DNA interaction, and protein–protein interaction, Zhang et al. (2005) developed a network involving no less than 5831 nodes (genes, proteins) and 154 659 links between them. Such extremely complicated networks can be analysed for the occurrence of network motifs: patterns of interconnectedness between three or more genes that occur more frequently than expected from a random combination of links. Overlying a collection of network motifs is a network theme: an interconnected cluster of motifs reflecting a common organizational principle. Network themes can often be linked to a biological process and there are only a few of them in the cell. At a still higher organizational level is defined a thematic map, which captures the dynamic relationships between themes. We have dwelt on network theory to illustrate the approaches that systems biologists are applying in order to understand the metabolism of the living cell. The question arises, should ecological genomics follow a similar path to understand ecological systems and link genomics to ecology?
261
(a)
(b)
(c)
Figure 7.4 Three types of model for complex networks. (a) A scale-free model, characterized by a few, highly connected nodes; (b) a modular network, consisting of four highly interlinked units, connected to each other by a few links; and (c) an hierarchical network, which combines a scale-free topology with hierarchical clustering. Reprinted with permission from Ravasz et al. (2002). Copyright 2002 AAAS.
Network analysis is not uncommon in community ecology. Food webs can be considered as networks and ecologists are interested in what properties of food webs contribute to their stability. One such property, discussed by Neutel et al. (2002), is the pattern of interaction strengths across the web. Interaction strength of a trophic couple is a measure of the influence of one species on the population increase of another species when both are near equilibrium. The negative effect of a predator on its prey is usually larger than the positive effect of a prey on its predator; therefore, interactions
262
INTRODUCTION TO ECOLOGICAL GENOMICS
strengths are greater for top-down relationships than for bottom-up relationships. Interaction strengths are particularly important when there are loops in the web; that is, paths that return on the same species without visiting other species more than once. The mean interaction strength of all the pairs in a loop is called the loop weight. Examination of 104 published food-webs revealed that the longer the loop, the lower its loop weight. Mathematical analysis showed that this property contributes greatly to the stability of the network. So, loop weight in a food web can be considered a network motif of a significance comparable to the ones identified by Zhang et al. (2005) for metabolic networks in the cell. We believe that approaches similar in spirit to systems biology should ultimately be adopted to enable genomic answers to ecological questions. That is, a systems approach is needed to link genomics to ecosystem function, to life-history pattern, and to the ecological niche. Chapters 4, 5, and 6 of this book have shown that such links are currently far from complete. When ecological processes are governed by a limited number of signal transduction pathways, as in some of the stress responses discussed in Chapter 6, a network analysis of interactions seems to be a suitable option (see the figures in Chapter 6 showing induction of gene expression by stress). Also, in the cases of nutrient cycles catalysed by wellcharacterized genetic complexes in microorganisms, a systems approach seems to be feasible. However, in general it is difficult to forecast which type of systems biology is required as an integrative framework for ecological genomics. In addition, we see three main issues that lack in the present systems-biology approaches but which are nevertheless crucial for ecology. Spatial considerations. Space is a very important aspect of ecological analysis. Many processes in communities require some degree of proximity between different organisms (e.g. in the case of syntrophy). Reproduction in animals usually requires physical contact between the sexes; in flowering plants pollen has to travel from anther to pistil and the distance between these organs
matters. Stratification of the environment, or other types of heterogeneity, are often crucial for species to coexist with each other. Colonization events can alter the functioning of ecosystems dramatically if the colonizer is an invader and outcompetes local species. All these issues, so obvious for an ecologist, are completely absent from present-day systems biology. It is unclear how genomics and systems biology can contribute to spatial ecology. Temporal considerations. Like space, time is another important dimension of ecological analysis. Any ecosystem bears all kinds of traces from its prior development; the way in which an ecosystem functions is determined partly by what went before. Historical issues are, for example, reflected in the build-up of the soil profile and the presence of peat accumulated from previous plant growth. If birds for some reason in the past decided to use one piece of land rather than another, this situation may continue for a long time because habitat use is often culturally transmitted or imprinted in the offspring. So, ecologists are accustomed to the fact that some phenomena in nature can only be understood by referring to past events, and that there is a more or less predictable succession of events during the development of an ecosystem. It is unclear how such temporal phenomena can be reconciled with a systemsbiology perspective. Bi-directional interaction with the environment. In the systems-biology treatment of the living cell, the environment of the cell is considered as given; expressed in ecological terms, it is a set of external conditions that are not altered by activities of the cell. In real ecological systems, the environment is altered significantly by organisms, for example by gas exchange, by consuming resources, or by altering physical structure (e.g. burrowing by earthworms). Including such interactions in a systems-biology model would imply that resources and nutrients are considered dynamic variables that can be depleted or otherwise altered by the organism. Such bi-directional interactions are not yet part of systems-biology analyses.
INTEGRATIVE ECOLOGICAL GENOMICS
7.2
Ecological control analysis
In addition to network theory, which emphasizes topology and structure, systems biology also deploys a set of quantitative tools, aiming to capture the dynamics of transcriptome, proteome, and metabolome in mathematical terms. One such approach developed in the 1970s goes under the name of metabolic control analysis (MCA). The foundations of MCA theory were laid by Henrik Kacser in 1973 (Fell 1992; Kacser and Burns 1995). The theory focuses on the flux of metabolites through a biochemical pathway, where a certain substrate undergoes successive modification catalysed by enzymes. An example is the well-known glycolytic pathway, which involves 10 different catalytic steps starting with phosphorylation of glucose and ending in the formation of pyruvate. Under normal physiological conditions, the concentration of each intermediary metabolite will be constant, while there is a constant flux of glucose down to pyruvate. It is the flux of substrate that drives the metabolism of the cell, not the concentration. The question asked in MCA is, which enzyme exerts the greatest control over the flux? In the formularium of MCA, the flux of substrate through the pathway is designated by J. The control of an enzyme i over the flux is expressed as the increase of J that would be brought about by a small increase in enzyme concentration, ei. If an enzyme exerts a large control, the flux will increase strongly with a small increase of ei; that is, the derivative of J with respect to ei will be large. The flux-control coefficient Ci is therefore defined as the partial derivative of J with respect to ei, relative to J and ei themselves, under steady-state conditions: Ci ¼
qJ ei q ln J ¼ qei J q ln ei
Flux-control coefficients are dimensionless constants that characterize the action of an enzyme in the pathway. However, they should not be considered as properties of an enzyme as such, because their value depends on the state of the whole pathway. Control coefficients can only be measured while the whole pathway is intact; this can be done by measuring the flux as accumulation of the end product in cells with experimentally
263
manipulated enzyme concentrations, for example using specific inhibitors. Another approach is to use genetic means, for example by comparing homozygotes with heterozygotes, by mutating a gene to downregulate its activity, by introducing a plasmid carrying an extra copy of the gene, or by replacing the promoter of the gene by an artificial promoter that can be modulated by an external factor. The rise of DNA technology has greatly expanded the possibilities for manipulating enzyme activities and has allowed measurements of flux control that were difficult to achieve with earlier biochemical methods (Jensen et al. 1995). An interesting property of flux control coefficients in a metabolic pathway is that, leaving aside some special cases, the sum of their values over the whole pathway equals unity: n X
Ci ¼ 1
i¼1
where n is the number of enzymes in the pathway. This so-called summation theorem of MCA holds independent of the structure of the pathway; it is valid for linear pathways such as glycolysis, but also for non-linear pathways, including those with feedback, coupling, and branching. The summation theorem, which was proven by Kacser and Burns (1995), implies that control is not necessarily attributable to a single enzyme. The idea that there is always one enzyme in a metabolic pathway that is rate-limiting is not supported by theory or biochemical experiments. Instead MCA leads to the concept of distributed control: all enzymes in a metabolic pathway exert some degree of control over the flux. It is possible that all enzymes take an equal share in the control, but the most common situation is that several enzymes in a pathway contribute only little to flux control. This is supported by evidence from heterozygotes that carry a defective mutant allele; in such genotypes the activity of the enzyme involved may be reduced to 50% in the case of full recessiveness, but still the flux of metabolites through the pathway is often hardly affected. A second important concept in MCA concerns the way in which enzyme activities depend on the substrate concentration. This is expressed in the
264
INTRODUCTION TO ECOLOGICAL GENOMICS
elasticity coefficient e, which is defined for any enzyme i as the partial derivative of its reaction rate vi with respect to the substrate, S, again normalized to the substrate concentration and the rate: ei ¼
qvi S q ln vi ¼ qS vi q ln S
Elasticity coefficients are determined by the kinetic properties of the enzymes. In contrast to the fluxcontrol coefficient, they are local properties and can be studied using the enzyme when it is isolated from the pathway. Flux-control coefficients lose their meaning when the enzyme is isolated, but elasticity can still be studied in vitro. MCA theory further learns that there is a relationship between elasticity coefficients and fluxcontrol coefficients. This is a consequence of the fact that under steady-state conditions the flux neither accumulates nor oscillates in the pathway. If we consider two adjacent steps, 1 and 2, in a metabolic pathway, we have two elasticities, e1 and e2, and two flux-control coefficients, C1 and C2. The relationship between these quantities is: C1 e1 þ C2 e2 ¼ 0 This relationship is known as the connectivity theorem. For a formal proof the reader is referred to Kacser and Burns (1995). The relationship can be generalized from two adjacent steps to the whole metabolic pathway, in which case the connectivity theorem takes the form of a matrix equation. The connectivity theorem is one of the strongest results of MCA, since it implies a formal link between enzyme kinetics and flux control. If the elasticity coefficients of all enzymes in a pathway are known, their flux control coefficients can be derived by applying the connectivity theorem. Derivation of flux control from elasticities is called forward control analysis. Equally interesting is reverse control analysis, which argues from control coefficients to elasticities. Westerhoff et al. (1994) showed that through a single matrix inversion step the in-situ elasticities of the enzymes in a pathway can be obtained from properties of the pathway as a whole, the flux-control coefficients. MCA is interesting because it offers a powerful framework with potential application to ecology. A link between MCA and ecology is developed in
trophic control analysis (Getz et al. 2003). In this approach the MCA methodology is applied to food chains rather than biochemical pathways. Trophic chains are different from biochemical pathways in a one crucial aspect: the flux process is not conservative. Due to growth, respiration, excretion, and mortality in food chains, biomass is lost from the flux of matter; control analysis has to take this into account. Getz et al. (2003) developed an MCAlike food-web model by which it is possible to investigate which trophic groups exert the largest control over the biomass flux. The aim of the study was to test the trophic cascade hypothesis, which holds that predators exert control over their prey at the top of the food chain in such a way that the top-down control trickles down to lower trophic levels and so also limits populations at the base of the food web. Trophic control analysis demonstrated, however, that control is distributed over several different levels of the trophic chain, rather than residing in one particular place. Another type of application of MCA to ecology goes under the name ecological control analysis. This type of analysis stays close to MCA by focusing on the flux of some material through a community in the absence of significant biomass production from the flux. This may hold as an approximation for microbial communities under anaerobic conditions in which growth is extremely slow and almost all of the carbon is dissimilated. As a consequence enzyme concentrations and reaction stoichiometries can be assumed to be in steady state and are conserved. W.F.M. Ro¨ling et al., in work not yet published, considered a simple syntrophic community consisting of three functional groups of microorganisms, degrading a specific organic substrate by fermentation (Fig. 7.5). The fermenting microorganisms produce acetate and hydrogen but they are inhibited by these products and cannot grow when acetate and hydrogen accumulate in their environment. In a syntrophic community, fermentation products are utilized by terminal electron-accepting microorganisms such as iron reducers, sulphate reducers, and methanogens (see Section 4.3). It is assumed in the model that acetate and hydrogen are used by different microorganisms (Fig. 7.5).
INTEGRATIVE ECOLOGICAL GENOMICS
(a)
265
d
EAre EAox
– Ferm. m.o.
Acetate
TEA
Hydrogen
TE
Substrate Flux J
.1 m.o
Am
–
.o.
2
EA ox EA red
(b)
C
J ferm
J hydrogen J C acetate C
C
H2 ferm
H2 hydrogen H C 2 acetate C
C
acetate ferm
C
acetate hydrogen
C
acetate acetate
–1 1 =
_ εv ferm H2
_ εv ferm
acetate
1 _ εv hydrogen H2
0
1 0 _ εv acetate acetate
Figure 7.5 (a) Model of a syntrophic microbial community consisting of three members, one fermenting an organic substrate and producing acetate and hydrogen, the other two consuming the intermediates. Arrows indicate material transfer; the curved lines ending with bars indicate negative control of the products. Ferm. m.o., fermenting microorganisms; TEA m.o., terminal electron-accepting microorganisms; EAox, EAred, oxidized and reduced electron acceptors, respectively; J, flux of substrate. (b) Control matrix (left) obtained as the inverse of the elasticity matrix (right) that corresponds to the scheme shown in (a). C, flux-control coefficient; the superscript indicates which flux (J, hydrogen, acetate) is controlled, the subscript indicates the controlling functional group. e, Elasticity coefficient; the superscript indicates the functional group, the subscript indicates the substrate. From W.F.M. Ro¨ling, B.M. Van Breukelen, H.W. Van Verseveld, and H.V. Westerhoff, unpublished work.
Ro¨ling et al. estimated numerical values for the elasticity coefficients in this system and showed that in contrast to current views, degradation fluxes are not always limited by a single functional group, but can be controlled by several groups simultaneously. The model was used to explore under what conditions degradation of a substrate is controlled by which group of microorganisms. It turned out that under denitrifying and ironreducing conditions flux control by terminalelectron accepting microorganisms is generally negligible and control is exerted mainly by the fermentors; however, under less favourable redox conditions flux control by terminal electronaccepting microorganisms can strongly increase. The redox potential is therefore a dominant driver that determines where flux control is concentrated.
The results have very important practical implications, for example in the remediation and management of polluted groundwater systems. For the moment, ecological control analysis seems to fit best with problems of food-web ecology and biogeochemical cycles. However, we see no reason why application should be limited to these fields. We have seen several examples in this book that can be phrased in terms of fluxes (contaminants, oxygen radicals, resource allocation) and that could be analysed with some kind of control analysis. There is also a link between metabolic flux and population genetics, as explored in an early paper by Dykhuizen et al. (1987). These authors analysed enzymes of the lac operon of E. coli and showed that the b-galactosidase enzyme had only a small control coefficient with regard to
266
INTRODUCTION TO ECOLOGICAL GENOMICS
fitness. Therefore, genetic variants of this enzyme in which enzyme activity is changed mildly in comparison to the wild type will mostly be selectively neutral. This was in contrast with the b-galactosidase permease locus, which encodes an enzyme with strong control over fitness. Thus it was predicted that mutations in the latter locus, even if they change enzyme activity by only a little, could be under directional selection. The evolutionary fate of an allele is thus determined by the flux-control coefficient of the enzyme it encodes. There are many examples where alternative variants of enzymes exert a different degree of flux control. Ecologists can utilize the natural variation in such enzymes to test the evolutionary implications of MCA.
7.3
Outlook
For the final section of this book we will discuss a some emerging issues that we think will become important for ecological genomics in the near future. Whereas genomics develops at staggering speed, it is difficult to predict how much attention each of these issues will get; the ones we have selected logically follow from the topics addressed in this book.
7.3.1 Organization of model species communities One of the most frequently experienced obstacles of ecological genomics at the moment is the availability of just a few fully sequenced genomes of ecologically relevant species. However, we believe that this situation will improve soon and that within a few years many species on which more than a few ecological laboratories are working will have a sufficiently large genomic database to allow genome-wide analyses of ecological questions. Transcription profiling using microarrays is expected to be the major activity for ecological genomics in the near future, and although the use of microarrays is only useful when preceeded or followed up by major sequencing efforts, a complete genome sequence is not really necessary to work with microarrays. In
the transition phase the use of small, tailor-made arrays (so-called boutique arrays) can be a good compromise, as we have seen in several sections of this book (Chapters 4 and 6). Such arrays can be extended gradually as more genomic information on the species becomes available. The real obstacle for ecological genomics could very well be the creation of sufficiently large collaborative networks around model species. As we have noted above, ecologists are fascinated more by the biodiversity of species than by one representative species, and have difficulty in accepting the idea of model species. Still, it is unavoidable that ecological laboratories intending to specialize in genomics will collaborate and agree on a single model. Benefit from genome information can also be obtained by working on a wild, close relative of a genomic model, as we have seen in the case of Brassicaceae related to Arabidopsis (Chapter 3).
7.3.2 Large-scale sequencing of the environnment In Chapter 4 we saw that complete genomes can be reconstructed from DNA extracted from the environment, allowing analysis of metabolic potentials of organisms that have never been cultured in the laboratory. This strategy seems to be especially fruitful when applied to simplified communities in extreme environments. Such largescale sequencing projects produce a hardly imaginable amount of new information and without doubt new discoveries are in store. It seems that an order-of-magnitude increase in sequencing effort is still needed to apply this approach effectively to mesophilic communities including eukaryotes. If technology and computing power allows for such an increase in the near future, large-scale sequencing of the environment could make an enormously important contribution to mapping the Earth’s biodiversity and archiving sequences of species that risk extinction in the near future. In addition to sequencing, functional screening of metagenomic libraries is also expected to provide a lot of new information. As we have discussed in Chapter 4, metagenomic studies at the moment are focused on discovering new genes or
INTEGRATIVE ECOLOGICAL GENOMICS
biosynthetic pathways for products that have potential application in medicine, biotechnology, or agriculture. We expect that in the near future metagenomics will also benefit ecology. Many functions important for nutrient cycling, mutualism, quorum sensing, plant–microbe signalling, etc. are still hidden in the genomes of partly unknown microorganisms. New technological developments that combine genomics with localization and the use of tracers seem to be particularly promising.
7.3.3
Wild transcription profiling
The great majority of genomic studies reviewed in this book were conducted with organisms in a laboratory environment. The microbial studies reviewed in Chapter 4 are an exception and that is why we have argued that the process of merging ecology with genomics has shown the greatest progress in microbiology. However, microbial ecological genomics has to deal with challenges that plague botanists and zoologists to a lesser degree, the terra incognita of biodiversity. As the genomes of more and more ecologically relevant model species are sequenced, transcription profiling of organisms collected directly from their natural environment will come within reach. Such studies have not yet been conducted, but we expect that they will be crucial to understanding the dynamics and ecological relevance of transcription profiles. It could very well be that the profiles that have been observed until now in laboratory-cultured organisms will differ greatly from those collected in the wild. This may especially hold for species that face conditions in the field that are very different from their laboratory environment. For example, most ecologists are convinced that disease and parasitism are important limiting factors in the field. Do transcription profiles of plants and animals in the wild contain signatures of frequently upregulated immune responses? We don’t know.
7.3.4
The mechanistic framework
Sequencing and transcription profiling run the risk of only scraping the surface of what ecological
267
genomics has to offer. Indeed, collecting endless lists of genes and gene-expression profiles is not an aim in itself. In this chapter we discussed the necessity of linking genomics with hypothesisdriven research. In our opinion, gene-expression profiling makes sense only if the genes sooner or later can be positioned in an analytical framework that is grounded in physiological or biochemical knowledge. Even ecologists, if they take ecological genomics seriously, will have to get to grips with the mechanisms of the processes they study. We have seen that the most successful stories of ecological genomics discussed in Chapter 5, on longevity in C. elegans and flowering time in Arabidopsis, came from previous painstaking work in genetics and biochemistry. We argued in Chapter 2 that microarray-based transcription profiling should perhaps be viewed as just an exploratory instrument, or as only a stop on the way to some basic question, not as a goal in itself. We should avoid the impression, sometimes made, that genomics is a very advanced form of stamp collecting.
7.3.5
New methods of data analysis
The field of bioinformatics is developing a tremendous number of new analytical tools to match the high-throughput pipelines of comparative and functional genomics. Most of these methods are aimed at dimension reduction using various types of multivariate statistics, cluster analysis, pattern recognition, etc. Another avenue is the application of univariate models such as analysis of variance in a gene-by-gene manner, which raises statistical issues about false-positive results in large datasets. Ecologists are traditionally acquainted with statistics as a necessary tool for the analysis of noisy data; however, the sheer size of genomics data-sets adds a new dimension to statistical analysis in ecological genomics. We argued in Chapter 2 that the statistical approaches presently developed for microarrayderived transcription profiles are not necessarily optimal for ecological genomics. In particular, we argued that clustering of conditions may better fit with ecological problems than clustering of genes.
268
INTRODUCTION TO ECOLOGICAL GENOMICS
Another challenge for bioinformatics in ecology is how to define the normal operating range of species; that is, the set of expression profiles that reflects routine physiological variation and the absence of stress. Finally, the development of integrative approaches of the type visited earlier in Chapter 7, linking genomics and transcriptomics to questions of community structure, life-history, and ecological niche, may be the greatest challenge of all.
7.3.6
Comparative genomics
Whereas this book focuses on problems of ecology we have discussed evolutionary issues only marginally. In the last few years the field of comparative genomics has expanded its scope tremendously and is responsible for many exciting discoveries. Using techniques such as phylogenetic footprinting and phylogenetic shadowing information is obtained about the content of a genome in such a way that maximal use is made of homologies elsewhere in the tree of life. Using comparative genomics, organismal groups with unclear phylogenetic affiliation will soon be positioned solidly. Interestingly, new species are being sequenced not for the sake of these species but for the sake of a more or less distant model (usually humans). This development can actually benefit ecology. An example is the availability of a full genome sequence for the sea squirt, Ci. intestinalis, which was sequenced for comparative reasons, but is an equally good model for ecological studies in the coastal marine environment. We expect that the science of molecular evolution, supported by comparative genomics, is facing a glorious future.
7.3.7
Focus on natural variation
Natural variation in gene expression among and within field populations can be an extremely powerful tool for revealing evolutionary mechanisms, as illustrated in an elegant study on killifish, Fundulus heteroclitus (Oleksiak et al. 2002). This study and others suggest that inter-individual variation of transcriptional regulation is very common in natural populations. Such variation,
which is ultimately due to polymorphisms in promoter sequences or variation in trans-acting factors or signal transduction pathways, can be an important template for natural selection (Wray et al. 2003). The recent literature seems to suggest that, at least in animals, evolution acting upon transcriptional regulation could be at least as important as evolution of coding sequences (see the discussion in Stearns and Magwene 2003). The use of natural variation is also important because it allows ecological genomics to get away from the present focus on laboratory mutants (see the work presented in Chapter 5). Knocking-out genes to analyse their function is a crucial tool in mechanistic studies, but the relevance of the results for understanding functions in the environment is limited. The point is, we need to know the fitness consequences of gene mutations under ecologically relevant conditions. Where nature is already providing this variation, it is best to make optimal use of it.
7.3.8
Genetical genomics
The by now classical approaches of quantitative genetics and QTL analysis are badly integrated with ecological genomics at the moment. We foresee a renewed interest in quantitative character analysis when ecological genomics develops further. There is an increasing realization that even the expression of a single gene behaves as a quantitative character because several other gene products (transcription factors, enhancers, repressors, ribosomal factors, and splice factors) are involved with gene expression. Expression of single genes, when measured with quantitative methods such as real-time PCR, can be subjected to the same statistical analysis as traditional quantitative characters like body size and development time. To give an example, Roelofs et al. (2006) measured expression of a metal-binding protein, metallothionein, in a species of soil-living insect, Orchesella cincta, and estimated heritability of metallothionein expression from parent–offspring regression. The expression was extremely variable between individuals of this species, which was partly due to significant polymorphism in the
INTEGRATIVE ECOLOGICAL GENOMICS
promoter of the metallothionein gene. Such studies can potentially link gene-expression data to ecologically relevant quantitative characters. Several authors have expressed similar views (Walsh 2001; Gibson and Mackay 2002). The link between quantitative characters and genomics has developed further into a new field, called genetical genomics (Jansen and Nap 2001). The idea is to exploit the added value of genetic segregation by studying transcription profiles in large pedigrees of recombinant inbred lines. In principle it would be possible to treat each transcription profile as a quantitative trait and to use QTL methodology to dissect the expression profile into its underlying genetic components. This approach is potentially of enormous importance for ecological genomics, because it can forge a link between transcription profiling and QTL mapping.
7.3.9
Epigenetics
We know now that regulatory information that is not defined in the DNA can still be transmitted between cells, and from one generation to another, using DNA methylation, histone acetylation, etc. By means of epigenetic processes cells may canalize their potential expression repertoire and adopt specific functions or states. In addition, an epigenetically regulated state may be transmitted in cell lineages. Such epigenetic processes seem to be especially important when transmitting information that must be remembered in the daughter cells in order to respond in an adequate way to some environmental factor. We have seen several examples of epigenetic processes in this book, for example the regulation of flowering time in Arabidopsis by temperature (Chapter 5). Still, epigenetics has had little influence on ecology ( Jablonka and Lamb 2002). We call for more attention to this important phenomenon, for example by studying the frequency of epigenetic variants in natural populations. One of the mechanisms of epigenetic regulation is due to RNAi, a phenomenon by which double-stranded RNAs specifically suppress a
269
target protein by degradation of its mRNA or by transcriptional gene silencing (Novina and Sharp 2004). Following the discovery of RNAi in nematodes and plants in the 1990s, realization has come that it is a widespread natural phenomenon and an evolutionarily ancient mechanism of genome defence. It may be expected that RNAi is also involved in regulating ecologically important processes, but this has not yet been demonstrated.
7.3.10
The unification of biology
The enormous scientific success of biology in the course of the last century is evident from the fact that many other disciplines have adopted biological epithets. This is not limited to biochemistry and biophysics, but extends to disciplines such as biogeology, bioarchaeology, and biopsychology. As a consequence of this spreading movement, biology has become such an extensive scientific field that it is hardly possible to view the whole. What was just zoology, botany, and microbiology before is now scattered over a wide variety of subdisciplines. The same diversifying trend is present in ecology itself, which has to cover the widest span of all: from molecule to ecosystem. How sustainable is this situation? Should we fear for the future of ecology as an homogeneous science? Not denying the tendency to diversify, which is typically seen in any growing field, we also expect an opposite trend, the unification of biology. Genomics could very well turn out to act as a new point of crystallization, bringing biologists of various plumages to the same core. As demonstrated by the recent establishment of a Gordon Research Conference series on Evolutionary and Ecological Functional Genomics (Feder and Mitchell-Olds 2003), there is an increasing interest among molecular biologists in issues of evolution and ecology. Likewise, more and more ecologists are becoming interested in the molecular biology of ecological phenomena. We hope that this book has contributed at least a little to this admittedly ambitious perspective.
This page intentionally left blank
References
Adam, D. (2000) Now for the hard ones. Nature 408: 792–793. Adamcyk, J., Hesselsoe, M., Iversen, N., Horn, M., Lehner, A., Nielsen, P.H., Schloter, M., Roslev, P., and Wagner, M. (2003) The isotope array, a new tool that employs substrate-mediated labeling of rRNA for determination of microbial community structure and function. Applied and Environmental Microbiology 69: 6875–6887. Adams, M.D., Celniker, S.E., Holt, R.A., Evans, C.A., Gocayne, J.D., Amanatides, P.G., Scherer, S.E., Li, P.W., Hoskins, R.A., Galle, R.F. et al. (2000) The genome sequence of Drosophila melanogaster. Science 287: 2185–2195. Allen, E.A. and Banfield, J.F. (2005) Community genomics in microbial ecology and evolution. Nature Reviews Microbiology 3: 489–498. Altschul, S.F., Gish, W., Miller, W., Myers, E.W., and Lipman, D.J. (1990) Basic Local Alignment Search Tool. Journal of Molecular Biology 215: 403–410. Amasino, R.M. (2003) Flowering time: a pathway that begins at the 3 0 end. Current Biology 13: R670–R672. Amasino, R. (2004) Take a cold flower. Nature Genetics 36: 111–112. Amores, A., Force, A., Yan, Y.-L., Joly, L., Amemiya, C., Fritz, A., Ho, R.K., Langeland, J., Prince, V., Wang, Y.-L. et al. (1998) Zebrafish hox clusters and vertebrate genome evolution. Science 282: 1711–1714. Andersen, G.L., DeSantis, T.Z., Murray, S.R., and Moberg, J.P. (2004) Phylogenetic chip for microbial detection. 10th International Symposium on Microbial Ecology, Cancun, Mexico. International Society of Microbial Ecology, Geneva: 110. Andrews, G.K. (2001) Cellular zinc sensors: MTF-1 regulation of gene expression. BioMetals 14: 223–237. Aparicio, S., Chapman, J., Stupka, E., Putnam, N., Chia, J., Dehal, P., Christoffels, A., Rash, S., Hoon, S., Smit, A. et al. (2002) Whole-genome shotgun assembly and analysis of the genome of Fugu rubripes. Science 297: 1301–1310.
Arabidopsis Genome Initiative (2000) Analysis of the genome sequence of the flowering plant Arabidopsis thaliana. Nature 408: 796–815. Arantes-Oliveira, N., Apfeld, J., Dillin, A., and Kenyon, C. (2002) Regulation of life-span by germ-line stem cells in Caenorhabditis elegans. Science 295: 502–505. Aravind, L., Tatusov, R.L., Wolf, Y.I., Walker, D.R., and Koonin, E.V. (1998) Evidence for massive gene exchange between archaeal and bacterial hyperthermophiles. Trends in Genetics 14: 442–444. Arbeitman, M.N., Furlong, E.E.M., Imam, F., Johnson, E., Null, B.H., Baker, B.S., Krasnow, M.A., Scott, M.P., Davis, R.W., and White, K.P. (2002) Gene expression during the life cycle of Drosophila melanogaster. Science 297: 2270–2275. Armbrust, E.V., Berges, J.A., Bowler, C., Green, B.R., Martinez, D., Putnam, N.H., Zhou, S., Allen, A.E., Apt, K.E., Bechner, M. et al. (2004) The genome of the diatom Thalassiosira pseudonana: ecology, evolution, and metabolism. Science 306: 79–86. Armstrong, M.R., Blok, V.C., and Phillips, M.S. (2000) A multipartite mitochondrial genome in the potato cyst nematode Globodera pallida. Genetics 154: 181–192. Attwood, T.K. and Parry-Smith, D.J. (1999) Introduction to Bioinformatics. Prentice Hall, Harlow. Ausı´n, I., Alonso-Blanco, C., Jarillo, J.A., Ruiz-Garcia, L., and Martı´nez-Zapater, J.M. (2004) Regulation of flowering time by FVE, a retinoblastome-associated protein. Nature Genetics 36: 162–166. Azumi, K., Fujie, M., Usami, T., Miki, Y., and Satoh, N. (2004) A cDNA microarray technique applied for analysis of global gene expression profiles in tributyltinexposed ascidians. Marine Environmental Research 58: 543–546. Baker, B.J., Lutz, M.A., Dawson, S.C., Bond, P.L., and Banfield, J.F. (2004) Metabolically active eukaryotic communities in extremely acidic mine drainage. Applied and Environmental Microbiology 70: 6264–6271. 271
272
REFERENCES
Baldwin, I.T. (2001) An ecologically motivated analysis of plant-herbivore interactions in native tobacco. Plant Physiology 127: 1449–1458. Ball, K.D. and Trevors, J.T. (2002) Bacterial genomics: the use of DNA microarrays and bacterial artificial chromosomes. Journal of Microbiological Methods 49: 275–284. Barnes, A.I. and Partridge, L. (2003) Costing reproduction. Animal Behaviour 66: 199–204. Barnett, M.J., Fisher, R.F., Jones, T., Komp, C., Abola, A.P., Barloy-Hubler, F., Bowser, L., Capela, D., Galibert, F., Gouzy, J. et al. (2001) Nucleotide sequence and predicted functions of the entire Sinorhizobium meliloti megaplasmid. Proceedings of the National Academy of Sciences USA 98: 9883–9888. Bartels, D. and Sunkar, R. (2005) Drought and salt tolerance in plants. Critical Reviews in Plant Sciences 24: 23–58. Bartke, A., Wright, J.C., Mattison, J.A., Ingram, D.K., Miller, S.R., and Roth, G.S. (2001) Extending the lifespan of long-lived mice. Nature 414: 412. Bastow, R. and Dean, C. (2003) Deciding when to flower. Science 302: 1695–1697. Bastow, R., Mylne, J.S., Lister, C., Lippman, Z., Martienssen, R.A., and Dean, C. (2004) Vernalization requires epigenetic silencing of FLC by histone methylation. Nature 427: 164–167. Bavykin, S.G., Akowksi, J.P., Zakhariev, V.M., Barsky, V.E., Perov, A.N., and Mirzabekov, A.D. (2001) Portable system for microbial sample preparation and oligonucleotide microarray analysis. Applied and Environmental Microbiology 67: 922–928. Bayne, B.L. (1989) Measuring the biological effects of pollution: the mussel watch approach. Water Science and Technology 21: 1089–1100. Becker, A. and Theißen, G. (2003) The major clades of MADS-box genes and their role in the development and evolution of flowering plants. Molecular Phylogenetics and Evolution 29: 464–489. Beebee, T. and Rowe, G. (2004) Introduction to Molecular Ecology. Oxford University Press, Oxford. Be´ja`, O., Aravind, L., Koonin, E.V., Suzuki, M.T., Hadd, A., Nguyen, L.P., Jovanovich, S.B., Gates, C.M., Feldman, R.A., Spudich, J.L. et al. (2000a) Bacterial rhodopsin: evidence for a new type of phototrophy in the sea. Science 289: 1902–1906. Be´ja`, O., Suzuki, M.T., Koonin, E.V., Aravind, L., Hadd, A., Nguyen, L.P., Villacorta, R., Amjadi, M., Garrigues, C., Jovanovich, S.B. et al. (2000b) Construction and analysis of bacterial artificial chromosome libraries from a marine microbial assemblage. Environmental Microbiology 2: 516–529.
Be´ja`, O., Spudich, E.N., Spudich, J.L., Leclerc, M., and DeLong, E.F. (2001) Proteorhodopsin phototrophy in the ocean. Nature 411: 786–789. Beldade, P. and Brakefield, P.M. (2002) The genetics and evo-devo of butterfly wing patterns. Nature Reviews Genetics 3: 442–452. Beldade, P., Brakefield, P.M., and Long, A.D. (2002) Contribution of Distal-less to quantitative variation in butterfly eyespots. Nature 415: 315–318. Benner, S.A., Liberles, D.A., Chamberlin, S.G., Govindarajan, S., and Knecht, L. (2000) Functional inferences from reconstructed evolutionary biology involving rectified databases—An evolutionarily grounded approach to functional genomics. Research in Microbiology 151: 97–106. Bernardi, G. (2000) Isochores and the evolutionary genomics of vertebrates. Gene 241: 3–17. Biology Analysis Group and Genome Analysis Group (2004) A draft sequence for the genome of the domesticated silkworm (Bombyx mori). Science 306: 1937–1940. Bishop, W.E., Clarke, D.P., and Travis, C.C. (2001) The genomic revolution: what does it mean for risk assessment? Risk Analysis 21: 983–987. Blanc, G. and Wolfe, K.H. (2004) Widespread paleopolyploidy in model species inferred from age distributions of duplicate genes. The Plant Cell 16: 1667–1678. Blattner, F.R., Plunket, III, G., Bloch, C.A., Perna, N.T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J.D., Rode, C.K., Mayhew, G.F. et al. (1997) The complete genome sequence of Escherichia coli K12. Science 277: 1453–1462. Blaxter, M.L., De Ley, P., Garey, J.R., Liu, L.X., Scheldeman, P., Vierstraete, A., Vanfleteren, J.R., Mackey, L.Y., Dorris, M., Frisse, L.M. et al. (1998) A molecular evolutionary framework for the phylum Nematoda. Nature 392: 71–75. Bla´zquez, M.A., Ahn, J.H., and Weigel, D. (2003) A thermosensory pathway controlling flowering time in Arabidopsis thaliana. Nature Genetics 33: 168–171. Blu¨her, M., Kahn, B.B., and Kahn, C.R. (2003) Extended longevity in mice lacking the insulin receptor in adipose tissue. Science 299: 572–574. Bochdanovits, Z. and De Jong, G. (2004) Antagonistic pleiotropy for life-history traits at the gene expression level. Proceedings of the Royal Society of London (supplement) 271: S75–S78. Bochdanovits, Z., Van der Klis, H., and De Jong, G. (2003) Covariation of larval gene expression and adult body size in natural populations of Drosophila melanogaster. Molecular Biology and Evolution 20: 1760–1766.
REFERENCES
Bodrossy, L., Stralis-Pavese, N., Murrell, J.C., Radajewski, S., Weilharter, A., and Sessitsch, A. (2003) Development and validation of a diagnostic microbial microarray for methanotrophs. Environmental Microbiology 5: 566–582. Boffeli, D., McAuliffe, J., Ovcharenko, D., Lewis, K.D., Ovcharenko, I., Pachter, L., and Rubin, E.M. (2003) Phylogenetic shadowing of primate sequences to find functional regions of the human genome. Science 299: 1391–1394. Bohnert, H.J., Ayoubi, P., Borchert, C., Bressan, R.A., Burnap, R.L., Cushman, J.C., Cushman, M.A., Deyholos, M., Fischer, R., Galbraith, D.W. et al. (2001) A genomics approach towards salt stress tolerance. Plant Physiology and Biochemistry 39: 295–311. Bongers, T. (1988) De Nematoden van Nederland. KNNV Uitgeverij, Utrecht. Bongers, T. and Ferris, H. (1999) Nematode community structure as a bioindicator in environmental monitoring. Trends in Ecology and Evolution 14: 224–228. Borevitz, J.O. and Nordborg, M. (2003) The impact of genomics on the study of natural variation in Arabidopsis. Plant Physiology 132: 718–725. Bowers, J.E., Chapman, B.A., Rong, J., and Paterson, A.H. (2003) Unravelling angiosperm genome evolution by phylogenetic analysis of chromosomal duplication events. Nature 422: 433–438. Brachat, S., Dietrich, F.S., Voegeli, S., Zhang, Z., Stuart, L., Lerch, A., Gates, K., Gaffney, T.D., and Philippsen, P. (2003) Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii. Genome Biology 4: R45. Bradbury, J. (2004) Nature’s nanotechnologists: unveiling the secrets of diatoms. PLoS Biology 2: e347–e306. Bradshaw, Jr, H.D., Ceulemans, R., Davis, J., and Stettler, R. (2000) Emerging model systems in plant biology: poplar (Populus) as a model forest tree. Journal of Plant Growth Regulation 19: 306–313. Braeckman, B.P., Houthoofd, K., and Vanfleteren, J.R. (2001) Insulin-like signaling, metabolism, stress resistance and aging in Caenorhabditis elegans. Mechanisms of Ageing and Development 122: 673–693. Branicky, R., Be´nard, C., and Hekimi, S. (2000) clk-1, mitochondria and physiological rates. BioEssays 22: 48–56. Braun, E.L., Halpern, A.L., Nelson, M.A., and Natvig, D.O. (2000) Large-scale comparison of fungal sequence information: mechanisms of innovation in Neurospora crassa and gene loss in Saccharomyces cerevisiae. Genome Research 10: 416–430. Brazma, A. and Voli, J. (2000) Gene expression data analysis. FEBS Letters 480: 17–24.
273
Brazma, A., Hingamp, P., Quackenbush, J., Sherlock, G., Spellman, P., Stoeckert, C., Aach, J., Ansorge, W., Ball, C.A., Causton, H.C. et al. (2001) Minimum information about a microarray experiment (MIAME)— towards standards for microarray data. Nature Genetics 29: 365–371. Breitbart, M., Salamon, P., Andresen, B., Mahaffy, J.M., Segall, A.M., Mead, D., Azam, F., and Rohwer, F. (2002) Genomic analysis of uncultured marine viral communities. Proceedings of the National Academy of Sciences USA 99: 14250–14255. Britton, J.S., Lockwood, W.K., Li, L., Cohen, S.M., and Edgar, B.A. (2002) Drosophila’s insulin/PI3-kinase pathway coordinates cellular metabolism with nutritional conditions. Developmental Cell 2: 239–249. Brogiolo, W., Stocker, H., Ikeya, T., Rintelen, F., Fernandez, R., and Hafen, E. (2001) An evolutionary conserved function of the Drosophila insulin receptor and insulin-like peptides in growth control. Current Biology 11: 213–221. Brown, A. (2004) In the Beginning Was the Worm. Finding the Secrets of Life in a Tiny Hermaphrodite. Pocket Books, London. Brunetti, C.R., Selegue, J.E., Monteiro, A., French, V., Brakefield, P.M., and Carroll, S.B. (2001) The generation and diversification of butterfly eyespot color patterns. Current Biology 11: 1578–1585. Brunner, A.M. and Nilsson, O. (2004) Revisiting tree maturation and floral initiation in the poplar functional genomics area. New Phytologist 164: 43–51. Brunner, A.M., Busov, V.B., and Strauss, S.H. (2004) Poplar genome sequence: functional genomics in an ecologically dominant plant species. Trends in Plant Science 9: 49–56. Bult, C.J., White, O., Olsen, G.J., Zhou, L., Fleischmann, R.D., Sutton, G.G., Blake, J.A., Fitzgerald, L.M., Clayton, R.A., Gocayne, J.D. et al. (1996) Complete genome sequence of the methanogenic archaeon, Methanococcus jannaschii. Science 273: 1058–1073. Bultelle, F., Panchout, M., Leboulenger, F., and Danger, J.M. (2002) Identification of differentially expressed genes in Dreissena polymorpha exposed to contaminants. Marine Environmental Research 54: 385–389. Burczynski, M.E. (ed.) (2003) An Introduction to Toxicogenomics. CRC Press, Boca Raton, FL. Butte, A. (2002) The use and analysis of microarray data. Nature Reviews Drug Discovery 1: 951–960. Burnaford, J.L. (2004) Habitat modification and refuge from sublethal stress drive a marine plant-herbivore association. Ecology 85: 2837–2847. Calow, P. (1989) Proximate and ultimate responses to stress in biological systems. Biological Journal of the Linnean Society 37: 173–181.
274
REFERENCES
Campbell, B.J., Stein, J.L., and Cary, S.C. (2003) Evidence of chemolithoautotrophy in the bacterial community associated with Alvinella pompejana, a hydrothermal vent polychaete. Applied and Environmental Microbiology 69: 5070–5078. Can˜estro, C., Bassham, S., and Postlewaith, J.H. (2003) Seeing chordate evolution through the Ciona genome sequence. Genome Biology 4: 208. Ca´novas, D., Cases, I., and De Lorenzo, V. (2003) Heavy metal tolerance and metal homeostasis in Pseudomonas putida as revealed by complete genome analysis. Environmental Microbiology 5: 1242–1256. Carroll, R.L. (2000) Towards a new evolutionary synthesis. Trends in Ecology and Evolution 15: 27–32. Carroll, S.B., Grenier, J.K., and Weatherbee, S.D. (2005) From DNA to Diversity. Blackwell Publishing, Malden. Casal, J.J., Fankhauser, C., Coupland, G., and Bla´zquez, M.A. (2004) Signalling for developmental plasticity. Trends in Plant Science 9: 309–314. Causton, H.C., Quackenbush, J., and Brazma, A. (2003) Microarray Gene Expression Data Analysis. A Beginner’s Guide. Blackwell Science, Malden. Causton, H.C., Ren, B., Koh, S.S., Harbison, C.T., Kanin, E., Jennings, E.G., Lee, T.I., True, H.L., Lander, E.S., and Young, R.A. (2001) Remodeling of yeast genome expression in response to environmental changes. Molecular Biology of the Cell 12: 323–337. C. elegans Sequencing Consortium (1998) Genome sequence of the nematode C. elegans: a platform for investigating biology. Science 282: 2012–2018. Chain, P., Lamerdin, J., Larimer, F., Regala, W., Lao, V., Land, M., Hauser, L., Hooper, A., Klotz, M., Norton, J. et al. (2003) Complete genome sequence of the ammonia-oxidizing bacterium and obligate chemolithoautotroph Nitrosomonas europaea. Journal of Bacteriology 185: 2759–2773. Chang, L. and Karin, M. (2001) Mammalian MAP kinase signalling cascades. Nature 410: 37–40. Chapman, S., Schenk, P., Kazan, K., and Manners, J. (2001) Using biplots to interpret gene expression patterns in plants. Bioinformatics 18: 202–204. Chase, J.M. and Leibold, M.A. (2003) Ecological Niches. Linking Classical and Contemporary Approaches. The University of Chicago Press, Chicago. Chen, M., Chory, J., and Fankhauser, C. (2004) Light signal transduction in higher plants. Annual Review of Genetics 38: 87–117. Chen, W., Provart, N.J., Glazebrook, J., Katagiri, F., Chang, H.-S., Eulgem, T., Mauch, F., Luan, S., Zou, G., Whitham, S.A. et al. (2002) Expression profile matrix of
Arabidopsis transcription factor genes suggests their putative functions in response to environmental stresses. The Plant Cell 14: 559–574. Cheng, C., Pounds, S.B., Boyett, J.M., Pei, D., Kuo, M.-L., and Roussel, M.F. (2004) Statistical significance threshold criteria for analysis of microarray gene expression data. Statistical Applications in Genetics and Molecular Biology 3: 36. Chin, K.-J., Esteve-Nu´n˜ez, A., Leang, C., and Lovley, D.R. (2004) Direct correlation between rates of anaerobic respiration and levels of mRNA for key respiratory genes in Geobacter sulfurreducens. Applied and Environmental Microbiology 70: 5183–5189. Cho, J.-C. and Tiedje, J.M. (2001) Bacterial species determination from DNA-DNA hybridization by using genome fragments and DNA microarrays. Applied and Environmental Microbiology 67: 3677–3682. Cho, J.-C. and Tiedje, J.M. (2002) Quantitative detection of microbial genes by using microarrays. Applied and Environmental Microbiology 68: 1425–1430. Christoffels, A., Koh, E.G.L., Chia, J.-M., Brenner, S., Aparicio, S., and Venkatesh, B. (2004) Fugu genome analysis provides evidence for a whole-genome duplication early during the evolution of ray-finned fish. Molecular Biology and Evolution 21: 1146–1151. Christophides, G.K., Zdobnov, E., Barillas-Mury, C., Birney, E., Blandin, S., Blass, C., Brey, P.T., Collins, F.H., Danielli, A., Dimopoulos, G. et al. (2002) Immunity-related genes and gene families in Anopheles gambiae. Science 298: 159–165. Clancy, D.J., Gems, D., Harshman, L.G., Oldham, S., Stocker, H., Hafen, E., Leevers, S.J., and Partridge, L. (2001) Extension of life-span by loss of CHICO, a Drosophila insulin receptor substrate protein. Science 292: 104–106. Clancy, D.J., Gems, D., Hafen, E., Leevers, S.J., and Partridge, L. (2002) Dietary restriction in long-lived dwarf flies. Science 296: 319. Clark, M.S., Crawford, D.L., and Cossins, A. (2003) Meeting review: worldwide genomic resources for non-model fish species. Comparative and Functional Genomics 4: 502–508. Cliften, P., Sudarsanam, P., Desikan, A., Fulton, L., Fulton, B., Majors, J., Waterston, R., Cohen, B.A., and Johnston, M. (2003) Finding functional features in Saccharomyces genomes by phylogenetic footprinting. Science 301: 71–76. Clontech (2002) Clontech PCR-selectTM cDNA Subtraction Kit User Manual. BD Biosciences Clontech. Cobbett, C. and Goldsbrough, P. (2002) Phytochelatins and metallothioneins: roles in heavy metal detoxification
REFERENCES and homeostasis. Annual Review of Plant Biology 53: 159–182. Colborn, T., Myers, J.P., and Dumanoski, D. (1996) Our Stolen Future. Little, Brown and Company, Boston. Cole, J.R., Chai, B., Marsh, T.L., Farris, R.J., Wang, Q., Kulam, S.A., Chandra, S., McGarrell, D.M., Schmidt, T.M., Garrity, G.M., and Tiedje, J.M. (2003) The Ribosomal Database Project (RDP-II): previewing a new autoaligner that allows regular updates and the new prokaryotic taxonomy. Nucleic Acids Research 31: 442–443. Cornish-Bowden, A. and Ca´rdenas, M.L. (2005) Systems biology may work when we learn to understand the parts in terms of the whole. Biochemical Society Transactions 33: 516–519. Corona, M., Estrada, E., and Zurita, M. (1999) Differential expression of mitochondrial genes between queens and workers during caste determination in the honeybee Apis mellifera. Journal of Experimental Biology 202: 929–938. Cowan, D.A., Arslanoglu, A., Burton, S.G., Baker, G.C., Cameron, R.A., Smith, J.J., and Meyer, Q. (2004) Metagenomics, gene discovery and the ideal biocatalyst. Biochemical Society Transactions 32: 298–302. Crawford, D.L. (2001) Functional genomics does not have to be limited to a few select organisms. Genome Biology 2: Interactions/1001.1. Croal, L.R., Gralnick, J.A., Malasarn, D., and Newman, D.K. (2004) The genetics of geochemistry. Annual Review of Genetics 38: 175–202. Curtis, T.P. and Sloan, W.T. (2004) Prokaryote diversity and its limits: microbial community structure in nature and implications for microbial ecology. Current Opinion in Microbiology 7: 221–226. Curtis, T.P., Sloan, W.T., and Scannell, J.W. (2002) Estimating prokaryotic diversity and its limits. Proceedings of the National Academy of Sciences USA 99: 10494–10499. Cushman, J.C. and Bohnert, H.J. (2000) Genomic approaches to plant stress tolerance. Current Opinion in Plant Biology 3: 117–124. Dallinger, R., Berger, B., Hunziker, P., and Ka¨gi, J.H.R. (1997) Metallothionein in snail Cd and Cu metabolism. Nature 388: 237–238. D’Amico, L.J., Davidowitz, G., and Nijhout, H.F. (2001) The developmental and physiological basis of body size evolution in an insect. Proceedings of the Royal Society of London Series B 268: 1589–1593. Daniel, R. (2004) The soil metagenome—a rich resource for the discovery of novel natural products. Current Opinion in Biotechnology 15: 199–204.
275
Daniel, R. (2005) The metagenomics of soil. Nature Reviews Microbiology 3: 470–478. Darwin, C. (1845) The Voyage of The ‘Beagle’. J.M. Dent & Sons, London. Darwin, C. (1859) On the Origin of Species by Means of Natural Selection, or the Preservation of Favoured Races in the Struggle for Life. Penguin Books, Harmondsworth. Davidowitz, G., D’Amico, L.J., and Nijhout, H.F. (2003) Critical weight in the development of insect body size. Evolution & Development 5: 188–197. De Gregorio, E., Spellman, P.T., Rubin, G.M., and Lemaitre, B. (2001) Genome-wide analysis of the Drosophila immune response by using oligonucleotide microarrays. Proceedings of the National Academy of Sciences USA 98: 12590–12595. De Jong, G. (1995) Phenotypic plasticity as a product of selection in a variable environment. American Naturalist 145: 493–512. De Jong, G. and Bochdanovits, Z. (2003) Latitudinal clines in Drosophila melanogaster: body size, allozyme frequencies, inversion frequencies, and the insulinsignalling pathway. Journal of Genetics 82: 207–223. De la Torre, J.R., Christianson, L.M., Be´ja`, O., Suzuki, M.T., Karl, D.M., Heidelberg, J., and DeLong, E.F. (2003) Proteorhodopsin genes are distributed among divergent marine bacterial taxa. Proceedings of the National Academy of Sciences USA 100: 12830–12835. De Meester, L. (1996) Local genetic differentiation and adaptation in freshwater zooplankton populations: Patterns and processes. Ecoscience 3: 385–399. Dehal, P., Satou, Y., Campbell, R.K., Chapman, J., Degnan, B., De Tomaso, A., Davidson, B., Di Gregorio, A., Gelpke, M., Goodstein, D.M. et al. (2002) The draft genome of Ciona intestinalis: insights into the chordate and vertebrate origins. Science 298: 2157–2167. DeLong, E.F. (2001) Microbial seascapes revisited. Current Opinion in Microbiology 4: 290–295. DeLong, E.F. (2005) Microbial community genomics in the ocean. Nature Reviews Microbiology 3: 459–469. Demerec, M. and Kaufmann, B.P. (1950) Drosophila Guide. A Guide to Introductory Studies of the Genetics and Cytology of Drosophila melanogaster. With an Appendix Containing a Series of Experiments to be Conducted by the Beginning Student. The Lord Baltimore Press, Baltimore. Denef, V.J., Park, J., Rodrigues, J.L.M., Hashsham, S.A., and Tiedje, J.M. (2003) Validation of a more sensitive method for using spotted oligonucleotide DNA microarrays for functional genomics studies on bacterial communities. Environmental Microbiology 5: 933–943.
276
REFERENCES
Denlinger, D.L. (2002) Regulation of diapause. Annual Review of Entomology 47: 93–122. Denver, D.R., Morris, K., Lynch, M., and Thomas, W.K. (2004) High mutation rate and predominance of insertions in the Caenorhabditis elegans nuclear genome. Nature 430: 679–682. Deppenheimer, U., Johann, A., Hartsch, T., Merkl, R., Schmitz, R.A., Martinez-Arias, R., Henne, A., Wiezer, A., Ba¨umer, S., Jacobi, C. et al. (2002) The genome of Methanosarcina mazei: evidence for lateral gene transfer between Bacteria and Archaea. Journal of Molecular Microbiology and Biotechnology 4: 453–461. DeRisi, J.L., Iyer, V.R., and Brown, P.O. (1997) Exploring the metabolic and genetic control of gene expression on a genomic scale. Science 278: 680–686. DeSantis, T.Z., Dubosarskiy, I., Murray, S.R., and Andersen, G.L. (2003) Comprehensive aligned sequence construction for automated design of effective probes (SASCADE-P) using 16S rDNA. Bioinformatics 19: 1461–1468. De Souza, J.T., Weller, D.M., and Raaijmakers, J.M. (2003) Frequency, diversity, and activity of 2,4diacetylphloroglucinol-producing fluorescent Pseudomonas spp. in Dutch take-all decline soils. Phytopathology 93: 54–63. Devlin, P.F., Yanovsky, M.J., and Kay, S.A. (2003) A genomic analysis of the shade avoidance response in Arabidopsis. Plant Physiology 133: 1617–1629. Devonshire, A.L. and Field, L.M. (1991) Gene amplification and insecticide resistance. Annual Review of Entomology 36: 1–23. Devos, K.M. and Gale, M.D. (2000) Genome relationships: the grass model in current research. The Plant Cell 12: 637–646. Di Meo, C.A., Wilbur, A.E., Holben, W.E., Feldman, R.A., Vrijenhoek, R.C., and Cary, S.C. (2000) Genetic variation among endosymbionts of widely distributed vestimentiferan tubeworms. Applied and Environmental Microbiology 66: 651–658. Diatchenko, L., Lau, Y.-F.C., Campbell, A.P., Chenchik, A., Moqadam, F., Huang, B., Lukyanov, S., Lukyanov, K., Gurskaya, N., Sverdlov, E.D., and Siebert, P.D. (1996) Suppression subtractive hybridisation: a method for generating differentially regulated or tissue-specific cDNA probes and libraries. Proceedings of the National Academy of Sciences USA 93: 6025–6030. Dicke, M., Van Poecke, R.M.P., and De Boer, J.G. (2003) Inducible indirect defence of plants: from mechanisms to ecological functions. Basic and Applied Ecology 4: 27–42.
Dicke, M., Van Loon, J.J.A., and De Jong, P.W. (2004) Ecogenomics benefits community ecology. Science 305: 618–619. Dietrich, F.S., Voegeli, S., Brachat, S., Lerch, A., Gates, K., Steiner, S., Mohr, C., Po¨hlmann, R., Luedi, P., Choi, S. et al. (2004) The Ashbya gossypii genome as a tool for mapping the ancient Saccharomyces cerevisiae genome. Science 304: 304–307. Dillin, A., Crawford, D.L., and Kenyon, C. (2002) Timing requirements for insulin/IGF-1 signaling in C. elegans. Science 298: 830–834. Dimopoulos, G., Casavant, T.L., Chang, S., Scheetz, T., Roberts, C., Donohue, M., Schultz, J., Benes, V., Bork, P., Ansorge, W. et al. (2000) Anopheles gambiae pilot gene discovery project: Identification of mosquito innate immunity genes from expressed sequence tags generated from immune-competent cell lines. Proceedings of the National Academy of Sciences USA 97: 6619–6624. Dionne, M.S. and Schneider, D.S. (2002) Screening the fruitfly immune system. Genome Biology 3: reviews 1010.1–1010.2. Domsch, K.H. (1984) Effects of pesticides and heavy metals on biological processes in soil. Plant and Soil 76: 367–378. Doolittle, W.F. (1999) Phylogenetic classification and the universal tree. Science 284: 2124–2128. Dopazo, H. and Dopazo, J. (2005) Genome-scale evidence of the nematode-arthropod clade. Genome Biology 6: R41. Dopson, M., Baker-Austin, C., Koppineedi, P.R., and Bond, P.L. (2003) Growth in sulfidic environments: metal resistance mechanisms in acidophilic microorganisms. Microbiology 149: 1959–1970. Dover, G. (1999) Human evolution: our turbulent genes and why we are not chimps. In The Human Inheritance. Genes, Language, and Evolution, B. Sykes (ed.). Oxford University Press, Oxford: 75–92. Drake, J.W., Charlesworth, B., Charlesworth, D., and Crow, J.F. (1998) Rates of spontaneous mutation. Genetics 148: 1667–1686. Dujon, B. (1996) The yeast genome project: what did we learn? Trends in Genetics 12: 263–270. Dujon, B., Sherman, D., Fischer, G., Durrens, P., Casaregola, S., Lafontaine, I., De Montigny, J., Marck, C., Neuve´glise, C., Talla, E. et al. (2004) Genome evolution in yeasts. Nature 430: 35–44. Dumont, M.G. and Murrell, J.C. (2005) Stable isotope probing—linking microbial identity to function. Nature Reviews Microbiology 3: 499–504.
REFERENCES
Duret, L. and Hurst, L.D. (2001) The elevated GC content at exonic third sites is not evidence against neutralist models of isochore evolution. Molecular Biology and Evolution 18: 757–762. Dwight, S.S., Balakrishnan, R., Christie, K.R., Costanzo, M.C., Dolinski, K., Engel, S.R., Feierbach, B., Fisk, D.G., Hirschman, J., Hong, E.L. et al. (2004) Saccharomyces genome database: underlying principles and organisation. Briefings in Bioinformatics 5: 9–22. Dykhuizen, D.E., Dean, A.M., and Hartl, D.L. (1987) Metabolic flux and fitness. Genetics 115: 25–31. Eckardt, N.A. (2002) Alternative splicing and the control of flowering time. The Plant Cell 14: 743–747. Eddy, S.R. (2005) A model of the statistical power of comparative genome sequence analysis. PLoS Biology 3: e10. Edwards, R.A. and Rohwer, F. (2005) Viral metagenomics. Nature Reviews Microbiology 3: 504–510. Egli, D., Selvaraj, A., Yepiskoposyan, H., Zhang, B., Hafen, E., Georgiev, O., and Schaffner, W. (2003) Knockout of ‘metal-responsive transcription factor’ MTF-1 in Drosophila by homologous recombination reveals its central role in heavy metal homeostasis. EMBO Journal 22: 100–108. Eide, D.J. (2001) Functional genomics and metal metabolism. Genome Biology 2: 1028.1–1028.3. Eisen, J.A. (2000) Horizontal gene transfer among microbial genomes: new insights from complete genome analysis. Current Opinion in Genetics & Development 10: 606–611. Eisen, M.B., Spellman, P.T., Brown, P.O., and Botstein, D. (1998) Cluster analysis and display of genome-wide expression patterns. Proceedings of the National Academy of Sciences USA 95: 14863–14868. El Fantroussi, S., Urakawa, H., Bernhard, A.E., Kelly, J.J., Noble, P.A., Smidt, H., Yershov, G.M., and Stahl, D.A. (2003) Direct profiling of environmental microbial populations by thermal dissociation analysis of native rRNAs hybridized to oligonucleotide arrays. Applied and Environmental Microbiology 69: 2377–2382. El-Assal, S.E.-D., Alonso-Blanco, C., Peeters, A.J.M., Raz, V., and Koornneef, M. (2001) A QTL for flowering time in Arabidopsis reveals a novel allele of CRY2. Nature Genetics 29: 435–440. Elton, C. (1927) Animal Ecology. Methuen & Co., London. Enard, W., Khaitovich, P., Klose, J., Zo¨llner, S., Heissig, F., Giavalisco, P., Nieselt-Struwe, K., Muchmore, E., Varki, A., Ravid, R. et al. (2002) Intra- and interspecific variation in primate gene expression patterns. Science 296: 340–343.
277
Evans, J.D. and Wheeler, D.E. (1999) Differential gene expression between developing queens and workers in the honey bee, Apis mellifera. Proceedings of the National Academy of Sciences USA 96: 5575–5580. Evans, J.D. and Wheeler, D.E. (2000) Expression profiles during honeybee caste determination. Genome Biology 2: research0001.1–0001.6. Evans, J.D. and Wheeler, D.E. (2001) Gene expression and the evolution of insect polyphenisms. BioEssays 23: 62–68. Falkowksi, P.G. and De Vargas, C. (2004) Shotgun sequencing in the sea: a blast from the past? Science 304: 58–60. Falkowksi, P.G., Katz, M.E., Knoll, A.H., Quigg, A., Raven, J.A., Schofield, O., and Taylor, F.J.R. (2004) The evolution of modern eukaryotic phytoplankton. Science 305: 354–360. Featherstone, D.E. and Broadie, K. (2002) Wrestling with pleiotropy: genomic and topological analysis of the yeast gene expression network. BioEssays 24: 267–274. Feder, M.E. and Hofmann, G.E. (1999) Heat shock proteins, molecular chaperones and the stress response: evolutionary and ecological physiology. Annual Review of Physiology 61: 243–282. Feder, M.E. and Mitchell-Olds, T. (2003) Evolutionary and ecological functional genomics. Nature Reviews Genetics 4: 649–655. Fell, D.A. (1992) Metabolic Control Analysis: a survey of its theoretical and experimental development. Biochemical Journal 286: 313–330. Finkel, T. and Holbrook, N.J. (2000) Oxidants, oxidative stress and the biology of ageing. Nature 408: 239–247. Fitch, D.H.A. and Thomas, W.K. (1997) Evolution. In C. Elegans II, D.L. Riddle, T. Blumenthal, B.J. Meyer, and J.R. Priess (eds), Cold Spring Harbor Monograph Series. Cold Spring Harbor Press, Cold Spring Harbor: 815–850. Fleischmann, R.D., Adams, M.D., White, O., Clayton, R.A., Kirkness, E.F., Kerlavage, A.R., Bult, C.J., Tomb, J.-F., Dougherty, B.A., Merrick, J.M. et al. (1995) Wholegenome random sequencing and assembly of Haemophilus influenzae Rd. Science 269: 496–512. Foster, S.A. and Baker, J.A. (2004) Evolution in parallel: new insights from a classic system. Trends in Ecology and Evolution 19: 456–459. Fox Keller, E. (2000) The Century of the Gene. Harvard University Press, Cambridge, MA. Fraser, A.G. and Marcotte, E.M. (2004) A probabilistic view of gene function. Nature Genetics 36: 559–564. Fredrickson, H.L., Perkins, E.J., Bridges, T.S., Tonucci, R.J., Fleming, J.K., Nagel, A., Diedrich, K.,
278
REFERENCES
Mendez-Tenorio, A., Doktycz, M.J., and Beattie, K.L. (2001) Towards environmental toxicogenomics— development of a flow-through, high density DNA hybridization array and its application to ecotoxicity assessment. The Science of the Total Environment 274: 137–149. Friedman, D.B. and Johnson, T.E. (1988) A mutation in the age-1 gene in Caenorhabditis elegans lengthens life and reduces hermaphrodite fertility. Genetics 118: 75–86. Friedrich, C.G., Rother, D., Bardischewsky, F., Quentmeier, A., and Fischer, J. (2001) Oxidation of reduced inorganic sulfur compounds by bacteria: emergence of a common mechanism? Applied and Environmental Microbiology 67: 2873–2882. Fu¨tterer, O., Angelov, A., Liesegang, H., Gottschalk, G., Schleper, C., Schepers, B., Dock, C., Antranikian, G., and Liebl, W. (2004) Genome sequence of Picrophilus torridus and its implications for life around pH 0. Proceedings of the National Academy of Sciences USA 101: 9091–9096. Gabor, E.M., Alkema, W.B.L., and Janssen, D.B. (2004) Quantifying the accessibility of the metagenome by random expression cloning techniques. Environmental Microbiology 6: 948–958. Galagan, J.E., Calvo, S.E., Borkovich, K.A., Selker, E.U., Read, N.D., Jaffe, D., FitzHugh, W., Ma, L.-J., Smirnov, S., Purcell, S. et al. (2003) The genome sequence of the filamentous fungus Neurospora crassa. Nature 422: 859–868. Galibert, F., Finan, T.M., Long, S.R., Pu¨hler, A., Abola, P., Ampe, F., Barloy-Hubler, F., Barnett, M.J., Becker, A., Boistard, P. et al. (2001) The composite genome of the legume symbiont Sinorhizobium meliloti. Science 293: 668–672. Gallardo, M.H., Bickham, J.W., Honeycutt, R.L., Ojeda, R.A., and Ko¨hler, N. (1999) Discovery of tetraploidy in a mammal. Nature 401: 341. Gallardo, M.H., Kausel, G., Jime´nez, A., Bacquet, C., Gonza´lez, C., Figuerora, J., Ko¨hler, N., and Ojeda, R. (2004) Whole-genome duplications in South American desert rodents (Octodontidae). Biological Journal of the Linnean Society 82: 443–451. Garbeva, P., Van Veen, J.A., and Van Elsas, J.D. (2004) Microbial diversity in soil: selection of microbial populations by plant and soil type and implications for disease suppressiveness. Annual Review of Phytopathology 42: 243–270. Gasch, A.P. and Werner-Washburne, M. (2002) The genomics of yeast responses to environmental stress. Functional and Integrative Genomics 2: 181–192.
Gasch, A.P., Spellman, P.T., Kao, C.M., Carmel-Harel, O., Eisen, M.B., Storz, G., Botstein, D., and Brown, P.O. (2000) Genomic expression programs in the response of yeast cells to environmental changes. Molecular Biology of the Cell 11: 4241–4257. Gems, D. and Partridge, L. (2001) Insulin/IGF signalling and ageing: seeing the bigger picture. Current Opinion in Genetics & Development 11: 287–292. Gems, D. and McElwee, J.J. (2003) Microarraying mortality. Nature 424: 259–261. Getz, W.M., Westerhoff, H.V., Hofmeyr, J.-H.S., and Snoep, J.L. (2003) Control analysis of trophic chains. Ecological Modelling 168: 153–171. Giannakou, M.E., Goss, M., Ju¨nger, M.A., Hafen, E., Leevers, S.J., and Partridge, L. (2004) Long-lived Drosophila with over-expressed dFOXO in adult fat body. Science 305: 361. Gibson, G. (2002) Microarrays in ecology and evolution: a preview. Molecular Ecology 11: 17–24. Gibson, G. and Mackay, T.F.C. (2002) Enabling population and quantitative genomics. Genetical Research (Cambridge) 80: 1–6. Gibson, G. and Muse, S.V. (2002) A Primer of Genome Science. Sinauer Associates, Sunderland, MA. Gillespie, D.E., Brady, S.F., Bettermann, A.D., Cianciotto, N.P., Liles, M.R., Rondon, M.R., Clardy, J., Goodman, R.M., and Handelsman, J. (2002) Isolation of antibiotics turbomycin A and B from a metagenomic library of soil microbial DNA. Applied and Environmental Microbiology 68: 4301–4306. Gillott, C. (1980) Entomology. Plenum Press, New York. Girardot, F., Monnier, V., and Tricoire, H. (2004) Genome wide analysis of common and specific stress responses in adult drosophila melanogaster. BMC Genomics 5: 1471–2164/5/74. Goff, S.A., Ricke, D., Lan, T.-H., Presting, G., Wang, R., Dunn, M., Glazebrook, J., Sessions, A., Oeller, P., Varma, H. et al. (2002) A draft sequence of the rice genome (Oryza sativa L. ssp. japonica). Science 296: 92–100. Goffeau, A., Barrell, B.G., Bussey, H., Davis, R.W., Dujon, B., Feldmann, H., Galibert, F., Hoheisel, J.D., Jacq, C., Johnston, M. et al. (1996) Life with 6000 genes. Science 274: 546–567. Golden, T.R. and Melov, S. (2004) Microarray analysis of gene expression with age in individual nematodes. Aging Cell 3: 111–124. Goldstein, D.B. and Schlo¨tterer, C. (eds) (1999) Microsatellites. Evolution and Applications. Oxford University Press, Oxford. Go´mez-Mena, C., Pin˜eiro, M., Franco-Zorilla, J.M., Salinas, J., Coupland, G., and Martı´nez-Zapater, J.M.
REFERENCES
(2001) early bolting in short days: An Arabidopsis mutation that causes early flowering and partially suppresses the floral phenotype of leafy. The Plant Cell 13: 1011–1024. Gonzalez, P., Dominique, Y., Massabuau, J.C., Boudou, A., and Bourdineaud, J.P. (2005) Comparative effects of dietary methylmercury on gene expression in liver, skeletal muscle, and brain of the zebrafis (Danio rerio). Environmental Science and Technology 39: 3972–3980. Gonza´lez, V., Bustos, P., Ramı´rez-Romero, M.A., Medrana-Soto, A., Salgado, H., Herna´ndez-Gonza´lez, I., Herna´ndez-Celis, J.C., Quintero, V., MorenoHagelsieb, G., Girard, L. et al. (2003) The mosaic structure of the symbiotic plasmid of Rhizobium etli CFN42 and its relation to other symbiotic genome compartments. Genome Biology 4: R36. Goodner, B., Hinkle, G., Gattung, S., Miller, N., Blanchard, M., Qurollo, B., Goldman, B.S., Cao, Y., Askenazi, M., Halling, C. et al. (2001) Genome sequence of the plant pathogen and biotechnology agent Agrobacterium tumefaciens C58. Science 294: 2323–2328. Go¨rner, W., Durchschlag, E., Martinez-Pastor, M.T., Estruch, F., Ammerer, G., Hamilton, B., Ruis, H., and Schu¨ller, C. (1998) Nuclear localization of the C2H2 zinc finger protein Mns2p is regulated by stress and protein kinase A activity. Genes & Development 12: 586–597. Goto, S.G. and Denlinger, D.L. (2002) Short-day and long-day expression patterns of genes involved in the flesh fly clock mechanism: period, timeless, cycle and cryptochrome. Journal of Insect Physiology 48: 803–816. Govind, S. and Nehm, R.H. (2004) Innate immunity in fruit flies: a textbook example of genomic recycling. PLoS Biology 2: 1065–1068. Gracey, A.Y. and Cossins, A.R. (2003) Application of microarray technology in environmental and comparative physiology. Annual Review of Physiology 65: 231–259. Gracey, A.Y., Troll, J.V., and Somero, G.N. (2001) Hypoxia-induced gene expression profiling in the euryoxic fish Gillichthys mirabilis. Proceedings of the National Academy of Sciences USA 98: 1993–1998. Graur, D. and Li, W.-H. (2000) Fundamentals of Molecular Evolution. Sinauer Associates, Sunderland, MA. Gray, M.W., Burger, G., and Lang, B.F. (1999) Mitochondrial evolution. Science 283: 1476–1481. Gray, N.D. and Head, I.M. (2001) Linking genetic identity and function in communities of uncultured bacteria. Environmental Microbiology 3: 481–492. Greer, C.W., Whyte, L.G., Lawrence, J.R., Masson, L., and Brousseau, R. (2001) Genomic technologies for
279
environmental science. Environmental Science and Technology 35: 360A–366A. Gregory, T.R. (ed.) (2005) The Evolution of the Genome. Elsevier Academic Press, Amsterdam. Greilhuber, J., Dolezel, J., Lysa´k, M.A., and Bennett, M.D. (2005) The origin, evolution and proposed stabilization of the terms ‘Genome size’ and ‘C-value’ to describe nuclear DNA contents. Annals of Botany 95: 255–260. Griffiths, S., Dunford, R.P., Coupland, G., and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiology 131: 1855–1867. Gross, C., Kelleher, M., Iyer, V.R., Brown, P.O., and Winge, D.R. (2000) Identification of the copper regulon in Saccharomyces cerevisae by DNA microarrays. Journal of Biological Chemistry 275: 32310–32316. Grossman, A.R., Harris, E.E., Hauser, C., Lefebvre, P.A., Martinez, D., Rokhsar, D., Shrager, J., Silflow, C.D., Stern, D., Vallon, O., and Zhang, Z. (2003) Chlamydomonas reinhardtii at the crossroads of genomics. Eukaryotic Cell 2: 1137–1150. Guarante, L. and Kenyon, C. (2000) Genetic pathways that regulate ageing in model organisms. Nature 408: 255–261. Guiliano, D.B., Hall, N., Jones, S.J.M., Clark, L.N., Corton, C.H., Barrell, B.G., and Blaxter, M.L. (2003) Conservation of long-range synteny and microsynteny between the genomes of two distantly related nematodes. Genome Biology 3: research/0057/I–14. Gutman, B.L. and Niyogi, K.K. (2004) Chlamydomonas and Arabidopsis. A dynamic duo. Plant Physiology 135: 607–610. Halitschke, R., Ziegler, J., Keina¨nen, M., and Baldwin, I.T. (2004) Silencing of hydroperoxide lyase and allene oxide synthase reveals substrate and defense signaling crosstalk in Nicotiana attenuata. The Plant Journal 40: 35–46. Hamadeh, H.K., Bushel, P.R., Jayadev, S., Martin, K., DiSorbo, O., Sieber, S., Bennett, L., Tennant, R., Stoll, R., Barrett, J.C. et al. (2002) Gene expression analysis reveals chemical-specific profiles. Toxicological Sciences 67: 219–231. Handelsman, J. (2004) Metagenomics: applications of genomics to uncultured microorganisms. Microbiology and Molecular Biology Reviews 68: 669–685. Handelsman, J., Liles, M., Mann, D., Riesenfeld, C., and Goodman, R.M. (2002) Cloning the metagenome: culture-independent access to the diversity and functions of the uncultivated microbial world. Methods in Microbiology 33: 241–255. Haq, F., Mahoney, M., and Koropatnick, J. (2003) Signaling events for metallothionein induction. Mutation Research 533: 211–226.
280
REFERENCES
Harborne, J.B. (1997) Introduction to Ecological Biochemistry. Academic Press, London. Harmer, S.L., Hogenesch, J.B., Straume, M., Chang, H.-S., Han, B., Zhu, T., Wang, X., Kreps, J.A., and Kay, S.A. (2000) Orchestrated transcription of key pathways in Arabidopsis by the circadian clock. Science 290: 2110–2113. Harries, J.E., Sheahan, D.A., Jobling, S., Matthiessen, P., Neall, P., Sumpter, J.P., Tylor, T., and Zaman, N. (1997) Estrogenic activity in five United Kingdom rivers detected by measurement of vitellogenesis in caged male trout. Environmental Toxicology and Chemistry 16: 534–542. Harris, E.H. (2001) Chlamydomonas as a model organism. Annual Review of Plant Physiology and Plant Molecular Biology 52: 363–406. Harris, T.W., Chen, N., Cunningham, F., Tello-Ruiz, M., Antoshechkin, I., Bastiani, C., Bieri, T., Blasiar, D., Bradnam, K., Chan, J. et al. (2004) WormBase: a multispecies resource for nematode biology and genomics. Nucleic Acids Research 32: D411–D417. Hartl, D.L. and Clark, A.G. (1997) Principles of Population Genetics, 3rd edn. Sinauer Associates, Sunderland, MA. Hayama, R. and Coupland, G. (2004) The molecular basis of diversity in the photoperiodic flowering responses of Arabidopsis and rice. Plant Physiology 135: 677–684. Hayama, R., Yokoi, S., Tamaki, S., Yano, M., and Shimamoto, K. (2003) Adaptation of photoperiodic control pathways produces short-day flowering in rice. Nature 422: 719–722. Haymes, K.M., Van de Weg, W.E., Arens, P., Vosman, B., and Den Nijs, A.P.M. (1997) Molecular mapping and construction of SCAR markers of the strawberry Rpf1 resistance gene to Phytophthora fragariae and their use in breeding programmes. Acta Horticulturae 439: 845–851. He, Y., Michaels, S.D., and Amasino, R.M. (2003) Regulation of flowering time by histone acetylation in Arabidopsis. Science 302: 1751–1754. Heckel, D.G. (2003) Genomics in pure and applied entomology. Annual Review of Entomology 48: 235–260. Hedges, S.B. (2002) The origin and evolution of model organisms. Nature Reviews Genetics 3: 838–849. Heemsbergen, D.A., Berg, M.P., Loreau, M., Van Hal, J.R., Faber, J.H., and Verhoef, H.A. (2004) Biodiversity effects on soil processes explained by interspecific functional dissimilarity. Science 306: 1019–1020. Heidel, A.J. and Baldwin, I.T. (2004) Microarray analysis of salicylic acid- and jasmonic acid-signalling in responses of Nicotiana attenuata to attack by insects from multiple feeding guilds. Plant, Cell and Environment 27: 1362–1373.
Heidelberg, J.F., Paulsen, I.T., Nelson, K.E., Gaidos, E.J., Nelson, W.C., Read, T.D., Eisen, J.A., Seshadri, R., Ward, N., Methe, B. et al. (2002) Genome sequence of the dissimilatory metal ion-reducing bacterium Shewanella oneidensis. Nature Biotechnology 20: 1118–1123. Heidelberg, J.F., Seshadri, R., Haveman, S.A., Hemme, C.L., Paulsen, I.T., Kolonay, J.F., Eisen, J.A., Ward, N., Methe, B., Brinkac, L.M. et al. (2004) The genome sequence of the anaerobic, sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough. Nature Biotechnology 22: 554–559. Hekimi, S. and Guarante, L. (2003) Genetics and the specificity of the aging process. Science 299: 1351–1354. Held, M., Gase, K., and Baldwin, I.T. (2004) Microarrays in ecological research: a case study of a cDNA microarray for plant-herbivore interactions. BMC Ecology 4: 13. Henne, A., Schmitz, R.A., Bo¨meke, M., Gottschalk, G., and Daniel, R. (2000) Screening of environmental DNA libraries for the presence of genes conferring lipolytic activity on Escherichia coli. Applied and Environmental Microbiology 66: 3113–3116. Hensbergen, P.J., Donker, M.H., Van Velzen, M.J.M., Roelofs, D., Van der Schors, R.C., Hunziker, P.E., and Van Straalen, N.M. (1999) Primary structure of a cadmium-induced metallothionein from the insect Orchesella cincta (Collembola). European Journal of Biochemistry 259: 197–203. Hill, A.A., Hunter, C.P., Tsung, B.T., Tucker-Kellogg, G., and Brown, E.L. (2000) Genomic analysis of gene expression in C. elegans. Science 290: 809–812. Hirotsune, S., Yoshida, N., Chen, A., Garrett, L., Wynshaw-Boris, A., Sugiyama, F., Takahashi, S., Yagami, K.-I., and Yoshiki, A. (2003) An expressed pseudogene regulates the messenger-RNA stability of its homologous coding gene. Nature 423: 91–96. Hodgkin, J., Plasterk, R.H.A., and Waterston, R.H. (1995) The nematode Caenorhabditis elegans and its genome. Science 270: 410–414. Hoffmann, A.A., and Hercus, M.J. (2000) Environmental stress as an evolutionary force. BioScience 50: 217–226. Hoffmann, J.A. and Reichhart, J.-M. (2002) Drosophila innate immunity: an evolutionary perspective. Nature Immunology 3: 121–126. Hoffmann, M.H. (2002) Biogeography of Arabidopsis thaliana (L.) Heynh. (Brassicaceae). Journal of Biogeography 29: 125–134. Holt, R.A., Subramanian, G.M., Halpern, A., Sutton, G.G., Charlab, R., Nusskern, D.R., Wincker, P., Clark, A.G., Ribeiro, J.M.C., Wides, R. et al. (2002) The genome sequence of the malaria mosquito Anopheles gambiae. Science 298: 129–149.
REFERENCES
Holt, S.J. and Riddle, D.L. (2003) SAGE surveys C. elegans carbohydrate metabolism: evidence for an anaerobic shift in the long-lived dauer larva. Mechanisms of Ageing and Development 124: 770–800. Holter, N.S., Mitra, M., Maritan, A., Cieplak, M., Banavar, J.R., and Federoff, N.V. (2000) Fundamental patterns underlying gene expression profiles: simplicity from complexity. Proceedings of the National Academy of Sciences USA 97: 8409–8414. Holzenberger, M., Dupont, J., Ducos, B., Leneuve, P., Ge´loe¨n, A., Even, P.C., Cervera, P., and Le Bouc, Y. (2003) IGF-1 receptor regulates lifespan and resistance to oxidative stress in mice. Nature 421: 182–187. Hopkin, S.P. (1989) Ecophysiology of Metals in Terrestrial Invertebrates. Elsevier Applied Science, London. Horner-Devine, M., Carney, K.M., and Bohannan, B.J.M. (2004) An ecological perspective on bacterial biodiversity. Proceedings of the Royal Society of London, Series B 271: 113–122. Houthoofd, K., Braeckman, B.P., Lenaerts, I., Brys, K., De Vreese, A., Van Eygen, S., and Vanfleteren, J.R. (2002) Axenic growth up-regulates mass-specific metabolic rate, stress resistance, and extends life span in Caenorhabditis elegans. Experimental Gerontology 37: 1369–1376. Houthoofd, K., Braeckman, B.P., Johnson, T.E., and Vanfleteren, J.R. (2003) Life extension via dietary restriction is independent of the Ins/IGF-1 signalling pathway in Caenorhabditis elegans. Experimental Gerontology 38: 947–954. Hoy, M.A. (1994) Insect Molecular Genetics. Academic Press, San Diego. Hsu, A.-L., Murphy, C.T., and Kenyon, C. (2003) Regulation of aging and age-related disease by DAF-16 and heat-shock factor. Science 300: 1142–1145. Huang, J., Mullapudi, N., Lancto, C.A., Scott, M., Abrahamsen, M.S., and Kissinger, J.C. (2004) Phylogenomic evidence supports past endosymbiosis, intracelullar and horizontal gene transfer in Cryptosporidium parvum. Genome Biology 5: R88. Huber, H., Hohn, M.J., Rachel, R., Fuchs, T., Wimmer, V.C., and Stetter, K.O. (2002) A new phylum of Archaea represented by a nanosized hyperthermophilic symbiont. Nature 417: 63–67. Hughes, A.L. (1999) Adaptive Evolution of Genes and Genomes. Oxford University Press, New York. Hughes, J.B., Hellmann, J.J., Ricketts, T.H., and Bohannan, B.J. (2001) Counting the uncountable: statistical approaches to estimating diversity. Applied and Environmental Microbiology 67: 4399–4406. Hui, D., Iqbal, J., Lehman, K., Gase, K., Saluz, H.P., and Baldwin, I.T. (2003) Molecular interactions between
281
the specialist herbivore Manduca sexta (Lepidoptera, Sphingidae) and its natual host Nicotiana attenuata: V. Microarray analysis and further characterization of large-scale changes in herbivore-induced mRNAs. Plant Physiology 131: 1877–1893. Hulbert, A.J., Clancy, D.J., Mair, W., Braeckman, B.P., Gems, D., and Partridge, L. (2004) Metabolic rate is not reduced by dietary-restriction or by lowered insulin/ IGF-1 signalling and is not correlated with individual lifespan in Drosophila melanogaster. Experimental Gerontology 39: 1137–1143. Hurst, L.D. (2002) The Ka/Ks ratio: diagnosing the form of sequence evolution. Trends in Genetics 18: 486–487. Hurtado, L.A., Lutz, R.A., and Vrijenhoek, R.C. (2004) Distinct patterns of genetic differentiation among annelids of eastern Pacific hydrothermal vents. Molecular Ecology 13: 2603–2615. Hutchinson, G.E. (1957) Concluding remarks. In Cold Spring Harbor Symposia on Quantitative Biology. Volume XXII Population Studies: Animal Ecology and Demography. Cold Spring Harbor Press, New York: 415–427. Ideker, T., Galitski, T., and Hood, L. (2000) A new approach to decoding life: systems biology. Annual Review of Genomics and Human Genetics 2: 343–372. International Chicken Genome Sequencing Consortium (2004) Sequence and comparative analysis of the chicken genome provide unique perspectives on vertebrate evolution. Nature 432: 695–716. Irving, P., Troxler, L., Heuer, T.S., Belvin, M., Kopczynski, C., Reichhart, J.-M., Hoffmann, J.A., and Hetru, C. (2001) A genome-wide analysis of immune responses in Drosophila. Proceedings of the National Academy of Sciences USA 98: 15119–15124. Jablonka, E. and Lamb, M.J. (2002) The changing concept of epigenetics. Annals of the New York Academy of Sciences 981: 82–96. Jackson, R.B., Linder, C.R., Lynch, M., Purugganan, M.D., Somerville, S., and Thayer, S.S. (2002) Linking molecular insight and ecological research. Trends in Ecology and Evolution 19: 409–414. Jacob, F. (1977) Evolution and tinkering. Science 196: 1161–1166. Jacobson, D.J., Powell, A.J., Dettman, J.R., Saenz, G.S., Barton, M., Hiltz, M.D., Dvorachek Jr., W.H., Glass, N.L., Taylor, J.W., and Natvig, D.O. (2004) Neurospora in temperate forests of western North America. Mycologia 96: 66–74. Jaillon, O., Aury, J.-M., Brunet, F., Petit, J.-L., StangeThomann, N., Maucell, E., Bouneau, L., Fischer, C., Ozouf-Costaz, C., Bernot, A. et al. (2004) Genome duplication in the teleost fish Tetraodon nigroviridis
282
REFERENCES
reveals the early vertebrate proto-karyotype. Nature 431: 946–957. Jain, R., Rivera, M.C., and Lake, J.A. (1999) Horizontal gene transfer among genomes: The complexity hypothesis. Proceedings of the National Academy of Sciences USA 96: 3801–3806. Jaiswal, A.K. (2004) Nrf2 signaling in coordinated activation of antioxidant gene expression. Free Radical Biology & Medicine 36: 1199–1207. Jansen, R.C. and Stam, P. (1994) High resolution of quantitative traits into multiple loci via interval mapping. Genetics 136: 1447–1455. Jansen, R.C. and Nap, J.-P. (2001) Genetical genomics: the added value from segregation. Trends in Genetics 17: 388–391. Jarne, P. and Lagoda, P.J.L. (1996) Microsatellites, from molecules to populations and back. Trends in Ecology and Evolution 11: 424–429. Jenkins, B.D., Steward, G.F., Short, S.M., Ward, B.B., and Zehr, J.P. (2004) Fingerprinting diazotroph communities in the Chesapeake Bay by using a DNA macroarray. Applied and Environmental Microbiology 60: 1767–1776. Jensen, P.R., Snoep, J.L., Molenaar, D., Van Heeswijk, W.C., Khodolenko, B.N., Van der Gugten, A.A., and Westerhoff, H.V. (1995) Molecular biology for flux control. Biochemical Society Transactions 23: 367–370. Jessup, C.M., Kassen, R., Forde, S.E., Kerr, B., Buckling, A., Rainey, P.B., and Bohannan, B.J.M. (2004) Big questions, small worlds: microbial model systems in ecology. Trends in Ecology and Evolution 19: 189–197. Ji, W., Wright, M.B., Cai, L., Flament, A., and Lindpaintner, K. (2002) Efficacy of SSH PCR in isolating differentially expressed genes. BMC Genomics 3: 12. Jiang, M., Ryu, J., Kiraly, M., Duke, K., Reinke, V., and Kim, S.K. (2001) Genome-wide analysis of developmental and sex-regulated expression profiles in Caenorhabditis elegans. Proceedings of the National Academy of Sciences USA 98: 218–223. Jin, W., Riley, R.M., Wolfinger, R.D., White, K.P., PassadorGurgel, G., and Gibson, G. (2001) The contributions of sex, genotype and age to transcriptional variance in Drosophila melanogaster. Nature Genetics 29: 389–395. Jones, S.J.M., Riddle, D.L., Pouzyrev, A.T., Velculescu, V.E., Hillier, L., Eddy, S.R., Stricklin, S.L., Baillie, D.L., Waterston, R., and Marra, M.A. (2001) Changes in gene expression associated with developmental arrest and longevity in Caenorhabditis elegans. Genome Research 11: 1346–1352. Judice, C., Hartfelder, K., and Pereira, G.A.G. (2004) Caste-specific gene expression in the stingless bee
Melipone quadrifasciata—are there common patterns in highly social bees? Insectes Sociaux 51: 352–358. Kacser, H. and Burns, J.A. (1995) The control of flux (with additional comments by H. Kacser and D.A. Fell). Biochemical Society Transactions 23: 341–366. Kaeberlein, T., Lewis, K., and Epstein, S.S. (2002) Isolating ‘uncultivable’ microorganisms in pure culture in a simulated natural environment. Science 296: 1127–1129. Kaltz, O. and Bell, G. (2002) The ecology and genetics of fitness in Chlamydomonas. XII. Repeated sexual episodes increase rates of adaptation to novel environment. Evolution 56: 1743–1753. Kanao, T., Fukui, T., Atomi, H., and Imanaka, T. (2001) ATP-citrate lyase from the green sulfur bacterium Chlorobium limicola is a heteromeric enzyme composed of two distinct gene products. European Journal of Biochemistry 268: 1670–1678. Kaneko, T., Sato, S., Kotani, H., Tanaka, A., Asamizu, E., Nakamura, Y., Miyajima, N., Hirosawa, M., Sugiura, M., Sasamoto, S. et al. (1996) Sequence analysis of the genome of the unicellular cyanobacterium Synechocystis sp. strain PCC6803. II. Sequence determination of the entire genome and assignment of potential proteincoding regions. DNA Research 3: 109–136. Kassen, R. and Rainey, P.B. (2004) The ecology and genetics of microbial diversity. Annual Review of Microbiology 58: 207–231. Kasuga, M., Liu, G., Miura, S., Yamaguchi-Shinozaki, K., and Shinozaki, K. (1999) Improving plant drought, salt, and freezing tolerance by gene transfer of a single stressinducible transcription factor. Nature Biotechnology 17: 287–291. Katschinski, D.M. and Glueck, S.B. (2003) Hot worms can handle heavy metal. Focus on ‘HIF-1 is required for heat acclimation in the nematode Caenorhabditis elegans’. Physiological Genomics 14: 1–2. Kawasaki, S., Borchert, C., Deyholos, M., Wang, H., Brazille, S., Kawai, K., Galbraith, D., and Bohnert, H.J. (2001) Gene expression profiles during the initial phase of salt stress in rice. The Plant Cell 13: 889–905. Keightley, P.D. and Eyre-Walker, A. (1999) Terumi Mukai and the riddle of deleterious mutation rates. Genetics 153: 515–523. Keightley, P.D. and Charlesworth, B. (2005) Genetic instability of C. elegans comes naturally. Trends in Genetics 21: 67–70. Kellis, M., Patterson, N., Endrizzi, M., Birren, B., and Lander, E.S. (2003) Sequencing and comparison of yeast species to identify genes and regulatory elements. Nature 423: 241–254.
REFERENCES
Kellis, M., Birren, B.W., and Lander, E.S. (2004) Proof and evolutionary analysis of ancient genome duplication in the yeast Saccharomyces cerevisiae. Nature 428: 617–624. Kenyon, C., Chang, J., Gensch, E., Rudner, A., and Tabtiang, R. (1993) A C. elegans mutant that lives twice as long as wild type. Nature 366: 461–464. Kerr, M.K. and Churchill, G.A. (2001) Statistical design and the analysis of gene expression microarray data. Genetical Research (Cambridge) 77: 123–128. Kersting, K. (1984) Normalized ecosystem strain: a system parameter for the analysis of toxic stress in (micro-)ecosystems. Ecological Bulletins 36: 150–153. Kessler, A. and Baldwin, I.T. (2002) Plant responses to insect herbivory: the emerging molecular analysis. Annual Review of Plant Biology 53: 299–328. Kessler, A., Halitschke, R., and Baldwin, I.T. (2004) Silencing the jasmonate cascade: induced plant defenses and insect populations. Science 305: 665–668. Kim, H.-J., Hyun, Y., Park, J.-Y., Park, M.-J., Park, M.-K., Kim, M.D., Kim, H.-J., Lee, M.H., Moon, J., Lee, I., and Kim, J. (2004) A genetic link between cold responses and flowering time through FVE in Arabidopsis thaliana. Nature Genetics 36: 167–171. Kim, K.W., Shin, J.-H., Moon, J., Kim, M., Lee, J., Park, M.-C., and Lee, I. (2003) The function of flowering time gene AGL20 is conserved in crucifers. Molecules and Cells 16: 136–141. Kim, P.M. and Tidor, B. (2003) Subsystem identification through dimensionality reduction of large-scale gene expression data. Genome Research 13: 1706–1718. Kim, S.K., Lund, J., Kiraly, M., Duke, K., Jiang, M., Stuart, J.M., Eizinger, A., Wylie, B.N., and Davidson, G.S. (2001) A gene expression map for Caenorhabditis elegans. Science 293: 2087–2092. Kirkwood, T.B.L. and Austad, S.N. (2000) Why do we age? Nature 408: 233–238. Kitano, H. (2002) Systems biology: a brief overview. Science 295: 1662–1664. Knietsch, A., Waschkowitz, T., Bowien, S., Henne, A., and Daniel, R. (2003) Construction and screening of metagenomic libraries derived from enrichment cultures: generation of a gene bank for genes conferring alcohol oxidoreductase activity on Escherichia coli. Applied and Environmental Microbiology 69: 1408–1416. Kobayashi, M. and Yamamoto, M. (2005) Molecular mechanisms activating the Nrf2-Keap1 pathway of antioxidant gene regulation. Antioxidants & Redox Signaling 7: 385–394. Koeman, J.H. (1996) Toxicology, history and scope of the field. In Toxicology. Principles and Applications,
283
R.J.M. Niesink, J. De Vries, and M.A. Hollinger (eds). CRC Press, Boca Raton, FL: 3–14. Kole, C., Quijada, P., Michaels, S.D., Amasino, R.M., and Osborn, T.C. (2001) Evidence for homology of flowering-time genes VFR2 from Brassica rapa and FLC from Arabidopsis thaliana. Theoretical and Applied Genetics 102: 425–430. Kondrashov, F.A., Rogozin, I.B., Wolf, Y.I., and Koonin, E.V. (2002) Selection in the evolution of gene duplications. Genome Biology 3: research0008.1–0008.9. Kong, A.-N.T., Owuor, E., Yu, R., Hebbar, V., Chen, C., Hu, R., and Mandlekar, S. (2001) Induction of xenobiotic enzymes by the MAP kinase pathway and the antioxidant or electrophile response element (ARE/ EpRE). Drug Metabolism Reviews 33: 255–271. Kooijman, S.A.L.M. (2000) Dynamic Energy and Mass Budgets in Biological Systems. Cambridge University Press, Cambridge. Koonin, E.V., Makarova, K.S., and Aravind, L. (2001) Horizontal gene transfer in prokaryotes: quantification and classification. Annual Review of Microbiology 55: 709–742. Koornneef, M. (2004) Naturally occurring genetic variation in Arabidopsis thaliana. Annual Review of Plant Biology 55: 141–172. Koornneef, M., Alonso-Blanco, C., Peeters, A.J.M., and Soppe, W. (1998) Genetic control of flowering time in Arabidopsis. Annual Review of Plant Physiology and Plant Molecular Biology 49: 345–370. Korsloot, A., Van Gestel, C.A.M., and Van Straalen, N.M. (2004) Environmental Stress and Cellular Response in Arthropods. CRC Press, Boca Raton, FL. Korth, K.L. (2003) Profiling the response of plants to herbivorous insects. Genome Biology 4: 221. Kowalchuk, G.A. and Stephen, J.R. (2001) Ammoniaoxidizing bacteria: a model for molecular microbial ecology. Annual Review of Microbiology 55: 485–529. Kozlowski, J. (1993) Measuring fitness in life-history studies. Trends in Ecology and Evolution 8: 84–85. Krebs, C.J. (1999) Ecological Methodology. Addison Wesley Longman, Menlo Park, CA. Kreps, J.A., Wu, Y., Chang, H.-S., Zhu, T., Wang, X., and Harper, J.F. (2002) Transcriptome changes for Arabidopsis in response to salt, osmotic en cold stress. Plant Physiology 130: 2129–2141. Kulaev, I. and Kulakoskaya, T. (2000) Polyphosphate and phosphate pump. Annual Review of Microbiology 54: 709–734. Lander, E.S. and Waterman, M.S. (1988) Genomic mapping by fingerprinting random clones: a mathematical analysis. Genomics 2: 231–239.
284
REFERENCES
Lang, B.F., Burger, G., O’Kelly, C.J., Cedergren, R., Golding, G.B., Lemieux, C., Sankoff, D., Turmel, M., and Gray, M.W. (1997) An ancestral mitochondrial DNA resembling a eubacterial genome in miniature. Nature 387: 493–497. ˚ ., Lohm, J., Grahn, M., Andersen, Ø., and Langefors, A Von Schantz, T. (2001) Association between major histocompatibility complex class IIB alleles and resistance to Aeromonas salmonicida in Atlantic salmon. Proceedings of the Royal Society of London, Series B 268: 479–485. Larcher, W. (2003) Physiological Plant Ecology, 4th edn. Ecophysiology and Stress Physiology of Functional Groups. Springer, Berlin. Larkin, P., Folmar, L.C., Hemmer, M.J., Poston, A.J., Lee, H.S., and Denslow, N.D. (2002) Array technology as a tool to monitor exposure of fish to xenoestrogens. Marine Environmental Research 54: 395–399. Laverman, A.M., Speksnijder, A.G.C.L., Braster, M., Kowalchuk, G.A., and Verhoef, H.A. (2001) Spatiotemporal stability of an ammonia-oxidizing community in a nitrogen-saturated forest soil. Microbial Ecology 42: 35–45. Lawton, J.H. (1994) What do species do in ecosystems? Oikos 71: 367–374. Lederberg, J. and McCray, A.T. (2001) ‘Ome sweet’ omics—A genealogical treasure of words. The Scientist 15: 8. Lee, K.A. and Klasing, K.C. (2004) A role of immunology in invasion biology. Trends in Ecology and Evolution 19: 523–529. Lee, S.S., Kennedy, S., Tolonen, A.C., and Ruvkun, G. (2003) DAF-16 target genes that control C. elegans lifespan and metabolism. Science 300: 644–647. Leemans, R., Egger, B., Loop, T., Kammermeier, L., He, H., Hartman, B., Certa, U., Hirth, F., and Reichert, H. (2000) Quantitative transcript imaging in normal and heatshocked Drosophila embryos by using high-density oligonucleotide arrays. Proceedings of the National Academy of Sciences USA 97: 12138–12143. Leroi, A.M. (2001) Molecular signals versus the Loi de Balancement. Trends in Ecology and Evolution 16: 24–29. Leroi, A.M., Bartke, A., De Benedictis, G., Franceschi, C., Gartner, A., Gonos, E., Feder, M.E., Kisivild, T., Lee, S., ¨ zer, N. et al. (2005) What evidence is there Kartal-O for the existence of individual genes with antagonistic pleiotropic effects? Mechanisms of Ageing and Development 126: 421–429. Lesk, A.M. (2002) Introduction to Bioinformatics. Oxford University Press, Oxford.
Lessels, K. and Colegrave, N. (2001) Molecular signals or the Loi de Balancement? Trends in Ecology and Evolution 16: 284–285. Levine, S.N. (1989) Theoretical and methodological reasons for variability in the responses of aquatic ecosystem processes to chemical stress. In Ecotoxicology: Problems and Approaches, S.A. Levin, M.A. Harwell, J.R. Kelly, and K.D. Kimball (eds). Springer Verlag, New York: 145–179. Li, X., Schuler, M.A., and Berenbaum, M.R. (2002) Jasmonate and salicylate induce expression of herbivore cytochrome P450 genes. Nature 419: 712–715. Liang, P. and Pardee, A.B. (1992) Differential display of eukaryotic messenger RNA by means of the polymerase chain reaction. Science 257: 967–970. Liao, V.H.-C., Dong, J., and Freedman, J.H. (2002) Molecular characterization of a novel, cadmiuminducible gene from the nematode Caenorabditis elegans. Journal of Biological Chemistry 277: 42049–42059. Liberles, D.A., Schreiber, D.R., Govindarajan, S., Chamberlin, S.G., and Benner, S.A. (2001) The Adaptive Evolution Database (TAED). Genome Biology 2: research 0028.1–0028.6. Liles, M.R., Manske, B.F., Bintrim, S.B., Handelsman, J., and Goodman, R.M. (2003) A census of rRNA genes and linked genomic sequences within a soil metagenomic library. Applied and Environmental Microbiology 69: 2684–2691. Lin, K., Hsin, H., Libina, N., and Kenyon, C. (2001) Regulation of the Caenorhabditis elegans longevity protein DAF-16 by insulin/IGF-1 and germline signaling. Nature Genetics 28: 139–145. Lipshutz, R., Fodor, S.P.A., Gingeras, T.R., and Lockhart, D.J. (1999) High density synthetic oligonucleotide arrays. Nature Genetics Supplement 21: 20–24. Lobry, J.R. (1996) Asymmetric substitution pattern in the two DNA strands of bacteria. Molecular Biology and Evolution 13: 660–665. Lockhart, D.J. and Winzeler, E.A. (2000) Genomics, gene expression and DNA arrays. Nature 405: 827–836. Lockhart, D.J., Dong, H., Byrne, M.C., Follettie, M.T., Gallo, M.V., Chee, M.S., Mittmann, M., Wang, C., Kobayashi, M., Horton, H., and Brown, E.L. (1996) Expression monitoring by hybridization to highdensity oligonucleotide arrays. Nature Biotechnology 14: 1675–1680. Loreau, M., Naeem, S., Inchausti, P., Bengtsson, J., Grime, J.P., Hector, A., Hooper, D.U., Huston, M.A., Raffaelli, D., Schmid, B. et al. (2001) Biodiversity and ecosystem functioning: current knowledge and future challenges. Science 294: 804–808.
REFERENCES
Lorenz, P. and Schleper, C. (2002) Metagenome—a challenging source of enzyme discovery. Journal of Molecular Catalysis B: Enzymatic 19–20: 13–19. Lotka, A.J. (1924) Elements of Physical Biology. Dover Publications, New York. Lovett, R.A. (2000) Toxicologists brace for the genomics revolution. Science 289: 536–537. Lovley, D.R. (2003) Cleaning up with genomics: applying molecular biology to bioremediation. Nature Reviews Microbiology 1: 35–44. Lovley, D.R., Holmes, D.E., and Nevin, K.P. (2004) Dissimilatory Fe(III) and Mn(IV) reduction. Advances in Microbial Physiology 49: 219–286. Loy, A., Lehner, A., Lee, N., Adamczyk, J., Meier, H., Ernst, J., Schleifer, K.-H., and Wagner, M. (2002) Oligonucleotide microarray for 16S rRNA gene-based detection of all recognized lineages of sulfate-reducing prokaryotes in the environment. Applied and Environmental Microbiology 68: 5064–5081. Loy, A., Horn, M., and Wagner, M. (2003) probeBase: an online resource for rRNA-targeted oligonucleotide probes. Nucleic Acids Research 31: 514–516. Lumppio, H.L., Shenvi, N.V., Summers, A.O., Voordouw, G., and Kurtz, Jr., D.M. (2001) Rubrerythrin and rubredoxin oxidoreductase in Desulfovibrio vulgaris: a novel oxidative stress protection system. Journal of Bacteriology 183: 101–108. Lund, J., Tedesco, P., Duke, K., Wang, J., Kim, S.K., and Johnson, T.E. (2002) Transcriptional profile of aging in C. elegans. Current Biology 12: 1566–1573. Lynch, M. and Conery, J.S. (2000) The evolutionary fate and consequences of duplicate genes. Science 290: 1151–1155. Lynch, M. and Conery, J.S. (2003) The origins of genome complexity. Science 302: 1401–1404. Ma, L., Li, J., Qu, L., Hager, J., Chen, Z., Zhao, H., and Deng, X.W. (2001) Light control of Arabidopsis development entails coordinated regulation of genome expression and cellular pathways. The Plant Cell 13: 2589–2607. Maas, M.F.P.M., Van Mourik, A., Hoekstra, R.F., and Debets, A.J.M. (2005) Polymorphism for pKALILO based senescence in Hawaiian populations of Neurospora intermedia and Neurospora tetrasperma. Fungal Genetics and Biology 42: 224–232. MacDonald, C.C. and McMahon, K.W. (2003) The flowers that bloom in the sping: RNA processing and seasonal flowering. Cell 113: 671–672. Macknight, R., Duroux, M., Laurie, R., Dijkwel, P., Simpson, G., and Dean, C. (2002) Functional significance of the alternative transcript processing of the
285
Arabidopsis floral promoter FCA. The Plant Cell 14: 877–888. Madigan, M.T., Martinko, J.M., and Parker, J. (2003) Brock Biology of Microorganisms. Prentice Hall, Pearson Education, Upper Saddle River, NJ. Mair, W., Goymer, P., Pletcher, S.D., and Partridge, L. (2003) Demography of dietary restriction and death in Drosophila. Science 301: 1731–1733. Mair, W., Sgro`, C.M., Johnson, A.P., Chapman, T., and Partridge, L. (2004) Lifespan extension by dietary restriction in female Drosophila melanogaster is not caused by a reduction in vitellogenesis or ovarian activity. Experimental Gerontology 39: 1011–1019. Marshall, E. (2004) Getting the noise out of gene arrays. Science 306: 630–631. Martin, D.E., Demougin, P., Hall, M.N., and Bellis, M. (2004) Rank difference analysis of microarrays (RDAM), a novel approach to statistical analysis of microarray expression profiling data. BMC Bioinformatics 5: 148. Martin, W., Rujan, T., Richly, E., Hansen, A., Cornelsen, S., Lins, T., Leister, D., Stoebe, B., Hasegawa, M., and Penny, D. (2002) Evolutionary analysis of Arabidopsis, cyanobacterial and chloroplast genomes reveals plastid phylogeny and thousands of cyanobacterial genes in the nucleus. Proceedings of the National Academy of Sciences USA 99: 12246–12251. Martinez, D., Larrondo, L.F., Putnam, N., Sollewijn Gelpke, M.D., Huang, K., Chapman, J., Helfenbein, K.G., Ramaiya, P., Detter, J.C., Larimer, F. et al. (2004) Genome sequence of the lignocellulose degrading fungus Phanerochaete chrysosporium strain RP78. Nature Biotechnology 22: 695–700; Erratum, Nature Biotechnology 22: 899. Matsumura, H., Reich, S., Ito, A., Saitoh, H., Kamoun, S., Winter, P., Kahl, G., Reuter, M., Kru¨ger, D.H., and Terauchi, R. (2003) Gene expression analysis of plant host-pathogen interaction by SuperSAGE. Proceedings of the National Academy of Sciences USA 100: 15718–15723. Matthiessen, P. (2000) Is endocrine disruption a significant ecological issue? Ecotoxicology 9: 21–24. Matthysse, A.G., Deschet, K., Williams, M., Marry, M., White, A.R., and Smith, W.C. (2004) A functional cellulose synthase from ascidian epidermis. Proceedings of the National Academy of Sciences USA 101: 986–991. Mayer, G.D., Leach, A., Kling, P., Olsson, P.-E., and Hogstrand, C. (2003) Activation of the rainbow trout metallothionein-A promoter by silver and zinc. Comparative Biochemistry and Physiology Part B 134: 181–188.
286
REFERENCES
McCaig, A.E., Glover, L.A., and Prosser, J.I. (1999) Molecular analysis of bacterial community structure and diversity in unimproved and improved upland grass pastures. Applied and Environmental Microbiology 65: 1721–1730. McCarroll, S.A., Murphy, C.T., Zou, S., Pletcher, S.D., Chin, C.-S., Jan, Y.N., Kenyon, C., Bargmann, C.I., and Li, H. (2004) Comparing genomic expression patterns across species identifies shared transcriptional profile in aging. Nature Genetics 36: 197–204. McElwee, J., Bubb, K., and Thomas, J.H. (2003) Transcriptional outputs of the Caenorhabditis elegans forkhead protein DAF-16. Aging Cell 2: 111–121. McElwee, J.J., Schuster, E., Blanc, E., Thomas, J.H., and Gems, D. (2004) Shared transcriptional signature in Caenorhabditis elegans dauer larvae and long-lived daf-2 mutants implicates detoxification system in longevity assurance. Journal of Biological Chemistry 279: 44533–44543. McKusick, V.A. and Ruddle, F.H. (1987) A new discipline, a new name, a new journal. Genomics 1: 1–2. Menges, M., Hennig, L., Gruissem, W., and Murray, J.A.H. (2002) Cell cycle-regulated gene expression in Arabidopsis. Journal of Biological Chemistry 277: 41987–42002. Menges, M., Hennig, L., Gruissem, W., and Murray, J.A.H. (2003) Genome-wide gene expression in an Arabidopsis cell suspension. Plant Molecular Biology 53: 423–442. Menzel, R., Bogaert, T., and Achazi, R. (2001) A systematic gene expression screen of Caenorhabditis elegans cytochrome P450 gene reveals CYP35 as strongly xenobiotic inducible. Archives of Biochemistry and Biophysics 395: 158–168. Methe´, B.A., Nelson, K.E., Eisen, J.A., Paulsen, I.T., Nelson, W., Heidelberg, J.F., Wu, D., Wu, M., Ward, N., Beanan, M.J. et al. (2003) Genome of Geobacter sulfurreducens: metal reduction in subsurface environments. Science 302: 1967–1969. Miller, T.R. and Belas, R. (2004) Dimethylsulfoniopropionate metabolism by Pfiesteria-associated Roseobacter spp. Applied and Environmental Microbiology 70: 3383–3391. Mills, L. and Chichester, C. (2005) Review of evidence: are endocrine-disrupting chemicals in the aquatic environment impacting fish populations? Science of the Total Environment 343: 1–34. Mira, A., Ochman, H., and Moran, N.A. (2001) Deletion bias and the evolution of bacterial genomes. Trends in Genetics 17: 589–596. Miracle, A.L., Toth, G.P., and Lattier, D.L. (2003) The path from molecular indicators of exposure to describing dynamic biological systems in an aquatic organism:
microarrays and the fathead minnow. Ecotoxicology 12: 457–462. Miracle, A.L. and Ankley, G.T. (2005) Ecotoxicogenomics: linkages between exposure and effects in assessing risks of aquatic contaminants to fish. Reproductive Toxicology 19: 321–326. Mitchell-Olds, T. (2001) Arabidopsis thaliana and its wild relatives: a model system for ecology and evolution. Trends in Ecology and Evolution 16: 693–700. Momose, Y. and Iwahashi, H. (2001) Bioassay of cadmium using a DNA microarray: genome-wide expression patterns of Saccharomyces cerevisiae response to cadmium. Environmental Toxicology and Chemistry 20: 2353–2360. Monteiro, A., Prijs, J., Bax, M., Kahhaart, T., and Brakefield, P.M. (2003) Mutants highlight the modular control of butterfly eyespot patterns. Evolution & Development 5: 160–167. Moran, P.J., Cheng, Y., Cassell, J.L., and Thompson, G.A. (2002) Gene expression profiling of Arabidopsis thaliana in compatible plant-aphid interactions. Archives of Insect Biochemistry and Physiology 51: 182–203. Morimoto, R.I., Tissie`res, A., and Georgopoulos, C. (eds) (1994) The Biology of Heat Shock Proteins and Molecular Chaperones. Cold Spring Harbor Press, New York. Mouradov, A., Cremer, F., and Coupland, G. (2002) Control of flowering time: interacting pathways as a basis for diversity. The Plant Cell (supplement) 2002: S111–S130. Mousseau, T.A. and Fox, C.H. (1998) The adaptive significance of maternal effects. Trends in Ecology and Evolution 13: 403–407. Murakami, S. and Johnson, T.E. (2001) The OLD-1 positive regulator of longevity and stress resistance is under DAF-16 regulation in Caenorhabditis elegans. Current Biology 11: 1517–1523. Murphy, C.T., McCarrol, S.A., Bargmann, C.I., Fraser, A., Kamath, R.S., Ahringer, J., Li, H., and Kenyon, C. (2003) Genes that act downstream of DAF-16 to influence the lifespan of Caenorhabditis elegans. Nature 424: 277–284. Murray, A.W. (2000) Whither genomics? Genome Biology 1: comment 003.1–003.6. Muyzer, G., De Waal, E.C., and Uitterlinden, A.G. (1993) Profiling of complex microbial populations by denaturing gradient gel electrophoresis analysis of polymerase chain reaction-amplified genes coding for 16S rRNA. Applied and Environmental Microbiology 59: 695–700. Myers, G. (1999) Whole-genome DNA sequencing. Computing in Science and Engineering 1: 33–43.
REFERENCES
Naeem, S., Loreau, M., and Inchausti, P. (2002) Biodiversity and ecosystem functioning: the emergence of a synthetic ecological framework. In Biodiversity and Ecosystem Functioning, M. Loreau, S. Naeem, and P. Inchausti (eds). Oxford University Press, Oxford: 3–11. Nakamura, Y., Gojobori, T., and Ikemura, T. (2000) Codon usage tabulated from international DNA sequence databases: status for the year 2000. Nucleic Acids Research 28: 292. Nardi, F., Spinsanti, G., Boore, J.L., Carapelli, A., Dallai, R., and Frati, F. (2003) Hexapod origins: monophyletic or paraphyletic? Science 299: 1887–1889. Nebert, D.W., Roe, A.L., Dieter, M.Z., Solis, W.A., Yang, Y., and Dalton, T.P. (2000) Role of the aromatic hydrocarbon receptor and [Ah] gene battery in the oxidative stress response, cell cycle control, and apoptosis. Biochemical Pharmacology 59: 65–85. Neefs, J.-M., Van der Peer, Y., De Rijk, P., Chapelle, S., and De Wachter, R. (1993) Compilation of small ribosomal subunit RNA structures. Nucleic Acids Research 21: 3025–3049. Nei, M. and Gojobori, T. (1986) Simple methods for estimating the numbers of synonymous and nonsynonymous nucleotide substitutions. Molecular Biology and Evolution 3: 418–426. Nei, M., Gu, X., and Sitnikova, T. (1997) Evolution by the birth-and-death process in multigene families of the vertebrate immune system. Proceedings of the National Academy of Sciences USA 94: 7799–7806. Nelson, K.E., Clayton, R.A., Gill, S.R., Gwinn, M.L., Dodson, R.J., Haft, D.H., Hickey, E.K., Peterson, J.D., Nelson, W.C., Ketchum, K.A. et al. (1999) Evidence for lateral gene transfer between Archaea and Bacteria from genome sequence of Thermotoga maritima. Nature 399: 323–329. Nesbø, C.L., L’Haridon, S., Stetter, K.O., and Doolittle, W.F. (2001) Phylogenetic analyses of two ‘archaeal’ genes in Thermotoga maritima reveal multiple transfers between Archaea and Bacteria. Molecular Biology and Evolution 18: 362–375. Neutel, A.-M., Heesterbeek, J.A.P., and De Ruiter, P.C. (2002) Stability in real food webs: weak links in long loops. Science 296: 1120–1123. Nguyen, T., Sherrat, P.J., and Pickett, C.B. (2003) Regulatory mechanisms controlling gene expression mediated by the antioxidant response element. Annual Review of Pharmacology and Toxicology 43: 233–260. Nguyen, T., Yang, C.S., and Pickett, C.B. (2004) The pathways and molecular mechanisms regulating Nrf2 activation in response to chemical stress. Free Radical Biology & Medicine 37: 433–441.
287
Nielsen, C. (1995) Animal Evolution. Interrelationships of the Living Phyla. Oxford University Press, Oxford. Nijhout, H.F. (2003a) Development and evolution of adaptive polyphenisms. Evolution & Development 5: 9–18. Nijhout, H.F. (2003b) The control of body size in insects. Developmental Biology 261: 1–9. Nishida, R. (2002) Sequestration of defensive substances from plants by Lepidoptera. Annual Review of Entomology 47: 57–92. Nordgren, A., Ba˚a˚th, E., and So¨derstro¨m, B. (1983) Microfungi and microbial activity along a heavy metal gradient. Applied and Environmental Microbiology 45: 1829–1837. North, N.N., Dollhopf, S.L., Petrie, L., Istok, J.D., Balkwill, D.L., and Kostka, J.E. (2004) Change in bacterial community structure during in situ biostimulation of subsurface sediment cocontaminated with uranium and nitrate. Applied and Environmental Microbiology 70: 4911–4920. Novina, C.D. and Sharp, P.A. (2004) The RNAi revolution. Nature 430: 161–164. Nunes, F.M.F., Valente, V., Sousa, J.F., Cunha, M.A.V., Pinheiro, D.G., Maia, R.M., Araujo, D.D., Costa, M.C.R., Martins, W.K., Carvalho, A.F. et al. (2004) The use of open reading frame ESTs (ORESTES) for analysis of the honey bee transcriptome. BMC Genomics 5: 84. Nuwaysir, E.F., Huang, W., Albert, T.J., Singh, J., Nuwaysir, K., Pitas, A., Richmond, T., Gorksi, T., Berg, J.P., Ballin, J. et al. (2002) Gene expression analysis using oligonucleotide arrays produced by maskless photolithography. Genome Research 12: 1749–1755. Odum, E.P. (1953) Fundamentals of Ecology. W.B. Saunders Co., Philadelphia. Odum, E.P., Finn, J.T., and Franz, E.H. (1979) Perturbation theory and the subsidy-stress gradient. Bioscience 29: 349–352. Ohno, S. (1972) So much ‘junk’ DNA in our genome. In Evolution of Genetic Systems, H.H. Smith, H.J. Price, A.H. Sparrow, F.W. Studier, and J.D. Yourno (eds). Gordon and Breach, New York: 366–370. Oldham, S. and Hafen, E. (2003) Insulin/IGF and target of rapamycin signaling: a TOR de force in growth control. Trends in Cell Biology 13: 79–85. Oleksiak, M., Churchill, G.A., and Crawford, D.L. (2002) Variation in gene expression within and among natural populations. Nature Genetics 32: 261–266. Oliver, J.L., Bernaola-Galva´n, P., Carpena, P., and Roma´n-Rolda´n, R. (2001) Isochore maps of eukaryotic genomes. Gene 276: 47–56.
288
REFERENCES
Olsen, A., Sampayo, J.N., and Lithgow, G.L. (2003) Aging in C. elegans. In Aging of Organisms, H.D. Osiewacz (ed.). Kluwer Academic Publishers, Dordrecht: 163–199. Osta, M.A., Christophides, G.K., and Kafatos, F.C. (2004) Effect of mosquito genes on Plasmodium development. Science 303: 2030–2032. Øvrea˚s, L. (2000) Population and community level approaches for analysing microbial diversity in natural environments. Ecology Letters 3: 236–251. Ozturk, Z.N., Talame´, V., Deyolos, M., Michalowski, C.B., Galbraith, D.W., Gozokirmizi, N., Tuberosa, R., and Bohnert, H.J. (2002) Monitoring large-scale changes in transcript abundance in drought- and salt-stressed barley. Plant Molecular Biology 48: 551–573. Pace, N.R. (1997) A molecular view of microbial diversity and the biosphere. Science 276: 734–740. Palmiter, R.D. (1994) Regulation of metallothionein genes by heavy metals appears to be mediated by a zincsensitive inhibitor that interacts with constitutively active transcription factor, MTF-1. Proceedings of the National Academy of Sciences USA 91: 1219–1223. Palsson, B. (2000) The challenges of in silico biology. Nature Biotechnology 18: 1147–1150. Parkinson, J., Mitreva, M., Whitton, C., Thomson, M., Daub, J., Martin, J., Schmid, R., Hall, N., Barrell, B., Waterston, R.H. et al. (2004) A transcriptomic analysis of the phylum Nematoda. Nature Genetics 36: 1259–1267. Partridge, L. (2001) Evolutionary theories of ageing applied to long-lived organisms. Experimental Gerontology 36: 641–650. Partridge, L. and Gems, D. (2002a) The evolution of longevity. Current Biology 12: R544–R546. Partridge, L. and Gems, D. (2002b) Mechanisms of ageing: public or private? Nature Reviews Genetics 3: 165–175. Partridge, L. and Pletcher, S.D. (2003) Genetics of aging in Drosophila. In: Aging of Organisms H.D. Osiewacz (ed.). Kluwer Academic Publishers, Dordrecht: 125–161. Passarge, E., Horsthemke, B., and Farber, R.A. (1999) Incorrect use of the term synteny. Nature Genetics 23: 387. Pastorian, K., Hawel, III, L., and Byus, C.V. (2000) Optimization of cDNA representational difference analysis for the identification of differentially expressed mRNAs. Analytical Biochemistry 283: 89–98. Patel, N.H. (2004) Time, space and genomes. Nature 431: 28–29. Paul, J.H., Sullivan, M.B., Segall, A.M., and Rohwer, F. (2002) Marine phage genomics. Comparative Biochemistry and Physiology Part B 133: 463–476.
Pearson, G., Serra˜o, E.A., and Cancela, M.L. (2001) Suppression subtractive hybridization for studying gene expression during aerial exposure and desiccation in fucoid algae. European Journal of Phycology 36: 359–366. Peichel, C.L., Nereng, K.S., Ohgi, K.A., Cole, B.L.E., Colosimo, P.F., Buerkle, C.A., Schluter, D., and Kingsley, D.M. (2001) The genetic architecture of divergence between threespine stickleback species. Nature 414: 901–905. Pennie, W.D., Tugwood, J.D., Oliver, G.J.A., and Kimber, I. (2000) The principles and practice of toxicogenomics: applications and opportunities. Toxicological Sciences 54: 277–283. Peplies, J., Glo¨ckner, F.O., and Amann, R. (2003) Optimization strategies for DNA microarray-based detection of bacteria with 16S rRNA-targeting oligonucleotide probes. Applied and Environmental Microbiology 69: 1397–1407. Perkins, E.J. and Lotufo, G.R. (2003) Playing in the mud— using gene expression to assess contaminant effects on sediment dwelling invertebrates. Ecotoxicology 12: 453–456. Petersen, K., Didion, T., Anderson, C.H., and Nielsen, K.K. (2004) MADS-box genes from perennial ryegrass differentially expressed during transition from vegetative to reproductive growth. Journal of Plant Physiology 161: 439–447. Pichersky, E. and Gang, D.R. (2000) Genetics and biochemistry of secondary metabolites in plants: an evolutionary perpsective. Trends in Plant Science 5: 439–445. Piel, J., Hui, D., Fusetani, N., and Matsunaga, S. (2004) Targeting modular polyketide synthases with iteratively acting acyltransferases from metagenomes of uncultured bacterial consortia. Environmental Microbiology 6: 921–927. Pierik, R., Cuppens, M.L.C., Voesenek, L.A.C.J., and Visser, E.J.W. (2004) Interactions between ethylene and gibberellins in phytochrome-mediated shade avoidance responses in tobacco. Plant Physiology 136: 2928–2936. Pigliucci, M. (1996) How organisms respond to environmental changes: from phenotypes to molecules (and vice versa). Trends in Ecology and Evolution 11: 168–173. Pin˜eiro, M., Go´mez-Mena, C., Schaffer, R., Martı´nezZapater, J.M., and Coupland, G. (2003) EARLY BOLTING IN SHORT DAYS is related to chromatin remodeling factors and regulates flowering in Arabidopsis by repressing FT. The Plant Cell 15: 1552–1562.
REFERENCES
Pletcher, S.D., Macdonald, S.J., Marguerie, R., Certa, U., Stearns, S.C., Goldstein, D.B., and Partridge, L. (2002) Genome-wide transcript profiles in aging and calorically restricted Drosophila melanogaster. Current Biology 12: 712–723. Pokarzhevskii, A.D., Van Straalen, N.M., Zaboev, D.P., and Zaitsev, A.S. (2003) Microbial links and element flows in nested detrital food-webs. Pedobiologia 47: 213–224. Polz, M.F., Bertilsson, S., Acinas, S.G., and Hunt, D. (2003) A(r)ray of hope in analysis of the function and diversity of microbial communities. Biological Bulletin 204: 196–199. Postma, E. and Van Noordwijk, A.J. (2005) Gene flow maintains a large genetic difference in clutch size at a small spatial scale. Nature 433: 65–68. Price, P.W., Bouton, C.E., Gross, P., McPheron, B.A., Thompson, J.N., and Weis, A.E. (1980) Interactions among three trophic levels: Influence of plants on interactions between insect herbivores and natural enemies. Annual Review of Ecology and Systematics 11: 41–65. Prince, V.E. and Pickett, F.B. (2002) Splitting pairs: the diverging fates of duplicated genes. Nature Reviews Genetics 3: 827–837. Procaccini, G., Pischetola, M., and Di Lauro, R. (2000) Isolation and characterization of microsatellite loci in the ascidian Ciona intestinalis (L.). Molecular Ecology 9: 1924–1926. Pu¨hler, A. and Selbitschka, W. (2003) Genome research on bacteria relevant for agriculture, environment and biotechnology. Journal of Biotechnology 106: 119–120. Purohit, H.J., Raje, D.V., Kapley, A., Padmanabhan, P., and Singh, R.N. (2003) Genomic tools in environmental impact assessment. Environmental Science and Technology 37: 337A–368A. Putterrill, J., Laurie, R., and Macknight, R. (2004) It’s time to flower: the genetic control of flowering time. BioEssays 26: 363–373. Quackenbush, J. (2001) Computational analysis of microarray data. Nature Reviews Genetics 2: 410–427. Quail, P.H. (2002) Phytochrome photosensory signalling networks. Nature Reviews Molecular Cell Biology 3: 85–93. Quaiser, A., Ochsenreiter, T., Klenk, H.-P., Kleftzin, A., Treusch, A.H., Meurer, G., Eck, J., Sensen, C.W., and Schleper, C. (2002) First insight into the genome of an uncultivated crenarchaeote from soil. Environmental Microbiology 4: 603–611. Quaiser, A., Ochsenreiter, T., Lanz, C., Schuster, S.C., Treusch, A.H., Eck, J., and Schleper, C. (2003)
289
Acidobacteria form a coherent but highly diverse group within the bacterial domain: evidence from environmental genomics. Molecular Microbiology 50: 563–575. Quesada, V., Macknight, R., Dean, C., and Simpson, G.G. (2003) Autoregulation of FCA pre-mRNA processing controls Arabidopsis flowering time. EMBO Journal 22: 3142–3152. Radajewski, S., McDonald, I.R., and Murrell, J.C. (2003) Stable-isotope probing of nucleic acids: a window to the function of uncultured microorganisms. Current Opinion in Biotechnology 14: 296–302. Ram, R.J., VerBerkmoes, N.C., Thelen, M.P., Tyson, G.W., Baker, B.J., Blake, II, R.C., Shah, M., Hettich, R.L., and Banfield, J.F. (2005) Community proteomics of a natural microbial biofilm. Science 308: 1915–1920. Ranson, H., Claudianos, C., Ortelli, F., Abgrall, C., Hemingway, J., Sharakhova, M.V., Unger, M.F., Collins, F.H., and Feyereisen, R. (2002) Evolution of supergene families associated with insecticide resistance. Science 298: 179–181. Ranz, J.M., Castillo-Davis, C.I., Meiklejohn, C.D., and Hartl, D.L. (2003) Sex-dependent gene expression and evolution of the Drosophila transcriptome. Science 300: 1742–1745. Rasmussen, R., Morrison, R., Herrmann, M., and Wittwer, C. (1998) Quantitative PCR by continuous fluorescence monitoring of a double strand DNA specific binding dye. Biochimica 2: 8–11. Ratcliffe, O.J. and Riechmann, J.L. (2002) Arabidopsis transcription factors and the regulation of flowering time: a genomic perspective. Current Issues in Molecular Biology 4: 77–91. Ravasz, E., Somera, A.L., Mongru, D.A., Oltvai, Z.N., and Baraba´si, A.-L. (2002) Hierarchical organization of modularity in metabolic networks. Science 297: 1551–1555. Raven, J.A. and Allen, J.F. (2003) Genomics and chloroplast evolution: what did cyanobacteria do for plants? Genome Biology 4: 209. Rebrikov, D.V., Bulina, M.E., Bogdanova, E., Vagner, L.L., and Lukyanov, S.A. (2002) Complete genome sequence of a novel extrachromosomal virus-like element identified in planarian Girardia tigrina. BMC Genomics 3: 15. Rebrikov, D.V., Desai, S.M., Siebert, P.D., and Lukyanov, S.A. (2004) Suppression subtractive hybridisation. In Gene Expression Profiling. Methods and Protocols, R.A. Shimkets (ed.). Humana Press, Totowa, NJ: 107–134. Reinke, V. and White, K.P. (2002) Developmental genomic approaches in model organisms. Annual Review of Genomics and Human Genetics 3: 153–178.
290
REFERENCES
Rendulic, S., Jagtap, P., Rosinus, A., Eppinger, M., Baar, C., Lanz, C., Keller, H., Lambert, C., Evans, K.J., Goesmann, A. et al. (2004) A predator unmasked: life cycle of Bdellovibrio bacteriovorus from a genomic perspective. Science 303: 689–692. Reymond, P., Weber, H., Diamond, M., and Farmer, E.E. (2000) Differential gene expression in response to mechanical wounding and insect feeding in Arabidopsis. The Plant Cell 12: 707–719. Reysenbach, A.-L. and Shock, E. (2002) Merging genomes with geochemistry in hydrothermal ecosystems. Science 296: 1077–1082. Riddle, D.L. (1988) The dauer larva. In The Nematode Caenorhabditis elegans, W.B. Wood and the Community of C. elegans Researchers (eds). Cold Spring Harbor Press, Cold Spring Harbor: 393–412. Riesenfeld, C.S., Schloss, P.D., and Handelsman, J. (2004a) Metagenomics: genome analysis of microbial communities. Annual Review of Genetics 38: 525–552. Riesenfeld, C.S., Goodman, R.M., and Handelsman, J. (2004b) Uncultured soil bacteria are a reservoir of new antibiotic resistance genes. Environmental Microbiology 6: 981–989. Rizhsky, L., Liang, H., Shuman, J., Shulaev, V., Davletova, S., and Mittler, R. (2004) When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress. Plant Physiology 134: 1683–1696. Robbins, A.H., McRee, D.E., Williamson, M., Collet, S.A., Xuong, N.H., Furey, W.F., Wang, B.C., and Stout, C.D. (1991) Refined crystal structure of Cd, Zn metal˚ resolution. Journal of Molecular lothionein at 2.0 A Biology 221: 1269–1293. Roda, A., Halitschke, R., Steppuhn, A., and Baldwin, I.T. (2004) Individual variability in herbivore-specific elicitors from the plant’s perspective. Molecular Ecology 13: 2421–2433. Rodrigues-Pousada, C.A., Nevitt, T., Menezes, R., Azevedo, D., Pereira, J., and Amaral, C. (2004) Yeast activator proteins and stress response: an overview. FEBS Letters 567: 80–85. Roelofs, D., Overhein, L., De Boer, M.E., Janssens, T.K.S., and Van Straalen, N.M. (2006) Additive genetic variation of transcriptional regulation: metallothionein expression in the soil insect Orchesella cincta. Heredity 96: 85–92. Roesijadi, G. (1996) Metallothionein and its role in toxic metal regulation. Comparative Biochemistry and Physiology 113C: 117–123. Roff, D.A. (2002) Life History Evolution. Sinauer Associates, Sunderland, MA.
Rogina, B., Helfand, S.L., and Frankel, S. (2002) Longevity regulation by Drosophila Rpd3 deacetylase and caloric restriction. Science 298: 1745. Ro¨ling, W.F.M., Van Breukelen, B., Braster, M., Lin, B., and Van Verseveld, H.W. (2001) Relationships between microbial community structure and hydrochemistry in a landfill leachate-polluted aquifer. Applied and Environmental Microbiology 67: 4619–4629. Ro¨ling, W.F.M., Milner, M.G., Jones, D.M., Fratepietro, F., Swannell, R.P.J., Daniel, F., and Head, I.M. (2004) Bacterial community dynamics and hydrocarbon degradation during a field-scale evaluation of bioremediation on a mudflat beach contaminated with buried oil. Applied and Environmental Microbiology 70: 2603–2613. Rondon, M.R., Goodman, R.M., and Handelsman, J. (1999) The Earth’s bounty: assessing and accessing soil microbial diversity. Trends in Biotechnology 17: 403–409. Rondon, M.R., August, P.R., Bettermann, A.D., Brady, S.F., Grossman, T.H., Liles, M.R., Loiacono, K.A., Lynch, B.A., MacNeil, I.A., Minor, C. et al. (2000) Cloning the soil metagenome: a strategy for accessing the genetic and functional diversity of uncultured microorganisms. Applied and Environmental Microbiology 66: 2541–2547. Rosenberg, S.M. and Hastings, P.J. (2004) Worming into genetic instability. Nature 430: 625–626. Roskam, J.C. and Brakefield, P.M. (1999) Seasonal polyphenism in Bicyclus (Lepidoptera: Satyridae) butterflies: different climates need different cues. Biological Journal of the Linnean Society 66: 345–356. Rubin, G.M. and Lewis, E.B. (2000) A brief history of Drosophila’s contributions to genome research. Science 287: 2216–2218. Rubin, G.M., Yandell, M.D., Wortman, J.R., Gabor Miklos, G.L., Nelson, C.R., Hariharan, I.K., Fortini, M.E., Li, P.W., Apweiler, R., Fleischmann, W. et al. (2000) Comparative genomics of the eukaryotes. Science 287: 2204–2215. Russell, P.J. (2002) iGenetics. Pearson Education/Benjamin Cummings, San Fransisco. Rutledge, R.G. and Coˆte´, C. (2003) Mathematics of quantitative kinetic PCR and the application of standard curves. Nucleic Acids Research 31: e93. Saccone, C. and Pesole, G. (2003) Handbook of Comparative Genomics. John Wiley & Sons, Hoboken, NJ. Saint Andre´, A.V., Blackwell, N.M., Hall, L.R., Hoerauf, A., Brattig, N.W., Volkmann, L., Taylor, M.J., Ford, L., Hise, A.G., Lass, J.H. et al. (2002) The role of endosymbiotic Wolbachia bacteria in the pathogenesis of river blindness. Science 295: 1892–1895.
REFERENCES
Sanger, F., Air, G.M., Barrell, B.G., Brown, N.L., Coulson, A.R., Fiddes, J.C., Hutchison III, C.A., Slocombe, P.M., and Smith, M. (1977a) Nucleotide sequence of bacteriophage FX174 DNA. Nature 265: 687–695. Sanger, F., Nicklen, S., and Coulson, A.R. (1977b) DNA sequencing with chain-terminating inhibitors. Proceedings of the National Academy of Sciences USA 74: 5463–5467. Sansone, S.A., Morrisson, N., Rocca-Serra, P., and Fostel, J.M. (2004) Standardization initiatives in the (eco)toxicogenomics domain: a review. Comparative and Functional Genomics 5: 633–641. Santoro, M.G. (2000) Heat shock factors and the control of the stress response. Biochemical Pharmacology 59: 55–63. Schaffer, R., Landgraf, J., Accerbi, M., Simon, V., Larson, M., and Wisman, E. (2001) Microarray analysis of diurnal and circadian-regulated genes in Arabidopsis. The Plant Cell 13: 113–123. Schena, M., Shalon, D., Davis, R.W., and Brown, P.O. (1995) Quantitative monitoring of gene expression patterns with a complementary DNA microarray. Science 270: 467–470. Schepens, I., Duek, P., and Fankhauser, C. (2004) Phytochrome-mediated light signalling in Arabidopsis. Current Opinion in Plant Biology 7: 564–569. Schindler, D.W. (1987) Detecting ecosystem responses to anthropogenic stress. Canadian Journal of Fisheries and Aquatic Sciences 44: 6–25. Schink, B. and Friedrich, M. (2000) Phosphite oxidation by sulphate reduction. Nature 406: 37. Schittko, U., Hermsmeier, D., and Baldwin, I.T. (2001) Molecular interactions between the specialist herbivore Manduca sexta (Lepidoptera, Sphingidae) and its natural host Nicotiana attenuata. II. Accumulation of plant mRNAs in response to insect-derived cues. Plant Physiology 125: 701–710. Schleper, C., Jurgens, G., and Jonuscheit, M. (2005) Genomic studies of uncultivated Archaea. Nature Reviews Microbiology 3: 479–488. Schlichting, C.D. and Smith, H. (2002) Phenotypic plasticity: linking molecular mechanisms with evolutionary outcomes. Evolutionary Ecology 16: 189–211. Schloss, P.D. and Handelsman, J. (2003) Biotechnological prospects from metagenomics. Current Opinion in Biotechnology 14: 303–310. Schmid, M., Uhlenhaut, N.H., Godard, F., Demar, M., Bressan, R., Weigel, D., and Lohmann, J.U. (2003) Dissection of floral induction pathways using global expression analysis. Development 130: 6001–6012. Schmidt-Nielsen, K. (1997) Animal Physiology. Adaptation and Environment, 5th edn. Cambridge University Press, Cambridge.
291
Schulte, P.M. (2004) Changes in gene expression as biochemical adaptations to environmental change: a tribute to Peter Hochachka. Comparative Biochemistry and Physiology Part B 139: 519–529. Schulze, A. and Downward, J. (2001) Navigating gene expression using microarrays—a technology review. Nature Cell Biology 3: E190–E195. Schulze, E.-D. and Mooney, H.A. (eds) (1993) Biodiversity and Ecosystem Function. Springer-Verlag, Berlin. Schweitzer, J.A., Balley, J.K., Rehill, B.J., Martinsen, G.D., Hart, S.C., Lindroth, R.L., Keim, P., and Whitham, T.G. (2004) Genetically based trait in a dominant tree affects ecosystem processes. Ecology Letters 7: 127–134. Sebat, J.L., Colwell, F.S., and Crawford, R.L. (2003) Metagenomic profiling: microarray analysis of an environmental genomic library. Applied and Environmental Microbiology 69: 4927–4934. Segal, E., Shapira, M., Regev, A., Pe’er, D., Botstein, D., Koller, D., and Friedman, N. (2003) Module networks: identifying regulatory modules and their conditionspecific regulators from gene expression data. Nature Genetics 34: 166–176. Seki, M., Narusaka, M., Abe, H., Kasuga, M., YamaguchiShinozaki, K., Carninci, P., Hayashizaki, Y., and Shonozaki, K. (2001) Monitoring expression pattern of 1300 Arabidopsis genes under drought and cold stresses by using a full-length cDNA microarray. The Plant Cell 13: 61–72. Seki, M., Narusaka, M., Ishida, J., Nanjo, T., Fujita, M., Ouno, Y., Kamiya, A., Nakajima, M., Enju, A., Sakurai, T. et al. (2002) Monitoring the expression profiles of 7000 Arabidopsis genes under drought, cold and high-salinity stresses using a full-length cDNA microarray. The Plant Journal 31: 279–292. Sharbel, T.F., Huabold, B., and Mitchell-Olds, T. (2000) Genetic isolation by distance in Arabidopsis biogeography and postglacial colonization of Europe. Molecular Ecology 9: 2109–2118. She, X., Jiang, Z., Clark, R.A., Liu, G., Cheng, Z., Tuzun, E., Church, D.M., Sutton, G., Halpern, A.L., and Eichler, E.E. (2004) Shotgun sequence assembly and recent segmental duplications within the human genome. Nature 431: 927–930. Shimkets, R.A. (ed.) (2004) Gene Expression Profiling. Methods and Protocols. Humana Press, Totowa, NJ. Short, S.M. and Suttle, C.A. (2002) Sequence analysis of marine virus communities reveals that groups of related algal viruses are widely distributed in nature. Applied and Environmental Microbiology 68: 1290–1296. Shrader, E.A., Henry, T.R., Greeley, Jr., M.S., and Bradley, B.P. (2003) Proteomics in zebrafish exposed
292
REFERENCES
to endocrine disrupting chemicals. Ecotoxicology 12: 485–488. Simpson, G.C. and Dean, C. (2002) Arabidopsis, the Rosetta stone of flowering time? Science 296: 285–289. Simpson, G.G., Dijkwel, P.P., Quesada, V., Henderson, I., and Dean, C. (2003) FY is an RNA 3 0 end-processing factor that interacts with FCA to control the Arabidopsis floral transition. Cell 113: 777–787. Slack, J.M.W., Holland, P.W.H., and Graham, C.F. (1993) The zootype and the phylotypic stage. Science 361: 490–492. Small, J., Call, D.R., Brockman, F.J., Straub, T.M., and Chandler, D.P. (2001) Direct detection of 16S rRNA in soil extracts by using oligonucleotide microarrays. Applied and Environmental Microbiology 67: 4708–4716. Smith, L.M., Sanders, J.Z., Kaiser, R.J., Hughes, P., Dodd, C., Connell, C.R., Heiner, C., Kent, S.B.H., and Hood, L.E. (1986) Fluorescence detection in automated DNA sequence analysis. Nature 321: 674–679. Smyth, G.K., Yang, Y.H., and Speed, T. (2003) Statistical issues in cDNA microarray analysis. In Functional Genomics: Methods and Protocols, M.J. Brownstein and A.B. Khodurksy (eds). Humana Press, Totowa, NJ: 111–136. Snape, J.R., Maund, S.J., Pickford, D.B., and Hutchinson, T.H. (2004) Ecotoxicogenomics: the challenge of integrating genomics into aquatic and terrestrial ecotoxicology. Aquatic Toxicology 67: 143–154. Snel, B., Bork, P., and Huynen, M. (1999) Genome phylogeny based on gene content. Nature Genetics 21: 108–110. Snell, T.W., Brogdon, S.E., and Morgan, M.B. (2003) Gene expression profiling in ecotoxicology. Ecotoxicology 12: 475–483. Snyder, M. and Gerstein, M. (2003) Defining genes in the genomics era. Science 300: 258–260. Sokal, R.R. and Rohlf, F.J. (1995) Biometry. The Principles and Practice of Statistics in Biological Research, 3rd edn. W.H. Freeman and Company, San Fransisco. Sorrells, M.E., La Rota, M., Bermudez-Kandianis, C.E., Greene, R.A., Kantety, R., Munkvold, J.D., Miftahudin, Mahmoud, A., Ma, X., Gustafson, P.J. et al. (2003) Comparative DNA sequence analysis of wheat and rice genomes. Genome Research 13: 1818–1827. Soto, A.M., Justicia, H., Wray, J.W., and Sonnenschein, C. (1991) p-Nonyl-phenol: an estrogenic xenobiotic released from ‘modified’ polystyrene. Environmental Health Perspectives 92: 167–173. Spellman, P.T. and Rubin, G.M. (2002) Evidence for large domains of similarly expressed genes in the Drosophila genome. Journal of Biology 1: 5.
Spencer, J.F.T. and Spencer, D.M. (1997a) Ecology: where yeasts live. In Yeasts in Natural and Artificial Habitats, J.F.T. Spencer and D.M. Spencer (eds). Springer-Verlag, Berlin: 33–58. Spencer, J.F.T. and Spencer, D.M. (1997b) Taxonomy: the names of the yeasts. In Yeasts in Natural and Artificial Habitats, J.F.T. Spencer and D.M. Spencer (eds). Springer-Verlag, Berlin: 11–32. Sprague, J., Doerry, E., Douglas, S., Westerfield, M., and the ZFIN Group (2001) The Zebrafish Information Network (ZFIN): a resource for genetic, genomic and developmental research. Nucleic Acids Research 29: 87–90. Spring, J. (1997) Vertebrate evolution by interspecific hybridisation—are we polyploid? FEBS Letters 400: 2–8. Stearns, S.C. (1992) The Evolution of Life Histories. Oxford University Press, Oxford. Stearns, S.C. and Magwene, P. (2003) The naturalist in a world of genomics. American Naturalist 161: 171–180. Stein, L.D. (2004) End of the beginning. Nature 431: 915–916. Sterenborg, I. and Roelofs, D. (2003) Field-selected cadmium tolerance in the springtail Orchesella cincta is correlated with increased metallothionein mRNA expression. Insect Biochemistry and Molecular Biology 33: 741–747. Steward, G.F., Jenkins, B.D., Ward, B.B., and Zehr, J.P. (2004) Development and testing of a DNA macroarray to assess nitrogenase (nifH) gene diversity. Applied and Environmental Microbiology 70: 1455–1465. Stinchcombe, J.R., Weinig, C., Ungerer, M., Olsen, K.M., Mays, C., Halldorsdottir, S.S., Purugganan, M.D., and Schmitt, J. (2004) A latitudinal cline in flowering time in Arabidopsis thaliana modulated by the flowering time gene FRIGIDA. Proceedings of the National Academy of Sciences USA 101: 4712–4717. Stolc, V., Gauhar, Z., Mason, C., Halasz, G., Van Batenburg, M.F., Rifkin, S.A., Hua, S., Herreman, T., Tongprasit, W., Barbano, P.E. et al. (2004) A gene expression map for the euchromatic genome of Drosophila melanogaster. Science 306: 655–660. Strange, K. (2005) The end of ‘naı¨ve reductionism’: rise of systems biology or renaissance of physiology? American Journal of Physiology Cell Physiology 288: 968–974. Straub, P.F., Higham, M.L., Tanguy, A., Landau, B.J., Phoel, W.C., Hales, Jr., L.S., and Thwing, T.K.M. (2004) Suppression subtractive hybridization cDNA libraries to identify differentially expressed genes from contrasting fish habitats. Marine Biotechnology 6: 386–399.
REFERENCES
Strauss, S.H. and Martin, F.M. (2004) Poplar genomics comes of age. New Phytologist 164: 1–4. Stu¨rzenbaum, S.R. and Kille, P. (2001) Control genes in quantitative molecular biological techniques: the variability of invariance. Comparative Biochemistry and Physiology B 130: 281–289. Stu¨rzenbaum, S.R., Winters, C., Galay, M., Morgan, A.J., and Kille, P. (2001) Metal ion trafficking in earthworms. Identification of a cadmium-specific metallothionein. Journal of Biological Chemistry 276: 34013–34018. Sultan, A., Abelson, A., Bresler, V., Fishelson, L., and Mokady, O. (2000) Biomonitoring marine environmental quality at the level of gene expression—testing the feasibility of a new approach. Water Science and Technology 42: 269–274. Sumpter, J.P. (2005) Endocrine disrupters in the aquatic environment: an overview. Acta Hydrochimica et Hydrobiologica 33: 9–16. Sung, S. and Amasino, R.M. (2004) Vernalization in Arabidopsis thaliana is mediated by the PHD finger protein VIN3. Nature 427: 159–164. Sunnucks, P. (2000) Efficient genetic markers for population biology. Trends in Ecology and Evolution 15: 199–203. Talbert, P.B., Bryson, T.D., and Henikoff, S. (2004) Adaptive evolution of centromere proteins in plants and animals. Journal of Biology 3: 1–17. Tamaoki, M., Nakajima, N., Kubo, A., Aono, M., Matsuyama, T., and Saji, H. (2003) Transcriptome analysis of O3-exposed Arabidopsis reveals that multiple signal pathways act mutually antagonistically to induce gene expression. Plant Molecular Biology 53: 443–456. Tamayo, P., Slonim, D., Mesirov, J., Zhu, Q., Kitareewan, S., Dmitrovsky, E., Lander, E.S., and Golub, T.R. (1999) Interpreting patterns of gene expression with selforganizing maps: methods and application to hematopoietic differentiation. Proceedings of the National Academy of Sciences USA 96: 2907–2912. Tamura, S., Hanada, M., Ohnishi, M., Katsura, K., Sasaki, M., and Kobayashi, T. (2002) Regulation of stressactivated protein kinase signaling pathways by protein phosphatases. European Journal of Biochemistry 269: 1060–1066. Tan, P.K., Downey, T.J., Spitznagel, E.L., Xu, P., Fu, D., Dimitrov, D.S., Lempicki, R.A., Raaka, B.M., and Cam, M.C. (2003) Evaluation of gene expression measurements from commercial microarray platforms. Nucleic Acids Research 31: 5676–5684. Tanguy, A., Boutet, I., Laroche, J., and Moraga, D. (2005) Molecular identification and expression study of
293
differentially regulated genes in the Pacific oyster Crassostrea gigas in response to pesticide exposure. FEBS Journal 272: 390–403. Tanksley, S.D. (1993) Mapping polygenes. Annual Review of Genetics 27: 205–233. Taroncher-Oldenburg, G., Griner, E.M., Francis, C.A., and Ward, B.B. (2003) Oligonucleotide microarray for the study of functional gene diversity in the nitrogen cycle in the environment. Applied and Environmental Microbiology 69: 1159–1171. Tatar, M., Bartke, A., and Antebi, A. (2003) The endocrine regulation of aging by insulin-like signals. Science 299: 1346–1351. Tatar, M., Kopelman, A., Epstein, D., Tu, M.-P., Yin, C.-M., and Garofalo, R.S. (2001) A mutant Drosophila insulin receptor homolog that extends life-span and impairs neuroendocrine function. Science 292: 107–1110. Taylor, G. (2002) Populus: Arabidopsis for forestry. Do we need a model tree? Annals of Botany 90: 681–689. Teske, A., Dhillon, A., and Sogin, M.L. (2003) Genomic markers of ancient anaerobic microbial pathways: sulfate reduction, methanogenesis, and methane oxidation. Biological Bulletin 204: 186–191. Thiele, D.J. (1992) Metal-regulated transcription in eukaryotes. Nucleic Acids Research 20: 1183–1191. Thomas, M.A. and Klaper, R. (2004) Genomics for the ecological toolbox. Trends in Ecology and Evolution 19: 439–445. Thompson, D.A.W. (1917) On Growth and Form. Cambridge University Press, Cambridge. Tiedje, J.M. and Zhou, J. (2004) Future perspectives: genomics beyond single cells. In Microbial Functional Genomics, J. Zhou, D.K. Thompson, Y. Xu, and J.M. Tiedje (eds). John Wiley & Sons, Hoboken, NJ: 477–486. Tillier, E.R.M. and Collins, R.A. (2000) The contribution of replication orientation, gene direction, and signal sequences to base-composition asymmetries in bacterial genomes. Journal of Molecular Evolution 50: 249–257. Tiquia, S.M., Wu, L., Chong, S.C., Passovets, S., Xu, D., Xu, Y., and Zhou, J. (2004) Evaluation of 50-mer oligonucleotide arrays for detecting microbial populations in environmental samples. BioTechniques 36: 664–675. Tissenbaum, H.A. and Guarante, L. (2001) Increased dosage of a sir-2 gene extends lifespan in Caenorhabditis elegans. Nature 410: 227–230. Tong, A.H.Y., Lesage, G., Bader, G.D., Ding, H., Xu, H., Xin, X., Young, J., Berriz, G.F., Brost, R.L., Chang, M. et al. (2004) Global mapping of the yeast genetic interaction network. Science 303: 808–813.
294
REFERENCES
Tonsor, S.J., Alonso-Blanco, C., and Koornneef, M. (2005) Gene function beyond the single trait: natural variation, gene effects and evolutionary ecology in Arabidopsis thaliana. Plant, Cell and Environment 28: 2–20. Treinin, M., Shliar, J., Jiang, H., Powell-Coffman, J.A., Bromberg, Z., and Horowitz, M. (2003) HIF-1 is required for heat acclimation in the nematode Caenorhabditis elegans. Physiological Genomics 14: 17–24. Treusch, A.H., Kletzin, A., Raddatz, G., Ochsenreiter, T., Quaiser, A., Meurer, G., Schuster, S.C., and Schleper, C. (2004) Characterization of large-insert DNA libraries from soil for ennvironmental genomic studies of Archaea. Environmental Microbiology 6: 970–980. Tringe, S.G., Von Mering, C., Kobayashi, A., Salamov, A.A., Chen, K., Chang, H.W., Podar, M., Short, J.M., Mathur, E.J., Detter, J.C. et al. (2005) Comparative metagenomics of microbial communities. Science 308: 554–557. Trivedi, S., Ueki, T., Yamaguchi, N., and Michibata, H. (2003) Novel vanadium-binding proteins (vanabins) identified in cDNA libraries and the genome of the ascidian Ciona intestinalis. Biochimica et Biophysica Acta 1630: 64–70. Tudge, C. (2000) The Variety of Life. Oxford University Press, Oxford. Tusher, V.G., Tibshrinai, R., and Chu, G. (2001) Significance analysis of microarrays applied to the ionizing radiation response. Proceedings of the National Academy of Sciences USA 98: 5116–5121. Tyson, G.W., Chapman, J., Hugenholtz, P., Allen, E.A., Ram, R.J., Richardson, P.M., Solovyev, V.V., Rubin, E.M., Rokhsar, D.S., and Banfield, J.F. (2004) Community structure and metabolism through reconstruction of microbial genomes from the environment. Nature 428: 37–43. Uchiyama, T., Abe, T., Ikemura, T., and Watanabe, K. (2005) Substrate-induced gene-expression screening of environmental metagenomic libraries for isolation of catabolic genes. Nature Biotechnology 23: 88–93. Ueki, T., Adachi, T., Kawano, S., Aoshima, M., Yamaguchi, N., Kanamori, K., and Michibata, H. (2003) Vanadium-binding proteins (vanabins) from a vanadium-rich ascidian Ascidia sydneiensis samea. Biochimica et Biophysica Acta 1626: 43–50. Urakawa, H., Noble, P.A., El Fantroussi, S., Kelly, J.J., and Stahl, D.A. (2002) Single-base-pair discrimination of terminal mismatches by using oligonucleotide microaarrays and neural network analyses. Applied and Environmental Microbiology 68: 235–244. Valinsky, L., Della Vedova, G., Scupham, A., Alvey, S., Figueroa, A., Yin, B., Hartin, R.J., Chrobak, M., Crowley, D.E., Jiang, T., and Borneman, J. (2002)
Analysis of bacterial community composition by oligonucleotide fingerprinting of rRNA genes. Applied and Environmental Microbiology 68: 3243–3250. Valls, M., Bofill, R., Romero-Isart, N., Gonza`lez-Duarte, R., Abia´n, J., Carrascal, M., Gonza`lez-Duarte, P., Capdevila, M., and Atrian, S. (2000) Drosophila MTN: a metazoan copper-thionein related to fungal forms. FEBS Letters 467: 189–194. Valverde, F., Mouradov, A., Soppe, W., Ravenscroft, D., Samach, A., and Coupland, G. (2004) Photoreceptor regulation of CONSTANS protein in photoperiodic flowering. Science 303: 1003–1006. Van der Wielen, P.W.J.J., Bolhuis, H., Borin, S., Daffonchio, D., Corselli, C., Giuliano, L., D’Auria, G., De Lange, G.J., Huebner, A., Varnavas, S.P. et al., and the BioDeep Scientific Party (2005) The enigma of prokaryotic life in deep hypersaline anoxic basins. Science 307: 121–123. Van der Wurff, A.W.G., Chan, Y.L., Van Straalen, N.M., and Schouten, J. (2000) TE-AFLP: combining rapidity and robustness in DNA fingerprinting. Nucleic Acids Research 28: e105. Van Elsas, J.D., Garbeva, P., and Salles, J. (2002) Effects of agronomical measures on the microbial diversity of soils as related to the suppression of soil-borne plant pathogens. Biodegradation 13: 29–40. Van Noordwijk, A.J. and De Jong, G. (1986) Acquisition and allocation of resources: their influence on variation in life history tactics. American Naturalist 128: 137–142. Van Regenmortel, M.H.V. (2004) Reductionism and complexity in molecular biology. EMBO Reports 5: 1016–1020. Van Spanning, R.J.M., Delgado, M.J., and Richardson, D.J. (2005) The nitrogen cycle: denitrification and relationship to N2 fixation. In Nitrogen Fixation in Agriculture, Forestry, Ecology and the Environment, D. Werner and E. Newton (eds). Kluwer Academic Publishers, Dordrecht: 277–342. Van Straalen, N.M. (1985) Comparative demography of forest floor Collembola populations. Oikos 45: 253–265. Van Straalen, N.M. (2002) Assessment of soil contamination—a functional perspective. Biodegradation 13: 41–52. Van Straalen, N.M. (2003) Ecotoxicology becomes stress ecology. Environmental Science and Technology 37: 324A–330A. Van Straalen, N.M. and Hoffmann, A.A. (2000) Review of experimental evidence for physiological costs of tolerance to toxicants. In Demography in Ecotoxicology, J.E. Kammenga and R. Laskowski (eds). John Wiley and Sons, Chichester: 147–161.
REFERENCES
Van Straalen, N.M., Hensbergen, P.J., Sterenborg, I., Janssens, T.K.S., and Roelofs, D. (2006) The role of metallothionein in adaptation to heavy metals. In Environmental Risk Assessment of Metals: New Concepts and Applications, C.R. Janssen and H.E. Allen (eds). CRC Press, Boca Raton, FL. Van Valen, L. (1973) A new evolutionary law. Evolutionary Theory 1: 1–30. Velculescu, V., Zhang, L., Vogelstein, B., and Kinzler, K.W. (1995) Serial analysis of gene expression. Science 270: 484–487. Velculescu, V., Vogelstein, B., and Kinzler, K.W. (2000) Analysing unchartered transcriptomes with SAGE. Trends in Genetics 16: 423–425. Venkatesh, B. (2003) Evolution and diversity of fish genomes. Current Opinion in Genetics & Development 13: 588–592. Venter, J.C., Adams, M.D., Sutton, G.G., Kerlavage, A.R., Smith, H.O., and Hunkapiller, M. (1998) Shotgun sequencing of the human genome. Science 280: 1540–1542. Venter, J.C., Remington, K., Heidelberg, J.F., Halpern, A.L., Rusch, D., Eisen, J.A., Wu, D., Paulsen, I., Nelson, K.E., Nelson, W. et al. (2004) Environmental genome shotgun sequencing of the Sargasso Sea. Science 304: 66–74. Vido, K., Spector, D., Lagniel, G., Lopez, S., Toledano, M.B., and Labarre, J. (2001) A proteome analysis of the cadmium response in Saccharomyces cerevisae. Journal of Biological Chemistry 276: 8469–8474. Vinogradov, A.E. (2004) Testing genome complexity. Science 304: 389–390. Voelckel, C. and Baldwin, I.T. (2004) Generalist and specialist lepidopteran larvae elicit different transcriptional responses in Nicotiana attenuata, which correlate with larval FAC profiles. Ecology Letters 7: 770–775. Voelckel, C., Weisser, W., and Baldwin, I.T. (2004) An analysis of plant-aphid interactions by different microarray hybridization techniques. Molecular Ecology 13: 3187–3195. Voget, S., Leggewie, C., Uesbeck, A., Raasch, C., Jaeger, K.-E., and Streit, W.R. (2003) Prospecting for novel biocatalysts in a soil metagenome. Applied and Environmental Microbiology 69: 6235–6242. Voordouw, G., Voordouw, J.K., Karkhoff-Schweizer, R.R., Fedorak, P.M., and Westlake, D.W.S. (1991) Reverse sample genome probing, a new technique for identification of bacteria in environmental samples by DNA hybridization, and its application to the identification of sulfate-reducing bacteria in oil field
295
samples. Applied and Environmental Microbiology 57: 3070–3078. Vos, P., Hogers, R., Bleeker, M., Reijans, M., Van de Lee, T., Hornes, M., Frijters, A., Pot, J., Peleman, J., Kuijper, M., and Zabeau, M. (1995) AFLP: a new technique for DNA fingerprinting. Nucleic Acids Research 23: 4407–4414. Wahlund, T.M., Hadaegh, A.R., Clark, R., Nguyen, B., Fanelli, M., and Read, B. (2004) Analysis of expressed sequence tags from calcifying cells of marine coccolithophorid (Emiliania huxleyi). Marine Biotechnology 6: 278–290. Walbot, V. (2000) A green chapter in the book of life. Nature 408: 794–795. Walker, B., Kinzig, A., and Langridge, J. (1999) Plant attribute diversity, resilience, and ecosystem function: the nature and significance of dominant and minor species. Ecosystems 2: 95–113. Walker, D.W., McGoll, G., Jenkins, N.L., Harris, E.E., and Lithgow, G.L. (2000) Evolution of lifespan in C. elegans. Nature 405: 296–297. Walker, C.H., Hopkin, S.P., Sibly, R.M., and Peakall, D. (2001) Principles of Ecotoxicology, 2nd edn. Taylor & Francis, London. Walker, J.J., Spear, J.R., and Pace, N.R. (2005) Geobiology of a microbial endolithic community in the Yellowstone geothermal environment. Nature 434: 1011–1014. Walsh, B. (2001) Quantitative genetics in the age of genomics. Theoretical Population Biology 59: 175–184. Wang, J. and Kim, S.K. (2003) Global analysis of dauer gene expression in Caenorhabditis elegans. Development 130: 1621–1634. Wang, W., Cherry, M., Botstein, D., and Li, H. (2002) A systematic approach to reconstructing transcription networks in Saccharomyces cerevisiae. Proceedings of the National Academy of Sciences USA 99: 16893–16898. Ward, B.B. (2002) How many species of prokaryotes are there? Proceedings of the National Academy of Sciences USA 99: 10234–10236. Waters, M.D. and Fostel, J.M. (2004) Toxicogenomics and systems toxicology: aims and prospects. Nature Reviews Genetics 5: 936–948. Wayne, L.G., Brenner, D.J., Colwell, R.R., Grimont, P.A.D., Kandler, O., Krichevsky, M.I., Moore, L.H., Moore, W.E.C., Murray, R.G.E., Stackebrandt, E. et al. (1987) Report of the ad hoc committee on reconciliation of approaches to bacterial systematics. International Journal of Systematic Bacteriology 37: 463–464. Weber, J.L. and Myers, E.W. (1997) Human whole genome shotgun sequencing. Genome Research 7: 401–409.
296
REFERENCES
Weinbauer, M.G. and Rassoulzadegan, F. (2004) Are viruses driving microbial diversification and diversity? Environmental Microbiology 6: 1–11. Weinig, C., Ungerer, M.C., Dorn, L.A., Kane, N.C., Toyonaga, Y., Halldorsdottir, S.S., Mackay, T.F.C., Purugganan, M.D., and Schmitt, J. (2002) Novel loci control variation in reproductive timing in Arabidopsis thaliana in natural environments. Genetics 162: 1875–1884. Weitzman, J.B. (2002) Transcriptional territories in the genome. Journal of Biology 1: 2. Weller, D.M., Raaijmakers, J.M., McSpadden Gardener, B.B., and Thomashow, L.S. (2002) Microbial populations responsible for specific soil suppressiveness to plant pathogens. Annual Review of Phytopathology 40: 309–348. Wellington, E.M.H., Berry, A., and Krsek, M. (2003) Resolving functional diversity in relation to microbial community structure in soil: exploiting genomics and stable isotope probing. Current Opinion in Microbiology 6: 295–301. Wenger, R.H. (2002) Cellular adaptation to hypoxia: O2-sensing protein hydroxylases, hypoxia-inducible transcription factors and O2-regulated gene expression. FASEB Journal 16: 1151–1162. Werck-Reichhart, D. and Feyereisen, R. (2000) Cytochromes P450: a success story. Genome Biology 1: reviews 3003.1–3003.9. Werck-Reichhart, D., Bak, S., and Paquette, S. (2002) Cytochromes P450. In The Arabidopsis Book, C.R. Somerville and E.M. Meyerowitz (eds). American Society of Plant Biologists, Rockville, IL: 10.119/tab.0028. Westerhoff, H.V. and Palsson, B.O. (2004) The evolution of molecular biology into systems biology. Nature Biotechnology 22: 1249–1252. Westerhoff, H.V., Hofmeyr, J.-H.S., and Khodolenko, B.N. (1994) Getting into the inside of cells using metabolic control analysis. Biophysical Chemistry 50: 273–283. Whitaker, R.J., Grogan, D.W., and Taylor, J.W. (2003) Geographic barriers isolate endemic populations of hyperthermophilic Archaea. Science 301: 976–978. Whitfield, C.W., Band, M.R., Bonaldo, M.F., Kumar, C.G., Liu, L., Pardinas, J.R., Robertson, H.M., Soares, M.B., and Robinson, G.E. (2002) Annotated expressed sequence tags and cDNA microarrays for studies of brain and behavior in the honey bee. Genome Research 12: 555–566. Whitaker, R.J., Grogan, D.W. and Taylor, J.W. (2003) Geographic barriers isolate endemic populations of hyperthermophilic Archaea. Science 301: 976–978. Williams, J.G.K., Kubelik, A.R., Livak, K.J., Rafalski, J.A.,
and Tingey, S.V. (1990) DNA polymorphisms amplified by arbitrary primers are useful as genetic markers. Nucleic Acids Research 18: 6531–6535. Wilson, K.H., Wilson, W.J., Radosevich, J.L., DeSantis, T.Z., Viswanathan, V.S., Kuczmarski, T.A., and Andersen, G.L. (2002) High-density microarray of small-subunit ribosomal DNA probes. Applied and Environmental Microbiology 68: 2535–2541. Wimp, G.M., Young, W.P., Woolbright, S.A., Keim, P., and Whitham, T.G. (2004) Conserving plant genetic diversity for dependent animal communities. Ecology Letters 7: 776–780. Wittstock, U. and Gershenzon, J. (2002) Constitutive plant toxins and their role in defense against herbivores and pathogens. Current Opinion in Plant Biology 5: 300–307. Wolf, Y.I., Rogozin, I.B., Grishin, N.V., and Koonin, E.V. (2002) Genome trees and the tree of life. Trends in Genetics 18: 472–479. Wood, W.B., Hecht, R., Carr, S., Vanderslice, R., Wolf, N., and Hirsh, D. (1980) Parental effects and phenotypic characterization of mutations that affect early development in Caenorhabditis elegans. Developmental Biology 74: 446–469. Wood, D.W., Setubal, J.C., Kaul, R., Monks, D.E., Kitajima, J.P., Okura, V.K., Zhou, Y., Chen, L., Wood, G.E., Almeida, Jr, N.F. et al. (2001) The genome of the natural genetic engineer Agrobacterium tumefaciens C58. Science 294: 2317–2323. Woods, I.G., Kelly, P.D., Chu, F., Ngo–Hazelett, P., Yan, Y.-L., Huang, H., Postlewaith, J.H. and Talbot, W.S. (2000) A comparative map of the zebrafish genome. Genome Research 10: 1903–1914. Wray, G.A., Hahan, M.W., Abouheif, E., Balhoff, J.P., Pizer, M., Rockman, M.V., and Romano, L.A. (2003) The evolution of transcriptional regulation in eukaryotes. Molecular Biology and Evolution 20: 1377–1419. Wu, L., Thompson, D.K., Li, G., Hurt, R.A., Tiedje, J.M., and Zhou, J. (2001) Development and evaluation of functional gene arrays for detection of selected genes in the environment. Applied and Environmental Microbiology 67: 5780–5790. Wu, M., Sun, L.V., Vamathevan, J., Riegler, M., Deboy, R., Brownlie, J.C., McGraw, E.A., Martin, W., Esser, C., Ahmadinejad, N. et al. (2004) Phylogenomics of the reproductive parasite Wolbachia pipientis wMel: a streamlined genome overrun by mobile elements. PLoS Biology 2: 0327–0341. Wullschleger, S.D., Jansson, S., and Taylor, G. (2002) Genomics and forest biology: Populus emerges as the perennial favourite. The Plant Cell 14: 2651–2655.
REFERENCES
Wynne-Edwards, K.E. (2001) Evolutionary biology of plant defenses against herbivory and their predictive implications for endocrine disruptor susceptibility in vertebrates. Environmental Health Perspectives 109: 443–448. Yang, Z. and Bielawski, J.P. (2000) Statistical methods for detecting molecular adaptation. Trends in Ecology and Evolution 15: 496–503. Yanovsky, M.J. and Kay, S.A. (2003) Living by the calendar: how plants know when to flower. Nature Reviews Molecular Cell Biology 4: 265–275. Yarza´bal, A., Appia-Ayme, C., Ratouchniak, J., and Bonnefoy, V. (2004) Regulation of the expression of the Acidithiobacillus ferrooxidans rus operon encoding two cytochromes c, a cytochrome oxidase and rusticyanin. Microbiology 150: 2113–2123. Ye, R.W. and Thomas, S.M. (2001) Microbial nitrogen cycles: physiology, genomics and applications. Current Opinion in Microbiology 4: 307–312. Ye, R.W., Wang, T., Bedzyk, L., and Croker, K.M. (2001) Applications of DNA microarrays in microbial systems. Journal of Microbiological Methods 47: 257–272. Yoch, D.C. (2002) Dimethylsulfionopropionate: its sources, role in the marine food web, and biological degradation to dimethylsulfide. Applied and Environmental Microbiology 68: 5804–5815. Yu, C.-W., Chen, J.-H., and Lin, L.-Y. (1997) Metal-induced metallothionein gene expression can be inactivated by protein kinase C inhibitor. FEBS Letters 420: 69–73. Yu, J., Hu, S., Wang, J., Wong, G.K.-S., Li, S., Liu, B., Deng, Y., Dai, L., Zhou, Y., Zhang, X. et al. (2002) A draft sequence of the rice genome (Oryza sativa L. ssp. indica). Science 296: 79–92. Zavala, J.A., Patankar, A.G., Gase, K., and Baldwin, I.T. (2004) Constitutive and inducible trypsin proteinase inhibitor production incurs large fitness costs in Nicotiana attenuata. Proceedings of the National Academy of Sciences USA 101: 1607–1612. Zdobnov, E.M., Von Mering, C., Letunic, I., Torrents, D., Suyama, M., Copley, R.R., Christophides, G.K., Thomasova, D., Holt, R.A., Subramanian, G.M. et al. (2002) Comparative genome and proteome analysis of
297
Anopheles gambiae and Drosophila melanogaster. Science 298: 149–159. Zera, A.J. and Harshman, L.G. (2001) The physiology of life history trade-offs in animals. Annual Review of Ecology and Systematics 32: 95–126. Zhang, B., Egli, D., Georgiev, O., and Schaffner, W. (2001) The Drosophila homolog of mammalian zinc finger factor MTF-1 activates transcription in response to heavy metals. Molecular and Cellular Biology 21: 4505–4514. Zhang, L.V., King, O.D., Wong, S.L., Goldberg, D.S., Tong, A.H.Y., Lesage, G., Andrews, B., Bussey, H., Boone, C., and Roth, F.P. (2005) Motifs, themes and thematic maps of an integrated Saccharomyces cerevisiae interaction network. Journal of Biology 4: 6. Zhou, J. (2003) Microarrays for bacterial detection and microbial community analysis. Current Opinion in Microbiology 6: 288–294. Zhou, J. and Thompson, D.K. (2004) Application of microarray-based genomic technology to mutation analysis and microbial detection. In Microbial Functional Genomics, J. Zhou, D.K. Thompson, Y. Xu, and J.M. Tiedje (eds). John Wiley & Sons, Hoboken, NJ: 451–476. Zhou, J., Thompson, D.K., and Tiedje, J.M. (2004) Genomics: toward a genome-level understanding of the structure, functions, and evolution of biological systems. In Microbial Functional Genomics, J. Zhou, D.K. Thompson, Y. Xu, and J.M. Tiedje (eds). John Wiley & Sons, Hoboken, NJ: 1–19. Zhu-Salzman, K., Salzman, R.A., Ahn, J.-E., and Koiwa, H. (2004) Transcriptional regulation of sorghum defense determinants against a phloem-feeding aphid. Plant Physiology 134: 420–431. Zimmerman, P., Hirsch-Hoffmann, M., Hennig, L., and Gruissem, W. (2004) GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiology 136: 2621–2632. Zou, S., Meadows, S., Sharp, L., Jan, L.Y., and Jan, Y.N. (2000) Genome-wide study of aging and oxidative stress response in Drosophila melanogaster. Proceedings of the National Academy of Sciences USA 97: 13726–13731.
This page intentionally left blank
Index
16S rRNA 116, 118, 119, 126, 159 28S rRNA 43 2R hypothesis 59 3-methylcholanthrene-type induction 227, 229 ab initio gene discovery 33 ABA 233, 240 ABC transporter 44, 157 ABF 213 ABRE 213, 233 abscisic acid 233, 240 abscisic acid-reponsive element binding factor 213 abscisic-acid responsive element 213, 233 acetylcholinesterase 35 acid-mine drainage 155, 157 Acidobacteria 130, 154 Acidithiobacillus ferrooxidans 140, 141, 155 aconitase 35 activator protein 1 213, 222 adaptive immune system 244 Aedes aegypti 94, 99 Aegilops tauschii 106 AFLP 23 age at maturity 163 age-1 166, 168 aging 166, 172, 174, 184, 186, 187 agonist 253 Agrobacterium tumefaciens 7, 76 Ah battery 228 Ah receptor 213, 228 Ah receptor nuclear translocator 228, 236 AhR 213 airborne microorganisms 124 albumin 43 alignment 43, 45 alternative splicing 11, 183, 192, 206 Alvinella pompejana 158 -mannosidase 35 Amblyomma americanum 94
amidophosphoribosyl transferase 154 ammonia monooxygenase 131, 136, 143, 148, 149 ammonia oxidation 131, 136, 137, 145 ammonification 131, 134, 137 amphibians 112 ampilicin 27, 28 amplified fragment length polymorphism 23 amplified ribosomal DNA restriction analysis 121 analysis of variance 49, 50 anammox 131, 134, 137 ancestral mitochondrial genome 82 annotation 33, 35, 44 AnoBase 99 Anopheles gambiae 6, 94, 97 anoxygenic photosynthesis 130, 131 ants 200 antagonist 253 antibacterial activity 151, 152 antimicrobial peptides 245 antioxidant-responsive element 213, 221, 222, 225, 229 antisense RNA 239 AP1 190 AP-1 213, 222 APETALA 1 190 Apicomplexa 84 apicoplast 84 Apis mellifera 6, 94, 198 apple maggot fly 185 aquaporin 171, 233, 234 Aquifex aeolicus 78 Arabidopsis Genome Initiative 103 Arabidopsis halleri 102 Arabidopsis lyrata 102 Arabidopsis petraea 103 Arabidopsis thaliana cell cycle 52 flowering time 25, 187, 190, 194 model species 6, 101, 103, 105
shade avoidance 203 stress response 232, 233 wounding response 241 Arabis alpina 103 ARDRA 121 ARE 213, 221, 222, 225, 229 ARNT 228 aromatase 253 arsenic 156 aryl hydrocarbon receptor 213, 228 Ascaris lumbricoides 89 Ascaris suum 91 ascorbate peroxidase 221 ascospore 87 assembly 32, 129 assimilative iron reduction 140 assimilative nitrate reduction 136 assimilative sulphate reduction 138 -tocopherol 221 ATP citrate lyase 35 ATP-binding cassette transporter 44 atrazine 252 autonomous pathway of floral transition 190, 191 auxin 204 BAC 27, 28 Bacillus 118, 124, 126 background correction 46 bacterial artificial chromosome 27, 28 bacteriochlorophyll 132 bacteriophage 4, 149, 150 -actin 43 Basic Local Alignment Tool 44 -carotenoid 221 Bdellovibrio bacteriovorus 153 BeanGenes 99 Bicyclus 197 bioavailability 248 biodegradation 8, 120 biodiversity 113, 115, 121, 128, 159 biogenetic law 181 biogeochemical cycles 130 299
300
INDEX
biogeography 160 bioinformatics 43, 267 biomineralization 141 biotechnology 7 biotin 39, 40 biotransformation 226, 227, 228 biplot 53 birds 112 bit score 44 BLAST 44, 45 body size 164, 200, 201, 203 Boechera holboeli 103 bolting 101, 187 Bombyx mori 6, 94, 184, 185 boutique array 242, 254 brain 12 Brassica 99, 194 brown algae 22, 83 Brugia malayi 69 Burkholderia 147 bZIP 233 C4 photosynthesis 8 cadmium 20, 43, 223, 224, 225, 249, 250 Caenorhabditis briggsae 6, 70 Caenorhabditis elegans aging 166, 170, 178, 180, 188 life cycle 92, 182 model species 6, 92 calcium cycle 131, 141 caloric restriction 168, 175 Calvin cycle 132, 156 Candida glabrata 88 Canis familiaris 6, 92 capacity limitation 115 carbocyanin 37 carbon cycle 130 carbon fixation 131 caste determination 198 catalase 170, 171, 221 CBF1 213, 250 CDE1 213 cDNA 17, 38, 39 cDNA library 29 Cdr-1 226 Celera Genomics 5, 32 cell cycle 52 cellular stress 211, 212 cellulase 108, 151 central theorem of demography 163 centromere binding factor 1 213, 250 Chao’s estimator 127 chaperone 216, 219 chicken 6, 112 chico 173, 175
chimpanzee 6, 12 Chlamy Center 100 Chlamydomonas reinhardtii 6, 99, 100 chlorophyll 132 chloroplast 82, 83, 84 choreography of expression 230 chorion formation 186 Choristoneura fumiferana 185 chromophore 204 chromosomal walking 29 chromosome library 29 chromosome painting 68 Ciona intestinalis 6, 8, 107 circadian clock 184, 190 cis-regulatory element 212 Citrullus lanatus 59 c-Jun N-terminal kinase 215, 222 c-Jun/c-Fos 222 Clinton, B. 5 clk-1 169 clock biological timing 169 clock entrainment 189, 195 cloning vector 27 Clostridium 124 cluster analysis 51, 53 clutch size 162 CO 189, 190, 195 Coccolithophorida 141 codon usage 33 codon usage bias 67 colinearity 68 collector’s curve 127, 159 Collembola 95, 96, 179 Collins, F. 5 Colorado potato beetle 185 common environmental response 231 communication technology 2 community ecology 113, 210 community genome array 121, 122 community genomics 145, 148, 151, 155, 159 community profiling 118, 120 comparative functional genomics 187 comparative genomics 8, 56, 268 compensation of growth 164 competent 77 complementary DNA 17 complexity hypothesis 79 computing technology 2 concatenation 40, 41 conditions, environmental 211 conflict over gene expression 165, 201 conjugation 76, 78, 174, 227 connectivity theorem 264 CONSTANS 189, 190, 195
constitutive defence 239 contig 29, 30 convergence, in networks 206 copper 221, 225 copy DNA 17 core proteome 63 corpora allata 178, 198 cosmid 27, 28 cost to reproduction 177 cottonwood 6, 99, 100, 194 CpG islands 65 Crassostrea gigas 252 crassulacean acid metabolism 8 Craterostigma plantagineum 236 critical weight 200, 201 croquemort 35 cross-species hybridization 10 CRY1 189 CRY2 25, 189, 190, 195 cryptochrome 25, 189, 203 cryptopolyploidy 59 Cryptosporidium parvum 84 c-type cytochrome 131, 140, 156 Culex pipiens 94 CUP1 250 C-value 56 C-value paradox 57 Cx-value 59 Cy3, Cy5 37, 39 Cyanidioschyzon merolae 6 Cyanobacteria 82, 83, 132, 134 cycle threshold 42, 43 cyclins 179, 181, 185 Cyp 174, 226, 228, 251 cysteine 221, 223, 249 cytochrome c oxidase 35, 198 cytochrome P450 170, 171, 173, 174, 226, 228, 229, 250 daf genes 166, 168, 170, 171, 172 damage-induced defence 239 Danio rerio 6, 13, 110 Daphnia Genomics Consortium 94 Daphnia magna 94 Daphnia pulex 94 Darwin, C. 3, 161, 164 dauer larva 91, 167, 172, 205 daylength 184, 189, 193, 195, 206 DDC model 63 DDE 254 deaminase 137 DEB model 164 Debaryomyces hansenii 88 decomposition 131, 133, 137, 139 degenerate primer 17, 18 degree distribution 260
INDEX
dehydration-responsive element 213, 233 deletion 70 demography 162 denaturating gel electrophoresis 118, 120 denitrification 131, 134, 135, 136, 143 depth of coverage 31, 129 derived mitochondrial genome 82 Desulfovibrio vulgaris 137, 138 detection of microorganisms 122, 123, 124, 142 de-ubiquitination 218, 219 developmental focus 197 developmental stage 180, 182, 183 dFoxo 175 DGGE 118, 120 diagnostic use of microarrays 38 diapause 182, 183, 205 diatom 6, 142 diauxic shift 37 diazotrophy 134 Dictyostelium discoideum 6 dideoxy chain termination 26 dietary restriction 168, 175 differential display of mRNA 19, 194 dimensionality reduction 53 dimerization 215 dimethyl sulphide 131, 138 dinitrogenase 135 dinoflagellates 83 dioxin 227 dioxin-responsive element 213, 228 disease suppression 15, 126 Distal-less 197 distributed control 263 ditag 40, 41 diuron 252 dn/ds ratio 72 DNA fingerprinting 22 dog 6 Doris 161 dose-effect relationship 248 dot-blot 20, 22 doubly conserved synteny 68 downstream genes 170, 171 DRE 213, 228, 233 DREB 213, 233 DREB family transcription factor 213 driver, in SSH 21 drosomycin 244, 247 Drosophila melanogaster aging 173, 178, 186, 188 body size 201, genome properties 35, 93, 96 immune response 244, 246, 247
life cycle 182, 186 model species 6, 32, 95 stress response 216, 237 transcriptional territories 3 Drosophila pseudobscura 94, 99 Drosophila simulans 186 drought 22, 230, 232, 234, 235 Dunaliella salina 236 duplicative transposition 60 dye-swappping 36 dynamic energy budget model 164 E value 44, 45 EARLY BOLTING IN SHORT DAYS 193 early daylength insensitivity 25 eavesdropping 242 EBS 193 EC50 248 ecdysone 200, 201 ecological control analysis 264 ecological genomics, defined 1 ecological niche 208, 209, 210 ecological stress 210 ecophysiology 210 ecosystem process 114 ecotoxicogenomics 14, 248 EDI 25 Edman degradation 17 effective population size (Ne) 61, 62 effector kinase 214 EGF 202 elasticity coefficient 264 electron shuttling 140, 157 electron transport chain 169 electron-transport flavoproteins 135, 153 electrophile metabolite 229 electrophile-responsive element 213, 221 elicitor 241 elongation factor1 43 Elton, C. 115 emergent properties 257 Emiliania huxleyi 141 Encephalitozoon cuniculi 84 end sequencing 29, 30 endocrine disruption 253, 254 endosymbiosis 81, 82, 83 energy allocation 164, 165 Entamoeba histolytica 6 Enterobius vermicularis 89 environmental physiology 210 environmental stress response 230 ephippium 94 epidermal growth factor 202
301
epigenetic 191, 269 epitope 244 EpRE 213, 221 ERE 213, 253 ERK 214, 215 Escherichia coli 65, 76, 93 essential genes 74 EST 29 ethylene 204, 235 euchromatin 32, 96 Euclidian distance 51, 54 Euglenozoa 84 European corn borer 185 evolution 2, 8, 9 evolutionary and ecological functional genomics 1, 9 exon 33 exon-specific expression 183 expect value 44, 45 explorative use of microarrays 39 expressed sequence tag 29 expression mountain 53 expression ratio 47, 50 external coincidence model 189 extracellular signal-regulated kinase 214, 215 extreme environment 116, 155, 158 eyespot 197 F factor 28 FAC 241 false colour 37 false positives 50 fatty acid - amino acid conjugates 241, 243 FCA 192, 193 Fenton reaction 220 ferritin 223, 234, 238 Ferroplasma 155, 157 ferrotransferrin 223 fertility rate 162, 163 Filaria martis 89 Filarial Genome Network 89 filtering, in microarrays 48 fish 108, 109, 110, 236, 238 FISH 32 fix cluster 135, 153 flatworm 20, 22 FLC 189, 190, 192, 193 FLD 191, 192 floral transition 189, 190, 206 FLOWERING LOCUS C 189, 190, 192, 193 FLOWERING LOCUS D 191, 192 FLOWERING LOCUS T 190, 193 flowering time 25, 187, 191, 194, 207
302
INDEX
fluorescence resonance energy transfer 42 fluorescent in situ hybridization 32 fluorescent label 37, 38, 39, 42 fluorescently tagged ARDRA 121 flux control coefficient 263 FlyBase 35, 98 fold regulation 47, 50 Folsomia candida 8, 15, 209 forest genomics 100 forward control analysis 264 fosmid 28 FPF1 190 F-pili 76 F-plasmid 76 Fragaria x anannassa 23 Frankia 134 free radical 220 FRET 42 FRI 190, 191 FRIGIDA 190, 191 fruit fly see Drosophila frustule 142 FT 190, 193 FT-ARDRA 121 Fucus vesiculosis 22 fugu 6, 7, 108 functional dissimilarity 115 functional gene array 122, 142 functional genomics 11 functional redundancy 114 function-driven screening of DNA library 145, 151 fundamental niche 208 X174 4, 57 FY 192, 193 GA 190, 193 GAGA factor 219 Gallus gallus 6, 112 gap 45 gap closure 30 Gasterosteus aculeatus 110, 111 Gastrophysa atrocyanea 185 GC content 65, 67 GC mutational pressure 67 GC skew 64 GC-clamp 118 gene annotation 33, 35, 44 gene chip 37, 38 gene discovery 33 gene expression matrix 46, 49, 51 gene family 33, 62 gene finding 33 gene name 35 gene ontology 34, 35, 186
gene silencing 191, 206 genetic adaptation 211 genetic manipulation 7 genetic map 29 genetic redundancy 104 genetic turbulence 3 genetical genomics 269 genetics 2 genome assembly 32, 129 genome fragment array 122 genome miniaturization 57, 82 genome phylogeny 81 genome sequencing 29, 30, 31 genome size 7, 31, 58, 62, 83, 99 genome, coined 1 genomic library 26, 28 genomics, coined 1 Geobacter 121, 139, 140 Geoffroy Saint Hilaire, E. 164 germ line precursor cells 169 gibberellin signalling 190 Gillichthys mirabilis 238 Girardia tigrina 20, 22 global polyploidization 58 Globodera pallida 82 gluconeogenesis 238 glucose dehydrogenase 35 glucose-regulated stress protein 217 glucuronyl transferase 226, 227 glutathione 221, 249 glutathione depletion 221, 250 glutathione S-transferase 174, 185, 227, 251 Glycine max 99 glycosyl transferase 174, 227 GO 34, 35 granule 226 green leaf volatiles 240 groundwater 120 growth factor 214 GST 174, 185, 227, 251 Guillardia theta 6 gypsy moth 185
Heliothis virescens 94 herbivory 239 heterochromatin 32, 95 Heterodera schachtii 126 heterodimerization 215, 222 hexamerin 2 198, 190 hierarchical modularity 261 hierarchical sequencing 29 HIF-1 213, 236, 238 high scoring segment pairs 44 high-throughput library screening 146 histone deacetylation 191, 192, 218 HOG 215 homeostasis 211 Homo sapiens 5, 6, 12, 32, 93 homology 33, 43 homoplasy 44 honey bee 6, 94, 198 Hordeum vulgare 99, 106 horizontal transmission 77 hormonal signal 165, 177, 178, 198, 200, 205 house-keeping gene 43, 47 Hox genes 110, 197 HPLC 17, 19 HRE 213 hsc 185 HSE 213, 218 HSF 172, 213, 218 Hsp 44, 170, 172, 184, 185, 215, 219 Human Genome Project 5, 32 hydrogen peroxide 169, 220 hydrophilic 14 hydrophobic 14, 152 hydrophobicity profile 152 hydrothermal vent 138, 158 hydroxyl radical 169, 220 hypoxanthine phosphoribosyl transferase 43 hypoxia 236 hypoxia-inducible factor 213, 236, 238
Haeckel, E. 181 Haemophilus influenzae 4, 5, 75 Hd1 194, 195 HDAC 191, 192 heat diagram 53 heat shock 215 heat shock cognate protein 185, 216 heat shock factor 172, 213, 217, 218 heat shock protein 170, 172, 184, 185, 215, 219, 236 hedgehog signalling 197 Helicoverpa zea 242
idiosyncratic hypothesis 114 image analysis 46 Imd 245 immune deficiency 245 immune response 98, 108, 185, 186, 244, 246 in silico biology 259 indel 70 indicator DNA signature 14 informational genes 74 innate immune respons 98, 108, 244, 246
INDEX
ins-7 172, 185 insert size 27 insertion 70 insulin signalling 166, 168, 172, 176, 201 insulin/IGF receptor 167, 168, 176 insulin-like peptide 167, 171, 178 integrated cellular stress-defence system 211 interaction strength 261 interdigitisation 69 International Fugu Genome Consortium 108 International Populus Genome Consortium 101 intron 33 inverse approach 256 inversion 70 ionomics 14 iron 220, 223, 246, 247 iron oxidation 131, 155 iron reduction 120, 131, 139, 140 isochore 65 isoproturon 252 isotope array 145 iteroparity 164 jasmonic acid 235, 240, 241 JNK 214, 215 junk DNA 57 juvenile hormone 198, 200, 201 rule 164 Ka/Ks ratio 71 Keap1 222 Kelch-like ECH-associating protein 1 222 keystone species 114 kinase 214 Kinetoplastida 6, 84 Kluyveromyces lactis 88 Kluyveromyces waltii 63 Krogh’s principle 10 lacZ 27 landing light 46 largemouth bass 254 large subunit, of ribosome 116, 118 late embryogenesis-abundant protein 233, 234 lateral transmission 77 LEA protein 233, 234 LEAFY 190, 193 Legume Genomics 99 Leishmania tropica 6
Leptinotarsa decemlineata 185 Leptospirillum 155, 157 LFY 190, 193 library construction 26, 27 library screening 28, 145 life-history trait 161, 177, 202 lifespan 166, 168, 169, 172, 175, 177, 178 lineage-specific effects 162 linear chromosome 76 linkage disequilibrium 25 lipid peroxidation 220 lipophilic substances 170, 174, 226, 228 local weighted regression 47, 48 locus control region 69 LOESS 47, 48 lognormal species-abundance curve 128 loi de balancement 164, 177 Lolium perenne 194 longevity 166, 168, 169, 172, 175, 177, 178 long-jawed mudsucker 238 loop weight 262 Lotka, A.J. 161 LSU 116, 118 Lycopersicon esculentum 99 Lymantria dispar 185 lysosomal vesicle 226 macroarray 36 macrophage 245 MADS-box protein 189, 193, 194 Maf protein 222 maintenance costs 164 major histocompatibility complex 244 MALDI-MS 19 Manduca sexta 184, 200, 242 manganese 221 MAPK phosphatase 215 MAPK signalling 202, 213, 214 mapping 25, 29 marine biodiversity 128, 129, 146, 150 marine community genomics 146, 150 maternal effect 182 maturity index 89 MCA 263 Medicago truncatula 7, 100 megaplasmid 76 meiotic drive 72 MEK 214 melanization 245, 247 melting curve analysis 123
303
mercury 225 Mesembryanthemum crystallinum 236 metabolic control analysis 263 metabolomics 11, 14 metagenomics 145, 148, 151, 155, 159 metal responsive element-binding transcription factor 213, 224, 225 metal tolerance 44, 149, 156, 158 metallothionein 17, 108, 171, 223 metal-thiolate cluster 223 metamorphosis 200, 201 Methanococcus jannaschii 5, 8, 134, 158 methanogenesis 131, 133, 134, 158 Methanosarcina mazei 79, 134 methanotrophy 131, 133, 143 methyl salicylate 240 methylmercury 225 MFO 226 MHC 244 MIAME 48 microarray 36, 39, 122, 142, 159 microbiology 2, 116 microevolution 211 Micropterus salmoides 254 microRNA 194 microsatellites 23 microsomal monooxygenase 226 Microsporidium 6 microsynteny 68 microtechnology 2 MIKC 189 minimal tiling path 29, 30 minimum information about a microarray experiment 48 mismatch 38, 39 mitochondrial genome 82, 83 mitogen-activated protein kinase signalling 202, 213, 214 mixed function oxygenase 226 MKK 214 MKP 215 model species 4, 6, 7, 9, 207 modularity 260 molybdene 135 monooxygenase 133, 136, 226 mortality rate 162, 163 mouse 6, 176, 178 MRE 213, 224 mRNA 11 Msn2p, Msn4p 213, 231 Mt gene 223 MTF-1 213, 224, 225 multilocus DNA fingerprinting 23 Multinational Brassica Genome Project 99
304
INDEX
multivariate statistics 51, 53 Mus musculus 6 Musa acuminata 59 mutation accumulation experiment 70 Mycoplasma genitalium 57 myosin heavy chain 35 Myzus nicotianae 243 natural variation 7, 9, 191, 201, 207, 268 neofunctionalization 63 net reproductive rate 162 network analysis 206, 260 network motif 261 network theme 261 Neurospora crassa 85, 86, 147 niche 208, 209, 210 Nicotiana attenuata 242 Nicotiana digluta 58 nicotine 242 nif regulon 135, 153 NIH 5 nir cluster 131, 136, 143 nitrate reductase 131, 136, 143 nitrification 131, 134, 136, 143 nitrite oxidation 131, 136, 137 Nitrobacter 136, 137 nitrogen cycle 131, 134 nitrogen fixation 7, 131, 134, 135, 153 nitrogenase 135, 153 Nitrosomonas 136, 137 Nitrosospira 136, 137 no effect concentration 248 NO reductase 131, 136 Nod-factor 76 noncyclic photophosphorylation 132 nonfunctionalization 62 nonsynonymous 70 nonylphenol 13, 254 NOR 54 norm of reaction 166, 195 normal operating range 54 normalization, in microarrays 47 Nostoc punctiforme 82 Notch 59 Nrf2 213, 221, 222 nuclear body 204 nuclear factor erythroid 2-related factor 2 213, 221 oestradiol 13, 254 oestrogen receptor 213, 253 oestrogen responsive element 213, 253 old-1 170
oligonucleotide microarray 37, 38 omc cluster 131, 140 omics 11 Onchocerca volvulus 89 one gene/one enzyme hypothesis 85 open reading frame 33 operational genes 74 operational taxonomic unit 124 operon 74 opines 76 optimality in life-history theory 162, 163 Orchesella cincta 17, 44 ORF 33 organelle genome database 81 origin of replication 27, 28, 74 orphans 34 orthologous 62 Oryza sativa 6, 99, 106, 194, 195 Ostreococcus tauri 100 Ostrinia nubilalis 185 OTU 124 outer membrane cytochrome 140 oxidative stress 220, 223, 228, 229 oxygenic photosynthesis 131 oxylipins 240 P element 60 p value 50 PAH 227 Pan troglodytes 6, 12 panhandle structure 20, 21 Paracelsus 247 Paracoccus denitrificans 136 Paracoccus pantotrophus 138, 139 parallelism, in networks 206 paralogous 62 paraquat 250, 251 pathogenicity factor 23 pathogenomics 14 PB-type induction 227, 229 PCA 51, 52 PCB 227 PCR efficiency 43 period 184 Peripatus 8 phage 27, 28 Phage Proteomic Tree 149 Phanerochaete chrysosporium 84, 133 pharmacogenomics 14 phase I, II metabolism 174, 227, 228 Phaseolus vulgaris 100 phenobarbital-type induction 227, 229 phenotypic plasticity 166, 196, 202, 205
phorbol ester 213 phosphite oxidation 138 phosphorus cycle 131, 138 photoautotrophy 130 photoheterotrophy 133, 146 photolithography 37 photoperiod 184, 189 photoperiod-response pathway 189, 190, 206 photosynthesis 22 photosynthetic cluster 132 photosystem I, II 132 phototropin 203 PHYA 189 PHYB 189, 204 phylochip 122, 124, 125 phylogenetic array 122 phylogenetic footprinting 8, 34, 88 phylogenetic shadowing 8, 88 phylogeny 45 physiological adaptation 211 physiological ecology 210 physiology 2, 10, 177, 210 phytochelatin 108, 224 phytochelatin synthase 224 phytochrome 189, 195, 203, 204, 205 phytoestrogen 253 Phytophthora fragariae 23 Picrophilus torridus 156 Pisum sativum 99 PKC 222 planarian 20, 22 plasmid 28, 74, 76, 82 Plasmodium 6 pleiotropy 165, 177, 179, 201 PLPP domain 193 poison 247 poly(A)tail 18, 36, 142, 193 polychlorinated biphenyls 227 polycistronic 74, 93 polycyclic aromatic hydrocarbons 227 polygenic mRNA 74 polymorphism 70, 97, 155 polyphasic taxonomy 116 polyphenism 196 polyphosphate 131, 139 polyploidization 58 Pompeii worm 158 poplar 6, 99, 100, 194 population genetics 2, 25 Populus nigra 101 Populus trichocarpa 6, 99, 100, 101, 194 post-translational modification 13, 189, 206 potato 99
INDEX
primary lesion 250 principal component analysis 51, 52 principle of complementarity 115 promoter 34, 212, 213, 219 prophage 75 protein kinase C 222 protein phosphorylation 167, 168 protein processing 13 proteolytic degradation 218 proteomics 11, 12, 13 proteorhodopsin 131, 133, 146, 147 prothoracicotropic hormone 200, 201 Protopterus aethiopicus 57 proximate response to stress 211 pseudogene 33 Pseudomonas 57, 123, 126, 158 pseudoreplication 49 PTTH 201 pUC vector 27 puffer fish 6, 7, 109 purF 154 purple bacteria 130, 132 pyrite oxidation 155, 157 QTL 24, 110, 111, 268 quantitative PCR 41, 42 quantitative trait locus 24, 110, 111, 268 queen caste 198, 199 RACE 18, 20 radical 220 random genome fragment array 122 randomly amplified polymorphic DNA 23 Rank Difference Analysis of Microarrays 50 RAPD 23 rapid amplification of cDNA ends 18 Ras signalling 201, 202 Rattus norvegicus 6 RDAM 50 RDP-II 118 reaction norm 166, 196 reactive oxygen species 169, 174, 220 reading frame conservation test 88 realized niche 208 real-time PCR 41, 42, 43 receptor tyrosine kinase 213, 214 Reclinomonas americana 81 recombinant DNA 7, 27 red cytochrome 156 red jungle fowl 6, 112 Red Queen hypothesis 244 redundant species hypothesis 114 regional polyploidization 58
repABC operon 77 repetitive DNA 32 replication slippage 60 replication, in microarrays 49 resources 211 respiration 169, 198 restriction-fragment fingerprinting 29 reverse control analysis 264 reverse hybridization 36 reverse sample genome probing 121 reverse transcription 17, 18, 39, 43 reversed phase liquid chromatography 17 rhabditid 89 Rhagoletis pomonella 185 rhesus monkey 12 Rhizobium 134, 153 Rhodobacter 132 rhodopsin 35, 133, 146, 147 Ribosomal Database Project 118 ribosome 116, 118 rice 6, 99, 106, 194, 195 Rickettsia 81,83 Rio Convention 113 rivet hypothesis 114, 143, 159 RNA interference 7 ROS 174, 220, 225 Roseobacter 138 rRNA 11, 118 RTK 213, 214 Rubisco 131, 132, 157 rubredoxin oxidoreductase 221 rusticyanin 131, 140, 141, 156 Saccharomyces cerevisiae aging 176 diauxic shift 37 gene network 260 genome properties 34, 85, 93 life cycle 87 model species 6, 30, 84, 85 stress response 230, 249 Saccharomyces Genome Database 87 SAGE 40 salinity 232, 234 Salmo salar 245 salt marsh 137, 138 SAM 50 Sanger sequencing 26 SAPK 214, 215 Sarcophaga crassipalpis 184, 185 Sargasso Sea 129, 147 scaffold 29, 30, 129 scale-free topology 260 SCAR 23
305
scavenging of ROS 220 ¨ TZE 193 SCHLAFMU SCHNARCHZAPFEN 193 scope for growth 253 Secale cereale 106 secondary compounds 239 sediment 137, 143 segregation distortion 72 selectable marker 28 self-fertilization 91 self-organizing maps 52, 53, 180 semelparity 164 senescence 186 sequence-characterized amplified region 23 sequence-driven screening of DNA library 145, 153 sequence-tagged site 23 sequencing 26 sequential hermaphoditism 91 serial analysis of gene expression 40 sex 50, 186 sexual conjugation 87 SGA 260 SGD 34 shade avoidance 202 shearing 31 Shewanella 140 shmoos 87 shotgun sequencing 31 siderophore 140 signal transduction 212 silent information regulator2 176 silicium 131, 142 silk worm 6, 94, 184, 185 single nucleotide polymorphism 24, 70 single-nucleotide discrepancy 98 singlet oxygen 220 singular-value decomposition 51 Sinorhizobium meliloti 7, 100 SIP 143 sir2 176 sludge 136, 145 small subunit, of ribosome 116, 118 SMZ 193 SNP 24 SNZ 193 SOC1 190, 193, 195 SOD 221 soil microorganisms 127, 128, 151, 154 Solanaceae Genomics Network 99 Solanum tuberosum 99 SOM 52, 53 Southern blotting 36
306
INDEX
sox cluster 139 SoyBase 99 species accumulation curve 127 species richness 113 speckles 204 Spirochaetales 78 spliceosome 219 sporulation 87 spotting 37, 38 spruce budworm 185 SRP-PhyloChip 124 SSH 20, 44, 238 SSU 116, 118 stable isotope probing 143 statistical analysis 49, 50, 51 Statistical Analysis of Microarrays 50 steroid 178, 229 stickleback 110, 111 strawberry 23 STRE 213, 231 streptavidin 39, 40 stress ecology 210 stress elicitors 241 stress protein 215, 216 stress response 170, 185, 186, 211 stress response element 213, 231 stress, defined 210 stress-activated protein kinase signalling 214, 215, 219 structural genomics 56 STS 23 subfunctionalization 63 subgenomic-sized mitochondrial DNA 82 substitution 70 substrate limitation 115 sugar beet cyst nematode 126 sulphate reduction 124, 125, 131, 137 sulphocyanin 156, 157 sulphotransferase 227 sulphur cycle 137 sulphur oxidation 131, 138, 139, 156, 157, 159 sulphur salvage 249 summation theorem 263 superfunctionalization 62 superoxide dismutase 221 superoxide radical 220 suppression subtractive hybridization 20, 44 SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1 193, 195 survival rate 162, 163, 166, 201, 203 Svedberg unit 116
Syber green 42 symbiosis 76, 134, 153, 158, 159 symbiotic plasmid 76 synonymous substitution 33, 70 synteny 8, 68 synthetic genetic array 260 syntrophy 134, 265 systemic response 240 systems biology 258 TAED 74 tagging enzyme 40, 41 take-all 126 Takifugu rubripes 6, 7, 108 tandem mass spectrometry 12 tangled bank 3 target of rapamycin 201 TATA box 219 TCDD 227 T-DNA 76 TE-AFLP 24 temperature 158, 191, 197, 201, 215, 232, 233, 235 temperature-gradient electrophoresis 118 terminal restriction fragment length polymorphism 121 terminal sequencing 29, 30 tester, in SSH 21 Tetraodon nigroviridis 6, 109 tetraploidy 58 tetrodotoxin 108 TFIID 219 TGGE 118 Thalassiosira pseudonana 6, 142 thaumatin 171 The Adaptive Evolution Database 74 The Arabidopsis Information Resource 106 thematic map 261 Thermotoga maritima 78 Thermotogales 78 thiol group 223 thioredoxin 221 Thlaspi caerulescens 103 Thompson, D’A. 200 three-enzyme AFLP 24 Ti plasmid 76 tinkering 3 tissue-specificity of expression 225, 234 tobacco 242 tobacco hornworm 184, 200, 242 Toll 245 tomato 99 TOR 201
total intensity normalization 47 toxicity 247 toxicogenomics 14, 248 trade-off 162, 164, 165, 177, 180, 201 transactivation 218 trans-acting factor 212 transcription factor 34, 167, 212, 213 transcription factor binding site 34, 212, 213 transcription factor IID 219 transcription modules 260 transcription profiling 36, 38, 40, 46, 170, 180, 190, 199, 202, 205, 238, 247, 254, 267 transcriptional regulation 212 transcriptional territories 3 transcriptomics 11, 12, 36 transduction 77 TRANSFACÒ 212 transformation 77 transforming DNA 76 transition 70 translational control 13 transposon 7 transversion 70 TreeGenes 99 T-RFLP 121 Tribolium castaneum 94 trimerization 215, 216 triploidy 59 Triticum aestivum 59, 99 tritrophic interaction 240 tRNA 11 trophic control analysis 264 trophosome 159 Trypanosoma brucei 6 tube worm 159 tubulin 43 tumor-inducing plasmid 76 tunicamycin 251 tunicin 108 Tupiocoris notatus 243 Tympanoctomys barrerae 59 ubiquinone 169 ubiquitin 185, 216, 217, 218 ubiquitination 218 ultimate response to stress 211 unculturable microorganisms 116 unequal crossing-over 60 universal bacterial primers 118 universal tree of life 117 untranslated region of mRNA 18, 20, 37 upstream genes 170 UTR 18, 37
INDEX
vanabins 108 vanadium 108 V-ATPase 131, 141 Venn diagram 13 Venter, J.C. 5 vernalization 187, 190, 191 Vestimentifera 159 viral communities 149, 150 vital rates 161 vitamin E 221 vitellogenin 180, 253 volcano plot 50 wFleaBase 95 WGS 31, 129, 147, 148
white rot 84, 133 whole genome shotgun sequencing 31, 129, 147, 148 wildfire 86, 242 Wolbachia 81 worker caste 198, 199 WormBase 92 WW domain 193 Xenbase 112 xenobiotic responsive element 213, 228, 229 xenobiotics 170, 174, 252 Xenopus laevis 112 XRE 213, 228, 229
307
YAC 27, 28 Yap 231 Yarrowia lipolytica 88 yeast see Saccharomyces yeast activator protein 231 yeast artificial chromosome 27, 28 yolk protein 172 Zea mays 59, 99 zebrafish 6, 13, 110 Zebrafish Information Network 110 zinc 209, 223, 224 zootype 69