Commerce and Monetary Systems in Ancient World (Oriens et Occidens, 6)

MELAMMU SYMPOSIA V

Robert Rollinger / Christof Ulf (Eds.)

Commerce and Monetary Systems in the Ancient World: Means of Transmission and Cultural Interaction

Franz Steiner Verlag 2004

INHALTSVERZEICHNIS/CONTENTS SYMPOSIUM PROGRAMM/SYMPOSIUM PROGRAMME

10

VORWORT/PREFACE Christoph Ulf

14

EINLEITUNG/INTRODUCTION Robert Rollinger, The 'Melammu' Project: An Introductory Note 17 Robert Rollinger, Das fünfte internationale 'Melammu-Meeting' in Innsbruck. Überlegungen zu Kulturkontakt und Kulturaustausch in der Alten Welt 20 I. WIRTSCHAFTSTHEORIE/ECONOMIC THEORY Engelbert Theurl, Konkurrierende Theorien der Geldentstehung: Einige Überlegungen zur Vereinbarkeit Marc Van De Mieroop, Economic Theories and the Ancient Near East Morris Silver, Modern Ancients

33 54 65

II. MESOPOTAMIEN IM 3. JAHRTAUSEND/ MESOPOTAMIA IN THE THIRD MILLENNIUM B.C. Piotr Steinkeller, Toward a Definition of Private Economic Activity in Third Millennium Babylonia 91 III. MESOPOTAMIEN UND DIE LEVANTE IN DER 1. HÄLFTE DES 1. JAHRTAUSENDS V.CHR./ MESOPOTAMIA AND THE LEVANT IN THE FIRST HALF OF THE FIRST MILLENNIUM B.C. Michael Jursa, Grundzüge der Wirtschaftsformen Babyloniens im ersten Jahrtausend v. Chr. Muhammad Dandamayev, Twin Towns and Ethnic Minorities in First-Millennium Babylonia Karen Radner, Assyrische Handelspolitik: Die Symbiose mit unabhängigen Handelszentren und ihre Kontrolle durch Assyrien Günter Kopcke, Mycenaean Kingship - A Speculative View

115 137 152 170

IV. GRIECHISCHE ARCHAIK/GREEK ARCHAIC David Tandy, Trade and Commerce in Archilochos, Sappho, and Alkaios V. WIRTSCHAFTSTHEORIEN IN ANWENDUNG AUF DIE KLASSISCHE ANTIKE/ ECONOMIC THEORIES APPLIED TO CLASSICAL ANTIQUITY Kurt A. Raaflaub, Archaic Greek Aristocrats as Carriers of Cultural

183

8

Inhaltsverzeichnis

Interaction Astrid Möller, Zur Aktualität der Wirtschaftsanthropologie Karl Polanyis

197 218

VI. LEVANTE, ÄGYPTEN UND DIE ÄGÄIS IN DER 1. HÄLFTE DES 1. JAHRTAUSENDS V.CHR./ LEVANT, EGYPT AND THE AEGEAN WORLD IN THE FIRST HALF OF THE FIRST MILLENNIUM B.C. Michael Sommer, Die Peripherie als Zentrum: Die Phöniker und der interkontinentale Fernhandel im Weltsystem der Eisenzeit Hans Georg Niemeyer, The Phoenicians and the Birth of a Multinational Mediterranean Society Nancy Demand, Iron Age Cyprus: Recent Finds and Interpretative Strategies Ingomar Weiler, Sklaverei in der homerischen und altorientalischen Welt. Vergleichende Betrachtungen

233 245 257 270

VII. HELLAS UND ACHÄMENIDEN, PARTHER, SASANIDEN UND ROM/ GREECE AND ACHAEMENIDS, PARTHIANS, SASANIANS AND ROME Josef Wiesehöfer, "Persien, der faszinierende Feind der Griechen": Güteraustausch und Kulturtransfer in achaimenidischer Zeit Burkhard Meissner, Über Modelle antiker Geldverkehrssysteme Andreas Luther, Dura-Europos zwischen Palmyra und den Parthern. Der politische Status der Region am Mittleren Euphrat im 2. Jh. n.Chr. und die Organisation des palmyrenischen Fernhandels Herbert Grassl, Marktorganisation und Preisbildung in der römischen Kaiserzeit Andrea Gariboldi, Royal Ideological Patterns between Seleucid and Parthian Coins: the Case of Θεοπάτωρ Antonio Panaino, Commerce and Conflicts of Religions in Sasanian Iran between Social Identity and Political Ideology

295 311 327 352 366 385

VIII. SPEZIELLE ASPEKTE/SPECIAL ASPECTS Richard N. Frye, Trade and Coinage on the Ancient 'Silk Route' Jaakko Hämeen-Anttila, A "New" Source for Late Antique Paganism Baruch A. Levine, Tracing the Biblical Accounting Register: Terminology and the Signification of Quantity Hannes D. Galter, Militärgrenze und Euphrathandel. Der sozio-ökonomische Hintergrund der Trilinguen von Arslan Tash Manfred Schretter, Zur Rolle der altmesopotamischen Schule bei der Gestaltung und überregionalen Verbreitung kultureller Orientierungsmuster

405 408 420 444 461

Contents

Salvo De Meis, Astronomical Reflexes in Ancient Coins Reinhold Bichler, Some Observations on the Image of the Assyrian and Babylonian Kingdoms within the Greek Tradition Fabio Martelli, Il progetto di colonizzazione Armena della Terra Santa nell'eta' di T'oros II

9

470 499 519

REGISTER/INDEX I. Orts- und Personenregister II. Quellen

531 540

STATUTES

550

INHALTSVERZEICHNIS DER BÄNDE MELAMMU I, II, III/ CONTENTS OF THE VOLUMES MELAMMU I, II, III

555

AUTORINNEN UND AUTOREN/ CONTRIBUTORS

559

DAS FÜNFTE INTERNATIONALE ‘MELAMMU’-MEETING IN INNSBRUCK. ÜBERLE1 GUNGEN ZU KULTURKONTAKT UND KULTURAUSTAUSCH IN DER ALTEN WELT Robert Rollinger Ich möchte zunächst mit einem allgemeinen und grundsätzlichen Gedankengang beginnen und die in den Introductory Notes angeschnittenen Grundideen des ‘Melammu’-Projekts erneut aufgreifen. Zwei Dinge erscheinen mir dabei für die Konferenz in Innsbruck von Bedeutung. Sie weist, wie die Vorgängerveranstaltungen auch, einen thematischen Schwerpunkt auf: “Commerce and Monetary Systems in the Ancient World: Means of Transmission and Cultural Interaction”. Andererseits ist – trotz der angestrebten inhaltlichen und chronologischen Breite – doch auch eine gewisse Schwerpunktsetzung für die erste Hälfte des ersten Jahrtausends v. Chr. erkennbar, ohne freilich das ‘davor’ und ‘danach’ zu vernachlässigen. Es sind nicht nur Gründe der Praktikabilität eines thematisch fixierten Wissensaustausches im Rahmen eines Kongresses, die uns zu diesem Schritt veranlaßten, sondern diese Vorgehensweise hängt auch mit dem Standort Innsbruck zusammen. Schon seit geraumer Zeit stellt die Erforschung der Dark Ages sowie der nachfolgenden Archaik einen wesentlichen Pfeiler der Forschungsaktivitäten des hiesigen Instituts für Alte Geschichte und Altorientalistik dar. Die Beziehungen mit der Welt der Levante werden dabei als grundsätzliche Voraussetzung für ein adäquates Verständnis der Vorgänge innerhalb der griechischen Welt betrachtet. Diese Forschungsbemühungen fanden Eingang in ein von Christoph Ulf und mir verfolgtes und längerfristig angelegtes Projektvorhaben, das die Entwicklungen der früharchaischen Zeit in den übergeordneten Kontext einer historischen Betrachtung des östlichen Mittelmeerraumes stellt. Vor zwei Jahren veranstalteten wir in diesem Rahmen einen internationalen Kongreß, der den programmatischen Titel: “Das Archaische Griechenland: interne und externe Impulse” trug. Die Ergebnisse liegen inzwischen in gedruckter Form vor2. Doch verlassen wir für ein paar Augenblicke die Welt der wissenschaftlichen Exklusivität und erweitern wir unseren Blick. Was bedeutet unter diesen Auspizien ‘Melammu’, wenn wir über die Grenzen der Wissenschaftsdisziplinen und verstaubten Gelehrtenstuben hinausschauen? Lassen sich aus den das ‘MelammuProjekt’ bestimmenden Leitlinien auch Perspektiven für ein breiteres Bildungsbewußtsein ableiten? Ich glaube ja. Werfen wir nur einen Blick auf das Hier und Jetzt.

1

2

Die hier angestellten Überlegungen decken sich teilweise mit R. Rollinger, Von Griechenland nach Mesopotamien und zurück: Alte und neue Probleme in der Beschäftigung mit Fragen des Kulturtransfers, von Kulturkontakten und interkultureller Kommunikation (Zu den Beziehungen zwischen Mesopotamien und Griechenland im ersten Jahrtausend v. Chr.), in: F. Schipper (Hg.), Der Irak zwischen den Zeiten. Österreichische Forschungen zwischen Euphrat und Tigris, Klagenfurt 2004, im Druck. R. Rollinger und Ch. Ulf (Hg.), Griechische Archaik: Interne Entwicklungen – Externe Impulse, Berlin 2004.

Robert Rollinger

21

Die Europäische Union befindet sich in einer entscheidenden Erweiterungsphase. Einwanderungs- und Asylfragen beschäftigen nicht nur die europäische Politik. Der Europabegriff gilt als neue politische Vision. Damit verbunden sind freilich auch Ab- und Ausgrenzungen. Eine europäische Identität wird gesucht, und die Differenz gegenüber dem Anderen gewinnt ihre – auch populistischen – Akzente. Forderungen nach einer ‘Leitkultur’ werden unverblümt artikuliert. Europa scheint als identitätsstiftender Faktor eine Renaissance zu erleben. Sucht man nach den Ursprüngen des Europabegriffs und des Europabewußtseins, gelangt man rasch in die griechische Welt des 5. Jahrhunderts v. Chr., als sich im Rahmen der Auseinandersetzung mit den persischen Großkönigen Abgrenzungsmuster entwickelten, die aus der europäischen Kulturgeschichte nicht mehr wegzudenken sind und die bis heute eine ungebrochene Nachwirkung entfalten. ‘Europa’ und ‘Asien’ werden nicht nur als vorgegebene geographische Räume erfaßt, sondern auch als Kulturzonen definiert, deren Gegensätzlichkeit nicht markanter sein könnte3. Dabei werden Denk- und Deutungsstrukturen entwickelt, denen mentalitätsgeschichtlich und politisch ein überwältigender Erfolg beschieden sein sollte. Die Person des persischen Großkönigs wird zum Paradigma des Despoten, der als schwächlich, weibisch, grausam und hoffärtig, als Tempelzerstörer und Frevler par excellence charakterisiert wird, eine Darstellung, die in der griechischen Tradition beinahe kanonischen Charakter gewinnt4. Gleichzeitig wird die Auseinandersetzung mit den Persern zum Krieg zweier Welten hochstilisiert. ‘Asien’ und ‘Europa’ werden als unterschiedliche Räume erfaßt, die durch divergierende Lebensweisen charakterisiert sind. Dort der verweichlichte, dem Luxus verfallene Orientale, der Despotie unterworfen, der König in seinem Harem gefangen, unfähig, sich den realen Anforderungen eines Regenten zu stellen. Hier die hart erprobten und von einer kargen Umwelt gestählten Griechen, freisinnig und nur sich selbst gehorchend und letztlich politisch erfolgreich. Die Ge3

4

Im folgenden werden Begriffe wie ‘Asien’, ‘Europa’, ‘Orient’ und ‘Okzident’ als durch Konvention festgelegte Bezeichnungen für geographische Großregionen verwendet. Dabei ist zu berücksichtigen, daß die Verwendung dieser Termini für die Zeit vor dem 5. vorchristlichen Jahrhundert im Prinzip einen Anachronismus darstellt. Vgl. generell zu dieser Thematik: J. Cobet, Europa und Asien – Griechen und Barbaren – Osten und Westen, in: Geschichte in Wissenschaft und Unterricht 47 (1996), 405-419. A. Demandt, Europa. Begriff und Gedanke in der Antike, in: P. Kneissl und V. Losemann (Hg.), Imperium Romanum. Studien zu Geschichte und Rezeption. Festschrift für Karl Christ zum 75. Geburtstag, Stuttgart 1998, 137157. T. L. Kienlin und B. Schweizer, Der Orient als Gegenbild Europas: Zur Konstruktion kultureller Einheiten, in: R. Aslan, S. Blum, G. Kastl, F. Schweizer, D. Thumm (Hg.), Mauerschau. Festschrift für Manfred Korfmann, Band 1, Remshalden-Grunbach 2002, 191-220. J. Wiesehöfer, Iraner und Hellenen: Bemerkungen zu einem umstrittenen kulturellen Verhältnis, in: S. Conermann und J. Kusber (Hg.), Studia Eurasiatica. Kieler Festschrift für Hermann Kulke zum 65. Geburtstag (Afrika und Asien, Band 10), Schenefeld 2003, 497-524. Vgl. P. Briant, Histoire et idéologie. Les Grecs et la ‘décadence perse’, in: M.-M. Mactoux und E. Geny (Hg.), Mélanges Pierre Lévêque, Volume 2: Anthropologie et societé (Centre de Recherches d´Histoire Ancienne Volume 82), Paris 1989, 33-47. R. Bichler und R. Rollinger, s.v. Greece VI. The Image of Persia and Persian in Greek Literature, in: Encyclopaedia Iranica XI/3, New York 2002, 326-329. R. Rollinger, s. v. Herodotus, in: Encyclopaedia Iranica XII/3, New York 2003, 254-288.

22

Einleitung

burt ‘Europas’ als geistige Konzeption hat in diesem historischen – um nicht zu sagen chauvinistischem – Milieu stattgefunden. In diesem Kontext wurden jene topisch fixierten und mit einer spezifischen Deutung der ‘Realität’ versehenen Parameter entwickelt, die sich über die Jahrhunderte der Geschichte bis in die Gegenwart hinein ihre Geltung bewahren konnten. Dabei wird allzu leicht vergessen, daß sie ihrerseits ursächlich mit der Geburt einer griechischen = europäischen Identität verbunden waren. Gräkozentrismus geht nahtlos in Eurozentrismus über. Und wie so oft: Identitätsfindung bedeutet gleichzeitig Ausgrenzung und die Entwicklung von Stereotypen.5 Doch die auf diese Weise geschaffenen Konzeptionen wirkten nicht nur in die Zukunft, sondern auch in die Vergangenheit zurück. Auch wenn sich so etwas wie ein „gemeinsames griechisches Bewußtsein“, das sich auf sprachlichen, kulturellen und religiösen Berührungspunkten gründete, in Ansätzen schon in der Antike entwickelte, so reicht diese Entwicklung doch nicht über das 6. Jahrhundert hinaus und dürfte für die erste Hälfte des ersten Jahrtausends v. Chr. auch nicht existiert haben6. Zudem wurde dieses ‘Gemeinschaftsbewußtsein’ von Staatswesen wie Athen und Sparta getragen, die nicht nur seit dem ausgehenden 6. Jahrhundert eine dominante Rolle in der ‘innergriechischen’ Geschichte spielten, sondern auch wirkungsmächtig die im 5. Jahrhundert einsetzende historiographische Überlieferung prägten. Dieser Umstand wirkte sich sehr stark auf die moderne Geschichtswissenschaft aus. Griechische Geschichte wird immer noch primär mit ‘athenischer’ und ‘spartanischer’ Geschichte gleichgesetzt. Gleichzeitig wird jedoch an der Existenz einer genuin ‘griechischen’ Geschichte festgehalten, die sich gegenüber den Nachbarräumen abhebe und in der die Geburt der europäi5

6

Zwei Beispiele aus der österreichischen Medienlandschaft der sogenannten Qualitätszeitungen mögen dies illustrieren. So ortet der Chefredakteur der ‘Presse’ in seinem Essay ‘Wir nennen es Europa’ (Spectrum, 1. März 2003) selbstbewußt drei europäische Wurzeln, die er in der griechisch-römischen Antike, im Christentum sowie in der Aufklärung zu erkennen glaubt. Die sich aus diesem Konstrukt ergebenden Abgrenzungen sind ebenso ‘klar’: „Diese drei Fundamente bringen auch interessante Antworten auf die Frage, was nicht zu Europa gehört: Mit den USA und Kanada teilt Europa alle drei Wurzelstränge, mit der Welt der orthodoxen Kirche nur noch die ersten beiden. Mit dem Islam keine.“ Bei Hans Rauscher, einem der führenden Kolumnisten des ‘Standard’, sind es nur noch zwei angebliche Pfeiler Europas, nämlich die griechisch-römische Antike und die Aufklärung (Standard, 11. November 2003). In einer persönlichen Replik wird schließlich die Gleichsetzung Europa – Griechen – Athen offenkundig, wobei Herr Rauscher ausdrücklich auf die Perserkriege als Ausgansszenario verweist, in denen er den Gegensatz zwischen einer „selbstorganisierten, selbstbewußten Bürgerschaft in der Polis“ (scil. Athens) und den „persischen Despoten des Hochkönigtums mit angeschlossenen Satrapen“ zu erkennen glaubt. Der Sieg sei auf der „individualistischen Grundhaltung“ ersterer basiert: „Das war das Geheimnis des Sieges über das dumpfe Gefolgschafts- und Personenkult-System der Perser (e-mail vom 13. November 2003). Vgl. zu all dem die kritisch-reflektierenden Gedanken von Alan Sked, Die Mythen von der europäischen Einheit, in: Europäische Rundschau 19, 1991, bzw. Peter Funke, Europäische lieux de mémoire oder lieux de mémoire für Europa im antiken Griechenland, in: Jahrbuch für Europäische Geschichte 3 (2002), 3-16. Ch. Ulf, Griechische Ethnogenese versus Wanderungen von Stämmen und Stammstaaten, in: Ch. Ulf (Hg.), Wege zur Genese griechischer Identität. Die Bedeutung der früharchaischen Zeit, Berlin 1996, 240-280, hier 250f. Siehe ferner J. M. Hall, Ethnic Identity in Greek Antiquity, Cambridge 1997.

Robert Rollinger

23

schen Geschichte verortet wird7. Bei genauerer Betrachtung erweist sich dieses Bild jedoch als unhaltbar. Die gewaltigen Veränderungen, die sich in einzelnen Zonen Griechenlands im ersten Drittel des ersten Jahrtausends v. Chr. abspielten, bleiben ohne den größeren Kontext der orientalischen Geschichte unverständlich. Dabei spielt nicht nur der Raum der Levante eine wesentliche Rolle, sondern die Leitlinien der Entwicklung lassen sich bis in den mesopotamischen Raum zurückverfolgen. Wie befruchtend eine solche verbreiterte Perspektive wirken kann und wie grundlegend unsere historischen Kenntnisse dadurch erweitert und bereichert werden, möchte ich an zwei Beispielen deutlich machen. Die Griechen reflektierten nicht nur in ihren Epen über ihre Kontakte mit der orientalischen Welt, sondern auch die orientalische Welt hinterließ uns Informationen über diese Begegnungen, wenn diese auch von der Forschung nicht immer zur Kenntnis genommen werden. Der älteste Beleg dafür stammt aus der Zeit um 730 v. Chr. und findet sich in einem Brief eines assyrischen Beamten an König Tiglatpilesar III. Dieser Beamte, der im Bereich um Tyros stationiert war, sah sich unversehens mit einer Attacke der ‘Ionier’ konfrontiert, worüber er seinem Herrn getreulich berichte8: Die ‘Ionier’ sind aufgetaucht. Bei der Stadt Samsimuruna haben sie ein Gefecht geliefert, bei der Stadt Harisu, und bei der Stadt [...]. Ein Berittener kam nach Danabu (um mir alles mitzuteilen). Ich sammelte die regulären Truppen und Dienstverpflichteten und verfolgte sie. Gar nichts haben sie (die ‘Ionier’) mitgenommen. Sobald sie (nämlich) meine Soldaten sahen, suchten sie auf ihren Booten das Weite, (und) sie verschwanden in der Mitte des Meeres. Der Text stellt die ‘Ionier’ bereits als eine bekannte Größe vor, mit der man offenkundig schon seit geraumer Zeit in Berührung gekommen war. Sie treten 7

8

Man vgl. etwa unlängst Ch. Meier, Besprechung von W. Burkert, Die Griechen und der Orient. Von Homer bis zu den Magiern, München 2003, in: Neue Zürcher Zeitung vom 16. April 2003, wo Meier auf Burkerts Diktum eines „mehrdimensionalen Reichtums“ der griechischen Kultur, den er „in der kontinuierlichen Gesamtheit einer nahöstlich-mediterranen Koiné“ verortet sieht, repliziert: „Die Alternative dazu wäre, daß es sich bei den Griechen doch eher um einen Neuanfang handelte, vielleicht gar den Anfang Europas. 97 Prozent der genetischen Substanz sollen Menschen mit Affen gemein haben. Ganz wichtige Prozentpunkte können also Entscheidendes ausmachen. Vielleicht verhält es sich mit den Kulturen mutatis mutandis gar nicht so anders. Man kann vieles jedenfalls von zwei Seiten sehen“. Dazu ist festzuhalten, daß diese angebliche Schärfung des Blickes allzu oft nur dann gilt, wenn es darum geht, den vermeintlichen Neuanfang des ‘griechischen Wunders’ hervorzuheben. Wenn diese angeblich genuin griechische Kultur dann mit der sogenannten Kultur des modernen Europa oder der ‘westlichen Welt’ verbunden wird, werden die Vergleichsebenen allerdings rasch unschärfer. Man darf wohl annehmen, daß allfällige Gemeinsamkeiten, egal wie hoch man sie veranschlagt, in diesem Fall kaum auf vorgebliche anthropologische Konstanten, zurückgeführt werden, sondern im Gegensatz dazu auf ein gemeinsames kulturelles Erbe rekurriert wird. Vgl. dazu R. Rollinger, The Ancient Greeks and the Impact of the Ancient Near East: Textual Evidence and Historical Perspective, in: R. M. Whiting (Hg.), Melammu Symposia 2: Mythology and Mythologies: Methodological Approaches to Intercultural Influences. Proceedings of Second Annual Symposium of the Assyrian and Babylonian Intellectual Heritage Project held in Paris, October 4-7, 1999. Helsinki 2001, S. 233-264, hier 237-239.

24

Einleitung

nicht als geschlossene politische Macht mit territorialen Ansprüchen auf, sondern werden als Unruhefaktor präsentiert. Ihr Interesse scheint vor allem im Rauben und Plündern bestanden zu haben. Ihr Vorteil ist die Schnelligkeit. Die Auseinandersetzung mit der assyrischen Armee wird tunlichst vermieden. Rasches BeuteMachen und schneller Abzug kennzeichnen ihr Verhalten. Sie fallen keineswegs über den anatolischen Landweg in den Raum um Sidon und Tyros ein, sondern sind mit Schiffen unterwegs, die sie als kundige Seefahrer ausweisen. Worin ihre Beute bestanden hat, wird nicht gesagt, doch darf angenommen werden, daß sie mitnahmen, was sie in die Finger bekommen konnten. Dazu zählten neben materiellen Gütern wohl auch Menschen. Eine erstaunliche Parallele zu dem eben vorgeführten assyrischen Brief findet sich in der Odyssee, wo die als besonders rudertüchtig geltenden und als Menschenhändler verschrieenen Taphier in einem ähnlichen Kontext auftreten. Dort berichtet die aus Sidon stammende Amme des Eumaios von ihrer Verschleppung durch die Taphier: Aber die Taphier griffen mich auf, diese Räuber; ich ging da/ Eben vom Acker nachhause; sie brachten mich weg und verkauften/ Hier mich ins Haus dieses Mannes; der gab einen achtbaren Kaufpreis (Od. 15, 427-429, nach Weiher)9 Die Motivation für ein solches Verhalten war freilich nicht nur Beutegier und Profitstreben, sondern vielfach auch ökonomischer Zwang. Dies macht der als Bettler verkleidete Odysseus an einer anderen Stelle dem Schweinehirten Eumaios deutlich: Freilich der Magen! Er drängt und es kann ihn doch keiner verbergen,/ Diesen verwünschten, der so viele Übel den Menschen verursacht./ Er ist schuld, daß sie Schiffe mit trefflichen Ruderbänken/ rüsten aufs ruhelose Meer und Unheil bringen den Feinden (Od. 17, 286-289, nach Weiher). Ökonomische Zwänge als Triebfedern menschlichen Handelns und Movens transkultureller Begegnung – wir wollen diesen Gedanken im Gedächtnis behalten. Freilich implizieren solche Begegnungen auch die Überwindung sprachlicher Grenzen, ein Problem, das sich auch der Europäischen Union zusehends stellt und das sie mit der Ausbildung von Leitsprachen und einem ganzen Heer von Dolmetschern zu bewältigen sucht. Doch war dies auch ein Problem in der alten Welt, das einem regen Kulturaustausch im Wege stand? Wohl kaum, wie das zweite Beispiel zeigt. Dabei handelt es sich um zwei hieroglyphen-luwische Inschriften des 8. Jahrhunderts v. Chr., die aus Karkemiš stammen und autobiographische Nachrichten des Prinzenerziehers Iariri enthalten. Während Iariri in der ersten Inschrift seine weitreichenden Beziehungen dokumentiert, hält er in der zweiten seine umfassenden Sprach- und Schriftkenntnisse fest: Meinen Namen aber hatten die Götter die Grenze überschreiten lassen, und man hörte ihn von mir einerseits in Ägypten, andererseits hörte man ihn in Urartu, andererseits hörte man (ihn) auf Lydisch, auf Phrygisch und auf Phö9

Vgl. zu den Taphiern ferner Od. 1, 181-184, 419; 14, 452; 16, 426.

Robert Rollinger

25

nikisch, doch ließ ich (meine) Untergebenen ihn zusätzlich bei jedem König angenehm machen10. Und in der zweiten Inschrift heißt es: [Ich konnte in 4 Schriften schreiben, und zwar] in der städtischen Schrift, in der phönizischen Schrift, in der assyrischen Schrift und in der aramäischen Schrift. Auch konnte (wörtl.: wußte) ich 12 Sprachen: Anläßlich von Reiseunternehmungen hatte mir mein Herr wegen der (erforderlichen) Sprach(kenntnisse) den Sohn eines jeden Landes zur Verfügung gestellt, und er lehrte mich alle (sprachliche) Gewandtheit11. Auch wenn die Texte nach wie vor partiell sprachliche Schwierigkeiten bieten, die Identifizierung einzelner Schriften und Sprachen – die durchaus auch Dialekte sein können – mit Unsicherheiten behaftet ist und Iariri seine Fähigkeiten teilweise prahlerisch überhöht haben mag12, so ergibt sich doch ein stimmiges Gesamtbild. Angesprochen werden weitreichende diplomatische Beziehungen, die vom zentralen Anatolien über Syrien bis nach Ägypten reichen. Sie werden selbstbewußt von einem Mitglied des königlichen Hofes präsentiert, der als ‘Diplomat’ weitreichende Beziehungen pflegte und für den Sprach- und Kulturgrenzen keine Barrieren darstellten. Iariri war gewiß keine Ausnahmeerscheinung. Es tritt uns vielmehr eine polyglotte Welt entgegen, wie wir sie auch aus anderen, wenn auch nicht derart prägnanten Textzeugnissen kennen13. Daß der Blick Iariris nicht weiter nach Westen und Osten ausschweift, hängt allein mit der politischen Perspektive des Textes zusammen. Er dokumentiert die diplomatischen Beziehungen von Karkemiš. Andere ‘Staaten’ hatten gewiß einen anderen Radius14. Handelsund Wirtschaftskontakte stehen überhaupt auf einem anderen Blatt. Doch grundlegend bleibt: Sprachgrenzen bildeten kein grundsätzliches Hindernis für raumübergreifende Außenbeziehungen. Auch die Griechen standen mit dieser Welt in Kontakt, und es sind wieder die Taphier, die in der Odyssee mit einer vielsprachigen Welt in Berührung kamen. Diesmal ist es Athene, die in Gestalt des Taphiers Mentes zu Telemachos spricht: Mentes, den Sohn des klugen Anchialos, nenn ich mich rühmend./ Herrscher bin ich der Taphier, jener Freunde der Ruder./ Jetzt bin zu Schiff ich soeben 10 Karkamis A 6, 2-3 nach F. Starke, Sprachen und Schriften in Karkamis, in: B. PongratzLeisten, H. Kühne, P. Xella (Hg.), Ana šadî Labnani l! allik. Beiträge zu altorientalischen und mittelmeerischen Kulturen. Festschrift für Wolfgang Röllig (AOAT 247) Neukirchen/Vluyn 1997, 381-395, hier 382 (Unterstreichungen R.R. – sie geben Unsicherheiten in der Übersetzung an). 11 Karkamis A 15b, 4 nach Starke (wie Anm. 10), 382f. 12 So neige ich dazu, die Zahl 12 für ‘rund’ zu halten. Starke (wie Anm. 10), 387 lehnt dies entschieden ab. 13 Vgl. dazu generell R. Rollinger, Homer, Anatolien und die Levante: Die Frage der Beziehungen zu den östlichen Nachbarkulturen im Spiegel der schriftlichen Quellen, in: Ch. Ulf (Hg.), Der neue Streit um Troia. Eine Bilanz, München 2003, 330-348. 14 Vgl. etwa den bei Assurbanipal, Prisma A II 111-125, thematisierten ‘diplomatischen Verkehr’ zwischen Gyges von Lydien und Psammetich von Ägypten: R. Borger, Beiträge zum Inschriftenwerk Assurbanipals. Die Prismenklassen A, B, C = K, D, E, F, G, H, und T sowie andere Inschriften, Wiesbaden 1996, 219. Siehe dazu Rollinger (wie Anm. 13).

26

Einleitung

gekommen; ich fuhr mit Gefährten/ Fort auf dem weinroten Meer zu Menschen mit anderen Sprachen (Od. 1, 180-184, nach Weiher). Wir besitzen eine Reihe weiterer Textzeugnisse, die die wohl vielfältigen Kontaktsituationen zwischen der Welt der Ägäis und jener des Vorderen Orients vor Augen treten lassen. Dies ist nicht zuletzt deshalb von herausragender Bedeutung, weil sich in der archäologischen Hinterlassenschaft der Ägäis wie auch auf der Ebene des literarischen Schaffens mit Einsetzen der homerischen Epen jener vielschichtige Kulturaustausch offenbart, von dem vor allem die Regionen Zentralgriechenlands einen nicht zu unterschätzenden Entwicklungsschub erfuhren, der die historische und kulturelle Entwicklung innerhalb der ägäischen Welt weiter ausdifferenzierte und sie in neue Bahnen lenkte. Der direkte Kontakt mit der Levante war hierfür ein maßgeblicher Faktor, und es ist ebenso kein Zufall, daß sich seit der Wende vom 8. zum 7. Jahrhundert v. Chr. erstmals griechische ‘Handelsstützpunkte’ an der östlichen Küste des Mittelmeeres nachweisen lassen. Diese Stützpunkte dürfen nicht mit griechischen ‘Kolonien’ verwechselt werden, wie sie etwa an den Küsten des Schwarzen Meeres angelegt worden waren, in denen die Griechen als kulturell überlegene Siedler auftreten konnten. Demgegenüber war die Situation im ‘Orient’ ganz anders geartet. Hier waren die Griechen als Handelspartner geduldet und ihre Präsenz von der Zustimmung der lokalen Autoritäten abhängig. Gleichwohl ergaben sich hier Zonen und Möglichkeiten für jenen Kulturtransfer, der Teile der griechischen Welt so nachhaltig verändern sollte. Die orientalischen Textzeugnisse vermitteln einen Einblick in diesen weltgeschichtlich so bedeutsamen Prozeß aus der Perspektive des assyrischen Königtums. Gleichzeitig wird deutlich, daß sich die Kontakte der griechischen Welt nach Osten nicht auf die Levante beschränkten, sondern bis weit ins Innere des assyrischen Imperiums reichten. Hier tat sich eine Fülle weiterer interkultureller Kontaktzonen auf. Doch es ist nicht nur dieser Aspekt, der den Beziehungsgeflechten zwischen einer größeren orientalischen Welt und ihren westlichen Nachbarn ein besonderes Gepräge verleiht. Wenn wir uns der Zusammenhänge zwischen den ökonomisch bedingten Handels- und Entdeckungsfahrten der Phöniker und Syrer nach Westen, ihrer stimulierenden und transformatorischen Wirkung für einen sich ausbildenden und das ganze Mittelmeer umfassenden Ost-Westhandel und der damit verbundenen Ausprägung und Entwicklung eigenständiger Kulturregionen mit der diesen Prozeß erst bedingenden Expansion des assyrischen Reiches nach Westen in den Raum zwischen Kilikien und der ägyptischen Grenze vergegenwärtigen, so erscheint nicht nur die enge Verzahnung der Kulturen und Entwicklungen von Gibraltar bis ins Innere ‘Asiens’ unter einem neuen Gesichtspunkt, sondern auch der Anteil der Kulturen Mesopotamiens an der Ausprägung dessen, was die ältere Forschung als den von der Außenwelt scheinbar unberührten und somit einmaligen historischen Prozeß des ‘griechischen Wunders’ verstanden hat, in einem völlig anderen Licht. Ost und West rücken näher zusammen als das nicht nur bis in die Gegenwart gängigen Ab- und Ausgrenzungsmustern lieb sein kann. Zurück in die Gegenwart: Damit sind wir wiederum bei der aktuellen Diskussion angelangt, in der Fragen der interkulturellen Kommunikation und Kontaktnahme oder gar der diversen Möglichkeiten eines kulturübergreifenden Zusam-

Robert Rollinger

27

menlebens, sei es nun im Kontext der eben erst vollzogenen EU-Osterweiterung, sei es in Fragen des Asylrechts oder gar des Arbeitsmarktes, eine so brisante Rolle zukommt. Der Blick zurück in die Vergangenheit kann uns dabei zwei Dinge lehren. Zum einen bietet ein Blick auf die kulturellen Vernetzungen und Verzahnungen der ersten Hälfte des ersten vorchristlichen Jahrtausends v. Chr. eine breite Fülle an Anschauungsmaterial, das Fragen der transkulturellen Kommunikation und deren Folgeerscheinungen in einem differenzierten Licht erscheinen läßt. Die erkennbaren historischen Entitäten sind dabei keine ethnischen Größen im Sinne des modernen Nationalstaates. Vielmehr zeigt sich eine bunte Vielfalt differenzierten kulturellen Verhaltens, das gegenseitig äußerst befruchtend wirkt und ein beachtliches Entwicklungspotential freisetzt, ein Prozeß, in den verschiedenste Kulturen, vom heutigen Iran bis nach Gibraltar auf die eine oder andere Weise eingebunden waren. Das darf durchaus mit dem modernen Begriff der ‘Internationalisierung’ gleichgesetzt werden. Dabei hat der kulturell überlegene und in seiner gesellschaftlichen und ökonomischen Entwicklung wesentlich komplexere ‘Orient’ die vergleichsweise weniger weit entwickelten Gebiete im Westen in einem beachtlichen Ausmaß befruchtet und wichtige Impulse für deren Weiterentwicklung gegeben. Ethnische Schranken und Abgrenzungsmuster sind dabei zunächst nicht erkennbar. Sie entwickeln sich erst sekundär und erreichen schließlich im Athen des 5. Jahrhunderts, in der Zeit der Perserkriege, eine ungeheuere Dynamisierung. Hier entsteht jener Eurozentrismus, der als Idee bis in die Gegenwart wirkt und mit einem präpotenten – und ahistorischen – Überlegenheitsgefühl gepaart ist. Es ist eine wichtige Lehre der Geschichte, diesen Eurozentrismus nicht nur als ideengeschichtlches Konstrukt zu begreifen, sondern im Gegensatz dazu das Augenmerk auf die durch den Kulturkontakt gegebenen Entwicklungsmöglichkeiten und Impulse zu lenken. Und gerade davon profitierte auch die griechische Welt nach dem 5. Jahrhundert noch in erheblichem Maße. Zum anderen sind die Altertumswissenschaften gefordert, den Eurozentrismus nicht unreflektiert zu übernehmen und davon ‘inspiriert’, allein mit den Griechen die Geschichte ‘Europas’ beginnen zu lassen und folglich der Beschäftigung mit der griechischen Welt einen höheren Stellenwert gegenüber der Auseinandersetzung mit den Kulturen des Vorderen Orients einzuräumen15. Dies wäre eine fatale Reaktion auf jenen von außen herangetragenen legitimatorischen Druck, der zusehends auf den Altertumswissenschaften lastet; sie würde eine unreflektierte Verinnerlicherung eben dieses Eurozentrismus und damit eine neue Form der Ausgrenzung bedeuten, die in erheblichem Maße auch einer tieferen historischen Erkenntnis im Wege stünde. Die Altertumswissenschaften sollten vielmehr den Eurozentismus historisieren und ihn als historisch wirksame Idee begreifen16. Gleichzeitig

15 Vgl. dazu J. Osterhammel, Die Entzauberung Asiens. Europa und die asiatischen Reiche im 18. Jahrhundert, München 1998. J. Rüsen (Hg.), Westliches Geschichtsdenken. Eine interkulturelle Debatte, Göttingen 1999. 16 Vgl. oben Anm. 3.

28

Einleitung

muß aber der dadurch vorgegebene Rahmen gesprengt und der Blick erweitert werden. Historische Einheiten, Identitäten oder gar Ethnien sind immer gedanklich wirksame Konstrukte. Sie sind historisch gewachsene Deutungsmuster der ‘Realitäten’ und sollten nicht mit den ‘Realitäten’ und deren wirksamer Dynamik verwechselt werden. Auf diese Weise wird erkennbar, daß Kulturtransfer und Kulturaustausch ein gewaltiges Entwicklungspotential für alle Beteiligten bereithalten. Daß dadurch auch Ängste und Bedrohungsszenarien, Ab- und Ausgrenzungsmuster entstehen, ist verständlich und ebenso erklärbar. Das historische Beispiel kann unseren Blick für beide Phänomene schärfen und uns lehren, daß die Chancen zu einer dynamischen Weiterentwicklung die durch Ängste erzeugten ‘Gefahren’ bei weitem überwiegen. Mesopotamien und der ‘Orient’ liegen somit viel näher bei ‘Europa’ als wir das vermuten möchten. Eine Beschäftigung mit diesen faszinierenden Kulturen ist deshalb nicht nur als Begleiterscheinung eines verstaubten Gelehrtendaseins zu sehen. Denn die Beschäftigung mit menschlichem Verhalten, sozialen und ökonomischen Normen, sowie anthropologischen ‘Gesetzmäßigkeiten’, die Auseinandersetzung mit dem Menschen und den von ihm geschaffenen kulturellen Netzwerken in der älteren und jüngeren Vergangenheit kann auch der Standortbestimmung in der Gegenwart dienen. Die Aufgabe, den Blick für solche Fragestellungen zu öffnen, kommt im besonderen den Geisteswissenschaften zu, die gerade dadurch ihre ‘gesellschaftliche Relevanz’ bestätigen. Dies festzuhalten ist in Zeiten wie diesen wichtig, in denen mit Scheuklappen behaftete Kritiker, die Geistes- und Kulturwissenschaften insgesamt als „Wiederkäuer von Sekundär- und Tertiärliteratur“ denunzieren17. Ein derartiges von technokratischer Totengräbermentalität gespeistes Sykophantentum mag von der Hoffnung getragen werden, für den eigenen Forschungsbereich mittelfristig – und auf Kosten anderer Disziplinen – mehr Mittel zu lukrieren. Im Hinblick auf die Gestaltung auch nur befriedigender gesellschaftlicher und politischer Zustände ist eine solche kurzsichtige Haltung nicht zielführend. Demgegenüber sollte auch für die Wissenschaften als Ganzes das Bemühen um eine bessere Pflege des Miteinander als des Gegeneinander zur erstrebenswerten Norm erhoben werden. Daß in einem derartigen Leitbild zukünftiger Entwicklung den Geisteswissenschaften im allgemeinen und den Altertumswissenschaften im besonderen ein fester Platz zukommt, kann kaum bestritten werden. Wie stehen diese allgemeinen Ausführungen mit der hiesigen Konferenz und ihrem Leitthema: ‘Commerce and Monetary systems in the Ancient World. Means of Transmission and Cultural Interaction’ in Verbindung? Die Kontakte mit der orientalischen Welt hatten viele Gesichter. In den Altertumswissenschaften wird kaum mehr geleugnet, daß die ägäische Welt eine Vielfalt von Anregungen und Impulsen aus dem Vorderen Orient aufgegriffen hat. Dazu zählen etwa die Alphabetschrift, mythische Stoffe, literarische Motive, epische Erzähltechniken, Religion und Magie, Wissenskultur und Gestaltungselemente der politischen Kultur sowie ein breiter Fundus der materiellen Hinterlassenschaft, der von der Klein17 Vgl. Standard 5. Juli 2001, S. 35 (Ernst Bonek).

Robert Rollinger

29

kunst bis zur Großarchitektur reicht18. Dennoch bleibt vieles zu klären, insbesondere ist die Frage zu beantworten, wie wir uns die konkret faßbaren Kulturkontakte, die Wege des Kulturtransfers, jene Synapsen, die den regen kulturellen Austausch vermittelten, vorstellen dürfen. Um es mit den Worten Robin Osbornes zu sagen: “talk of easterners wandering about the Greek world is not enough”19. Vielmehr muß es in der künftigen Forschung darum gehen, zivilisatorischen, kulturellen, gesellschaftlichen und politischen Einfluß zu differenzieren, menschliche Begegnungsformen von Formen kultureller und herrschaftlicher Kolonisation abzuheben. Freilich konnten nicht all diese Aspekte gleichzeitig bei dem in Innsbruck veranstalteten Kongreß Berücksichtigung finden, da ein derartiges Unterfangen den Rahmen einer einzigen Veranstaltung gesprengt hätte. Deshalb war eine thematische Abgrenzung notwendig. Ebenso wie Kolonisation und Krieg stellt der Handel ein wesentliches Medium interkultureller Aktion dar. Diese Thematik wurde in das Zentrum des Innsbrucker Kongresses gestellt. Mit ihr beschäftigt sich die Mehrzahl der Beiträge in diesem Band. Um Austauschphänomene dieser Art erfassen zu können, war der Blick auch auf die Wirtschaftssysteme insgesamt von Bedeutung. Dabei galt es, ihre Gesetzmäßigkeiten zu beschreiben und ihre Rahmenbedingungen zu definieren. Erst dadurch schien ein volles Verständnis der sich in diesem Medium abspielenden kulturellen Kontakte möglich. Aus diesem Grund bekamen in diesem Rahmen auch grundsätzliche Fragen besonderes Gewicht, wie: ! Grundsätzliche Überlegungen zu den Formen von Wirtschaft bzw. zu den Modellen von Wirtschaftsformen, die sich auf die Gesellschaften des Alten Orients und der Antike anwenden lassen. ! Die Beschreibung des Verhältnisses von nur kleinräumig wirksamen Wirtschaftsformen und überregional wirksamen wirtschaftlichen Entwicklungen. ! Der Vergleich zwischen Wirtschaftsräumen im Alten Orient und jenen der Klassischen Antike mit dem Ziel, Spezifika und Ähnlichkeiten nachzuweisen. Bei all diesen Themenstellungen war besonderes Augenmerk auf die jeweiligen ‘kulturellen Nahtstellen’ zu legen. Ziel sollte es sein, Übernahmen, Impulse von außen, Transformationen und kulturelle Wechselwirkungen sowie die generelle Bedeutung des interkulturellen Kontakts für das den Kongreß bestimmende Leitthema näher zu betrachten. In diesem Zusammenhang war sowohl die geographische Dimension, d. h. der Einfluß auf ‘Nachbarkulturen’ zu thematisieren, als auch die chronologische Dimension, d. h. Voraussetzungen und Weiterentwicklungen innerhalb eines spezifischen kulturellen Milieus, zu behandeln. Aus den angeführten Themenbereichen ergab sich eine Fülle von Einzelfragen. Solche waren unter anderem: ! Die Frage der Aktualität des alten Streits zwischen Modernisten und Primitivisten. ! Das Verhältnis der (chronologischen) ‘Epochen’ zueinander. 18 Vgl. zu all dem Rollinger (wie Anm. 13). 19 R. Osborne, Besprechung von Ulf (Hg.) (wie Anm. 6), in Journal of Hellenic Studies 118 (1998), 240.

30

Einleitung

Die Existenz von Spezifika für die einzelnen Wirtschaftsräume. Die Existenz von ‘Entwicklungsschüben’ in regionalen und überregionalen Wirtschaftsräumen. Trotz dieser Konzentration auf ein Leitthema sollte auch bei dieser Veranstaltung Raum für all jene Fragen und Themen sein, die allgemein mit den Intentionen des Projekts ‘Melammu’ verknüpft sind. So war auch dieser Kongreß für alle allgemeineren Fragen, die mit den Themenbereichen des Kulturtransfers und Kulturaustauschs sowie des von Babylonien und Assyrien ausgehenden kulturellen und zivilisatorischen Erbes verbunden sind, offen. Alle Referate waren bewußt so angelegt, daß für zahlreiche Diskussionen und den interdisziplinären Fachaustausch genügend Raum blieb. Deshalb wurden die Pausen gezielt großzügig bemessen, weil sich erfahrungsgemäß hier besondere Gelegenheiten zur vertiefenden Diskussion boten. Auch ein im Rahmen des Kongresses veranstalteter gemeinsamer Ausflug zu den Iwein-Fresken auf Schloß Rodenegg – ein Beispiel für mittelalterliche Rezeption fremder Welten – war unter diesem Gesichtspunkt zu betrachten. Er sollte nicht nur willkommene Abwechslung, sondern auch eine gelöste Atmosphäre des anregenden Austausches bieten. Von den insgesamt 38 gehaltenen Referaten sind im vorliegenden Band 29 zur Drucklegung gelangt. Allen Referenten, die durch ihre Beiträge zu einer fruchtbaren Diskussion in einem interdisziplinären Kontext beigetragen haben, sei an dieser Stelle nochmals ausdrücklich gedankt.

! !

I. WIRTSCHAFTSTHEORIE/ECONOMIC THEORY

KONKURRIERENDE THEORIEN DER GELDENTSTEHUNG: 1 EINIGE ÜBERLEGUNGEN ZUR VEREINBARKEIT Engelbert Theurl 1. Problemstellung Die Erklärung der Entstehung und der Entwicklung von Geld sind herausfordernde Fragestellungen der Geldtheorie und Geldgeschichte. Beginnend mit Aristoteles wurden von Autoren wie Adam Smith, James Steuart, Carl Menger, Georg Friedrich Knapp, John Maynard Keynes, Milton Friedman, Bernhard Laum, Josef Schumpeter sowie Karl Brunner – um nur einige wichtige Vertreter zu nennen – unterschiedliche Erklärungsansätze angeboten. Zum Teil lassen sich die Unterschiede in den Theorien auf unterschiedliche Abgrenzungen von Geld und seine Funktionen, sowie auf eine unzureichende Trennung von Geldentstehung einerseits und den Geldfunktionen (Geldgebrauch) andererseits zurückführen. So stellen beispielsweise einzelne Autoren die Geldentstehung (z.B. die Schaffung von Buchgeld über Kreditvergabe) als einen eher technischen Vorgang in den Vordergrund ihrer Betrachtungen, während andere Autoren die Geldentstehung systemfunktionalistisch im Luhmann’schen Sinne (Vgl. Luhmann, 1994) begreifen. Innerhalb der verschiedenen ökonomischen Ansätze zur Geldentstehung und –entwicklung hat die Transaktionskostentheorie der Geldentstehung in den letzten Jahrzehnten ohne Zweifel den größten Einfluss ausgeübt. Die Verwendung von Geld senkt die Kosten des wirtschaftlichen Verkehrs. Diese Theorierichtung hat ihren Ausgangspunkt im wesentlichen in der Rolle von Geld als Tauschmittel, während die Funktionen der Wertaufbewahrung und der Recheneinheit nur peripher behandelt werden. Diese Theorie der Geldentstehung kann dogmengeschichtlich in einen breiteren Theoriestrang innerhalb der Ökonomik eingeordnet werden, nämlich in die Neue Institutionelle Ökonomik, wenngleich die Entwicklung der Transaktionskostentheorie des Geldes weitgehend unabhängig erfolgte. Das Forschungsprogramm der Neue Institutionenökonomik versucht mit Hilfe von Transaktionskosten die Herausbildung und die Dynamik von Institutionen zu erklären. Sie versucht damit eine generelle Theorie der Entstehung und Wirkung von Institutionen anzubieten. Soziale und ökonomische Institutionen wie der Staat, Geschäftspraktiken, ethische Spielregeln in ökonomischen Beziehungen, etc. werden in dieser verallgemeinerten Theorie als Mechanismen gesehen, um die Kosten im Austausch von Gütern, Ressourcen und ökonomischen Rechten zu reduzieren und damit zu einer Wohlfahrtssteigerung beizutragen. Die Neue Institutionenökonomik ist sich aber insbesondere in ihren neueren Arbeiten (Vgl. beispielsweise North 1992, S. 43 ff. ) bewusst, dass die Wahrscheinlichkeit der Herausbildung von transaktionskostenminimalen Arrangements im institutionellen Design sehr entscheidend von den Rahmenbedingungen der Institutionenwahl abhängt. Sie betont im weiteren auch die Bedeutung informeller 1 Ich bedanke mich bei Theresia Theurl für wertvolle Anregungen.

34

Engelbert Theurl

Institutionen als Alternative und/oder Ergänzung zu formellen Institutionen und erkennt auch die Bedeutung der Transaktionsatmosphäre (z.B. die Rolle von Vertrauen zwischen den Transaktionspartnern) für die Herausbildung und Funktionsfähigkeit von Transaktionsregimen. Letztlich hat damit im Zuge der Entwicklung der Neuen Institutionenökonomik eine Erweiterung des Betrachtungsrahmens stattgefunden. Dies macht es besonders reizvoll, die Transaktionskostentheorie des Geldes mit Theorien zu konfrontieren, welche Geld aus anderen Ursachenkonstellationen heraus zu erklären versuchen. Eine solche vermeintlich konträre Position wurde von Bernhard Laum in seinem 1924 erschienenen Buch „Heiliges Geld - Eine historische Untersuchung über den sakralen Ursprung des Geldes“ formuliert. Laum betont in seiner Analyse besonders den sakralen Ursprung des Geldes. In den nachfolgenden Ausführungen sollen 1. die historische Entwicklung der Transaktionskostentheorie des Geldes nachgezeichnet und wesentliche Theorieelemente dargestellt werden, 2. der Erklärungsansatz von Berhard Laum vorgestellt werden und schließlich 3. analysiert werden, inwieweit eine Versöhnung des Transaktionskostenansatzes des Geldes mit dem Erklärungsansatz von Bernhard Laum möglich ist. 2. Ein Abriss der Entwicklung der Transaktionskostentheorie des Geldes Die heute in den Wirtschaftswissenschaften dominierende Sicht der Geldentstehung, nämlich die Transaktionskostentheorie des Geldes, hat ihren Ausgangspunkt bei Aristoteles. Er formuliert im 9. Kapitel des Ersten Buches der Politik: „Der Tauschhandel kann bei allen Dingen stattfinden und hat zuerst mit dem was naturgemäß ist, angefangen, in dem die Menschen von der einen Art von Produkten mehr, von der anderen weniger hatten, als sie brauchten: (...) Ein solcher Tauschhandel (....) ist weder gegen die Natur, noch ist er eine Art des Gelderwerbs. Er diente zur Ergänzung und Vervollständigung des natürlichen Selbstgenügens. Es lag aber nahe, dass sich aus ihm jene Kunst des Gelderwerbes entwickelte. Als nämlich die durch die Einfuhr des Bedarfs und Ausfuhr des Überflusses gewonnene Hilfe sich nach immer ferneren Ländern ausdehnte, musste notwendig das Geld in Gebrauch kommen, da nicht alle Naturalbedürfnisse leicht zu transportieren waren. Man kam daher überein, behufs Tausches gegenseitig eine Sache zu geben und anzunehmen, die selbst zu den nützlichen Dingen zählt und bei ihrer Verwendung im Verkehr am leichtesten zu handhaben war, wie es z.B. Eisen, Silber und dergleichen ist. Zuerst bestimmte man sie einfach nach Größe und Gewicht, schließlich aber drückte man ihr ein Zeichen auf, um sich das Messen und Wägen zu ersparen, indem die Prägung als Zeichen ihrer Quantität galt“ (Arist. pol. 1257a1540). Die Tauschtheorie des Geldes bei Aristoteles ist damit eingebettet in die wichtige Unterscheidung zwischen dem naturgemäßen Ergänzungshandel und dem naturfremden Kapitalerwerbswesen. Aristoteles betont in seiner Gelderklärung in erster Linie die Transportkosten im Rahmen des Exporthandels. Die Senkung der

Konkurrierende Theorien der Geldentstehung

35

Transaktionskosten in der Geldverwendung wird durch die Prägung und damit die Fixierung des Geldwertes erreicht. Adam Smith führt den Gedankengang von Aristoteles weiter und modifiziert ihn entsprechend. „Als jedoch die Arbeitsteilung eingesetzt hatte, muss dieses Tauschvermögen entschieden behindert und gehemmt worden sein. (...). Der Schlachter hat mehr Fleisch in seinem Laden, als er selbst konsumieren kann, und der Brauer und der Bäcker möchten gern einen Teil davon kaufen. Aber sie haben nichts zum Tausch anzubieten als die verschiedenen Produkte ihrer Gewerbe.(...) Um die Unbequemlichkeit einer solchen Situation zu vermeiden, wird jeder kluge Mensch zu allen Zeiten (...) natürlich bemüht gewesen sein, sich so einzurichten, dass er außer dem besonderen Produkt seines eigenen Gewerbes noch eine bestimmte Menge der einen oder anderen Ware bereithielt, von der er annehmen konnte, dass nur wenige Leute sie im Tausch gegen das Produkt ihres Gewerbes zurückweisen würden. Mancherlei verschiedene Waren sind vermutlich nacheinander ins Auge gefasst und zu diesem Zweck verwendet worden. (...) Indessen scheint es, dass die Menschen in allen Ländern durch unwiderstehliche Gründe dahin gebracht wurden, für diesen Zweck den Metallen vor jeder anderen Ware den Vorzug zu geben. (...) Die Unbequemlichkeit und Schwierigkeit, jene Metalle mit Genauigkeit zu wägen, gab die Veranlassung zur Verfertigung von Münzen (...). Auf diese Weise ist das Geld bei allen zivilisierten Nationen das universelle Handelsinstrument geworden, durch dessen Mittlerfunktion Güter aller Art gekauft und verkauft oder gegeneinander ausgetauscht werden“ (Smith, 1776, S. 22 - 28). Indem A. Smith die Arbeitsteilung betont, stellt er das Koinzidenzproblem im Rahmen des Realtausches als ubiquitäres Problem dar. Klarer als dies bei Aristoteles der Fall ist, löst A. Smith die Tauschtheorie des Geldes von ihren historischen Zusammenhängen und trägt damit zur Enthistorisierung der Theorie bei. Im Rahmen der österreichischen Schule der Nationalökonomik hat sich insbesondere Carl Menger mit der Geldentstehung auseinander gesetzt. Ähnlich wie Aristoteles und A. Smith betont Menger die Erfindung des Geldes als Medium der Tauscherleichterung. Der spezielle Aspekt der Menger’schen Theorie liegt jedoch in der Betonung der besonderen Form der Geldherausbildung. Menger betont die evolutorische Entwicklung des Geldes und sieht Geld als unintendiertes Ergebnis menschlichen Handelns. Geld wird „als sociale Institution, als das unreflectirte Ergebnis, als die unbeabsichtigte Resultante specifischer Bestrebungen der Mitglieder einer Gesellschaft“ (Menger, 1909, S. 555) angesehen. Die Theorie von Menger wendet sich damit im engeren Sinne gegen jene Erklärungsansätze der Geldentstehung, die „Geld als intendiertes Geschöpf der Rechtsordnung“ begreifen. Damit ist insbesondere die „Staatstheorie der Geldentstehung“ bei Gustav Knapp angesprochen. Seine Theorie der sozialen Evolution von Institutionen ist damit aber auch als Gegenentwurf zu den verschiedenen Varianten einer rationalistischen oder konstruktivistischen Ordnungstheorie, wie sie einerseits in der von Descartes und Voltaire inspirierten französischen Aufklärungs- und Staatsphilosophie formuliert wurde und wie sie andererseits für die deutsche Philosophie des Idealismus, dem Marxismus aber auch die in der Tradition von Hobbes stehenden fiktiven Vertragstheorien, einschließlich des konstruktivistischen Utilitarismus, charakteristisch ist. Diese Sichtweise lässt sich anschaulich mit dem

36

Engelbert Theurl

rakteristisch ist. Diese Sichtweise lässt sich anschaulich mit dem folgenden Zitat Menger’s untermauern. „Die sogen. socialen Organismen vermögen dagegen schlechterdings nicht als das Product rein mechanischer Kraftwirkungen aufgefasst und interpretiert zu werden; sie sind vielmehr das Ergebnis menschlicher Bestrebungen, der Bestrebungen denkender, fühlender, handelnder Menschen. Wenn demnach von einem „organischen Ursprunge“ der Socialgebilde, oder, richtiger gesagt, eines Theiles dieser Letzteren überhaupt die Rede sein kann, so vermag sich dies lediglich auf den Umstand zu beziehen, dass ein Theil der Socialphänomene das Ergebnis des auf ihre Begründung gerichteten Gemeinwillens (der Uebereinkünfte, der positiven Gesetzgebung u. s. f.), ein anderer Theil dagegen das unfreflectirte Ergebnis der auf die Erreichung wesentlicher individueller Zwecke gerichteten menschlichen Bestrebungen (die unbeabsichtigten Resultante dieser Letzteren) ist. (Menger 1883, S. 145) Mit der Gelderklärung der Österreichischen Schule der Nationalökonomik wird der Weg, eine allgemeine Theorie der Geldentstehung zu formulieren, explizit beschritten. Diese Stoßrichtung wurde in den letzten 40 Jahren weiter verfolgt. Beispielhaft sei auf Darstellung bei Brunner/Meltzer eingegangen (Brunner/ Meltzer, 1971, S. 784 ff.). Brunner/Meltzer sehen die Nachfrage nach Geld als abgeleitete Nachfrage aus den Funktionen von Geld.2 Sie differenzieren dabei zwischen der Geldnachfrage aus der Perspektive eines einzelnen Transaktors und der gesellschaftlichen Nachfrage nach Geld. Ausgangspunkt der individuellen Nachfrage nach Geld sind die Bedingungen des Gütertauschs. Potentielle Transaktoren auf Märkten haben sehr unvollständige Informationen über Güterqualitäten, über den Ort und die Identität anderer Transaktoren, über die Streuung von Preisen. Die Verwendung von Geld stellt eine Möglichkeit dar, diese Unsicherheit zu reduzieren, den Gütertausch zu erleichtern und damit auszuweiten. Eine Möglichkeit besteht in der Einführung von Geld als Recheneinheit. Sie reduziert die Kosten des Gütervergleichs in ähnlicher Weise wie dies durch die Einführung von einheitlichen Maßeinheiten (Gewicht, Länge, Volumen, etc.) der Fall ist. Ein zweiter Weg der Reduktion von Unsicherheit besteht in der Tauschmittelfunktion des Geldes. Ein Individuum, das über eine Anfangsausstattung an Ressourcen verfügt, hat mehrere Möglichkeiten diese Anfangsausstattung in ein bevorzugtes 2

Die Geldnachfragetheorie bei Brunner/Meltzer baut primär auf der Geldfunktion „Tauschmedium“ auf. Diese Argumentation ist nicht unumstritten. So kann die transaktionskostensenkende Funktion des Geldes auch an der Rolle von Geld bei der Synchronisation von Einzahlungen und Auszahlungen festgemacht werden. Geld wird dann als eine zeitliche Verschiebung der Kaufkraft interpretiert. Allerdings erscheint klar, dass sich aus Optimalitätskalkülen unterschiedliche Assets ergeben werden, je nachdem welche Geldfunktion betont wird. Erweitert man die Tauschtheorie des Geldes um die intertemporale Dimension, dann kann damit direkt die Wertaufbewahrungsfunktion des Geldes angesprochen werden. Die Funktion der Wertaufbewahrung baut unmittelbar auf Spar- und Investitionsvorgängen auf. Intertemporale Transformationsmedien mit niedrigen Transaktionskosten sind damit ein wichtiges Stimulans für den Produktionsumweg Investition. Wirtschaftshistorisch begegnen wir mit dem Beginn des Ackerbaues zum ersten Mal dem Problem Produktionen vorzufinanzieren. Während die Finanzierung bei den Viehzüchtern noch aus der Vorleistung der Natur erfolgte, musste der Bauer mindestens ein halbes Jahr auf die Ernte warten.

Konkurrierende Theorien der Geldentstehung

37

Güterbündel zu transformieren: Produktion, Konsum, Tausch. Daneben hat der Transaktor noch zwei weitere Möglichkeiten. Er kann erstens die Ressourcen dafür verwenden, um seinen Informationsstand bezüglich des Gütertausches zu verbessern und er kann zweitens Ressourcen verwenden um Ketten von Realtauschakten zu organisieren. Ein rationales Individuum wird in der Wahl des optimalen Konsumplans versuchen, die optimale Sequenz von Transaktionen und das optimale Niveau an Information zu finden. Das optimale Ausmaß an Information ist dann gegeben, wenn der Grenznutzen des Konsumverzichts durch die bei der Informationssuche eingesetzten Ressourcen dem Grenznutzen der Informationsverbesserung entspricht. Das Informationsoptimum hängt von den Eigenschaften der getauschten Güter und von den Tauschkonditionen ab. In der Geldgeschichte hat es zahlreiche Entwicklungsstadien gegeben, in denen es zu einer Transformation der Geldordnung durch weitreichende Veränderungen in den Tauschmedien gekommen ist. Dahinter standen veränderte Ergebnisse des skizzierten Optimalitätskalküls. Die Herausbildung des Münzwesens ist eines der ältesten Beispiele dafür. Die Einführung von Kreditkarten in unterschiedlichen Formen ist eine neuere Ausprägung. Ein allgemein akzeptiertes Tauschmedium wie Geld ist in der Lage, die Informationskosten von Gütertransaktionen zu senken. Daher stellt Geld für die Individuen ein Substitut für den Ressourceneinsatz in die Informationssuche dar. Die Verwendung von Geld erhöht die Wohlfahrt der Geldnutzer, da die Unsicherheit reduziert wird. Dies erfolgt über eine Verkürzung der Transaktionsketten für Güter, über eine Reduzierung der Preisvarianz und über die Freisetzung der Ressourcen für andere Zwecke. Diese einzelwirtschaftlichen Vorteile werden um Vorteile aus gesellschaftlicher Sicht ergänzt. „The use of money encourages the development of the market system by lowering the costs of aquiring information and transacting. With the expansion of the market, opportunities increase for professional middlemen and specialized traders to exploit the partial and incomplete distribution of information about particular commodities. Specialized traders substitute for a wider and more general distribution of information. The use of money also affects the intertemporal allocation of resources. Deferred payments, borrowing, credit and the payment system expand when a standardized asset with wellknown properties becomes available. The reason is that transactors become more willing to enter into contracts calling for deferred payments. The magnitude of the net social productivity of money is not constant but varies with the degree of uncertainty about market conditions, including exchange ratios and the quality of goods. (…) Our analysis implies that the demand for mediums of exchange is higher in periods of rapid change than in periods of gradual or relatively steady change” (Brunner/Meltzer, 1971, S. 800). In einer stationären Welt oder in einer sich kontinuierlich verändernden Welt (steady state) sind keine Anpassungen notwendig oder die Anpassungspfade bekannt. Die Hauptgründe dafür, dass bestimmte Austauschmedien Informationskostenvorteile haben, sind daher gering. Dies ist in einer sich nicht vorhersehbar ändernden Welt gänzlich anders. Brunner/Meltzer machen dies am Beispiel der Hyperinflation deutlich. Eine Hyperinflation verändert das Optimalitätskalkül der

38

Engelbert Theurl

Geldhaltung, da die Tauschkonditionen sich beschleunigt verändern und die Unsicherheit steigt. Dies erhöht die Grenzproduktivität des Geldes. Andererseits erhöht aber die Inflation auch die Grenzkosten der Geldhaltung. Transaktoren haben daher einen Anreiz – unter Umgehung von Geld – Transaktionsketten zu suchen, innerhalb derer die „Inflationssteuer“ vermieden werden kann, auch wenn dadurch höhere Transaktionskosten in Kauf genommen werden müssen. Aufbauend auf dieser Theorie gibt es keinen zwingenden Grund, dass eine Gesellschaft zu einem einzigen Austauschmedium konvergiert. Grundsätzlich können in Abhängigkeit von den Austauschbedingungen und dem Ausmaß der Unsicherheit verschiedene Assets als Austauschmedium herangezogen werden. Dem steht allerdings entgegen, dass Geld Netzwerkexternalitäten aufweist. Von solchen spricht man generell dann, wenn der Nutzen einer Person aus dem Konsum eines Gutes von der Zahl der anderen Konsumenten abhängt. Aus dieser Eigenschaft folgt, dass eine möglichst weite Verbreitung von Geld die wohlfahrtssteigernde Wirkung der Verwendung eines Austauschmediums maximiert. Sie kann normativ auch ein Grund dafür sein, dass dem Staat wesentliche Funktionen in der Ordnung des Geldwesens zuerkannt werden. 3. Die Erklärung der Geldentstehung bei Bernhard Laum Der Darstellung des Erklärungsansatzes von Bernhard Laum (in der Folge BL) sind einige einleitende Bemerkungen voranzustellen. Das Buch ist ein Dokument der Auseinandersetzung zwischen Vertretern der Historischen Schule der Nationalökonomie (Hildebrand, Roscher, Knies) und der „rein theoretischen Ökonomik“, wie sie insbesondere in der 2. Hälfte des 19. Jahrhunderts in Deutschland geführt wurde. Konkret wendet sich BL gegen die Theorie der Geldentstehung von G. F. Knapp (Knapp, 1905, 1. Aufl.). Dazu BL wörtlich: „In der Wissenschaft vom Gelde herrscht die Theorie. Seitdem es eine rein theoretische Oekonomik gibt, also seit David Ricardo, ist gerade das Geld ein bevorzugter Gegenstand der theoretischen Forschung. Die Berücksichtigung historischer Geldformen trat mehr und mehr in den Hintergrund. Natürlich bilden die Vertreter der historischen Schule der Nationalökonomie (Bruno Hildebrand, Roscher und Knies) eine Ausnahme, sie haben die geschichtlichen Tatsachen im weitesten Umfange gesammelt und verwertet (vor allem Roscher); aber die historische Betrachtung des Geldes war nur eine Episode, die Tendenz zur Theorie wirkt weiter. Gerade in der Gegenwart ist die Emanzipation von den Tatsachen größer als je. Höhepunkt der rein theoretischen Einstellung ist das bekannte Buch von G. F: Knapp, Staatliche Theorie des Geldes, 4. Aufl. 1923. Knapp steht auf dem Standpunkt, dass die Form, in der das Geld historisch erscheint, nicht entscheidend sei für die Erkenntnis seines Wesens. Werkzeug der Wesenserkenntnis ist nach ihm lediglich das logische Denken; was auf logischem Wege als Geld erkannt wird, ist Geld, ob es in der Wirklichkeit vorhanden war, ist oder sein wird, ist Nebensache; denn nur ein Bruchteil der begrifflich möglichen Formen gelangt zur Verkörperung in der Erscheinungswelt. Das vorliegende Buch steht methodisch in Opposition zu den dort ausgesprochenen

Konkurrierende Theorien der Geldentstehung

39

Grundsätzen. Von den Tatsachen, von den historischen Geldformen ausgehend sucht dies Buch die Erkenntnis des Wesens des Geldes zu fördern“ (Laum 1924, S. 1). Mit diesem Zitat wird die wissenschaftstheoretische Einordnung des Werkes von BL klar. BL unternimmt nicht den Versuch, eine allgemeine Theorie der Geldentstehung zu formulieren, sondern möchte historische Erkenntnisse mit theoretisch-ökonomischen Konzepten verknüpfen. Im folgenden wird – in der gebotenen Kürze – versucht, die wesentlichen Erklärungselemente bei BL nachzuzeichnen. „Historischer“ Ausgangspunkt der Betrachtung ist die homerische Gesellschaft. In dieser Gesellschaft identifiziert BL das Rind als wichtigsten Wertmesser (Laum 1924, S. 9). Die Herausbildung dieses Wertmessers ist aber nicht durch den Gütertausch entstanden, sondern entstammt dem religiöskulturellen Bereich. Gegen die Herleitung des Wertmessers „Rind“ aus dem Tausch werden mehrere Einwände ins Treffen geführt. Der Rinderbesitz war einerseits auf die Adeligen beschränkt. Zudem erfüllt das Rind die Voraussetzung der Teilbarkeit nicht. Damit war eine wesentliche Voraussetzung für die soziale Akzeptanz dieses Gutes als allgemeines Tauschmittel im Binnenhandel durch langdauernde und stetige Praxis nicht erfüllt. Ähnliches gilt für den überregionalen Handel (Seehandel). Das Rind ist in diesem Zusammenhang ein Tauschgut neben anderen, erfüllt aber nicht die Funktion eines allgemeinen Tauschmittels. BL untermauert diese Argumentation noch damit, dass er auf das niedrige Niveau der Tauschbeziehungen in der homerischen Gesellschaft im allgemeinen verweist. Er geht vornehmlich von geschlossenen Hauswirtschaften mit selektivem Ergänzungshandel (Metalle, Luxusgüter) aus, ein Bild, das durch die neuere Forschung unterstützt wird (Vgl. beispielsweise Ulf 1990, S. 189). Die Herausbildung des Wertmessers „Rind“ leitet sich aus dem Opfer ab. BL interpretiert das Opfer als Tauschbeziehung zwischen Menschen und Göttern. Die Auswahl eines geeigneten Opfertieres stellt für ihn einen Akt wirtschaftlichen Denkens dar. „Tiere derselben Gattung werden miteinander verglichen und aus dem Vergleich ihrer Merkmale ein Normaltypus geschaffen, der nun als qualitative Norm gilt. Es ist ein großer Schritt vorwärts von der rein gefühlsbetonten subjektiven Güterverschwendung im frühen Kult: dort Gütermassen, nicht in Beziehung gesetzt und gewertet, als Opfergaben, hier für die Opfergaben auf wertendes Urteil gebaute, festumrissene Normen, die sich in den Kultordnungen immer mehr objektivieren. Ich glaube schon hier den allgemeinen Satz aussprechen zu dürfen, dass im Kultus, nicht im Handel, der keinerlei Typisierung kennt, sondern rein individuell ist, die Güterwertung ihren Anfang genommen hat. Jedenfalls ist durch die Festsetzung des Opferritus zuerst der Normaltypus eines Gutes und damit die Möglichkeit der Stellvertretung geschaffen worden. Diese Entwicklung ist bereits in der homerischen Zeit so gut wie abgeschlossen“ (Laum 1924, S. 27). Die Übertragung dieses im Kult herausgebildeten Wertmessers in das profane Leben erfolgt auf verschiedenen Wegen. Im Zuge der gesellschaftlichen Ausdifferenzierung entstanden Priesterkasten, die ihre Leistungen nicht unentgeltlich zur Verfügung stellten, sondern vielfach ihre Monopolstellung ausnützten. „Womit wird nun die Dienstleistung der Priester entgolten, welches Gut dient als Zahlungs-

40

Engelbert Theurl

mittel? Das Rind! Und zwar ist das Rind Opferlohn für die Priester, weil es Opfergabe für die Götter war. (...) Das für uns wichtige Ergebnis ist, dass auf diesem Wege die für den kultischen Verkehr geschaffene Norm in den privaten Verkehr übergeht. Das Gut, das im Kult als Entgeltmittel dient, wird auch im privaten Verkehr als solches anerkannt und verwendet“ (Laum 1924, S. 43). Einen zweiten Weg der Übertragung dieses Wertmessers sieht BL in den gemeinsamen öffentlichen Mahlzeiten. Diese stellen in der homerischen Gesellschaft für den Oikosherrn (Basileus) eine wichtige Möglichkeit und Verpflichtung, dar Gruppen, die in unterschiedlicher Weise zu seinem Wohlstand beigetragen haben, zu belohnen. Diese Gruppen können als in konzentrischen Kreisen angeordnet gesehen werden, die in abgestufter Weise (in der Jagd, im Krieg, auf Beutezügen) zu einem Gemeinschaftsgut beitragen. Es sind 1. die Angehörigen des Oikos, 2. die Gruppe der Hetairoi, die eng und in persönlichem Verhältnis an den Anführer gebunden sind, 3. die Basilees um einen Oberbasileus, 4. die Geronten bzw. der Demos, und 5. eine geringe Zahl an Personen, die nicht dem eigenen Ethnos angehören. (Vgl. Ulf 1990, S. 191). In diesen öffentlichen Mahlzeiten sieht BL den Ursprung der öffentlichen Finanzwirtschaft, sie stellen die einfachste Form des öffentlichen Haushalts dar. „Aus diesem Grunde sind die Formen, die sich hier bilden, auch für die Entstehung des Geldes von großer Bedeutung. Der König ist die Verkörperung des Staates. Sein persönlicher Haushalt ist vom staatlichen noch nicht geschieden. (...) Anteilnahme am Mahl ist Dienstentlohnung schlechthin. (...) Das Stück Braten ist also Entgeltmittel für dem Staate geleistete Arbeit“ (Laum 1924, S. 48/49). Wichtig erscheint in diesem Zusammenhang der Hinweis, dass das Fleisch an der Stelle, wo das Tier geopfert worden war, verzehrt wurde. Dies hat mit dem Charakter der gemeinsamen öffentlichen Mahlzeit zu tun. Es verhindert aber, dass der Anteil an Fleisch ein allgemeines Zahlungsmittel für ökonomische Transaktionen werden konnte. Auch der Übergang vom Wertmesser „Naturalopfer“ zu „symbolischen“ Wertmessern (z.B. Münzen) wird von BL nicht mit Argumenten der Transaktionskostensenkung, sondern aus dem kulturell-religiösen Raum heraus erklärt. BL wählt dazu die Institution der „Stellvertretung“. Dies beschreibt Laum anschaulich am Beispiel der Entstehung des Münzgeldes. Eine Vorstufe, eine Vorbedingung für die Entstehung der Münze ist für ihn Idee der Stellvertretung, die ihrerseits in dem Vertrauen wurzelt, dass ein Sachobjekt durch ein Abbild ersetzt werden könnte. Es handelt sich um eine Überzeugung, die letztlich in magischen Vorstellungen gründet. Es ist daher nicht verwunderlich, dass diese Ersatzidee gerade im Opferwesen eine große Rolle spielt. BL interessiert nicht die Ablösung eines Lebewesens durch ein anderes, z. B. der Ersatz des Menschen durch ein Tieropfer. Wichtig für ihn jene Form der Stellvertretung, bei der ein lebendes Wesen durch ein totes Ding ersetzt wird, das eine Nachbildung des Originals darstellt. Im Kult hat der Ersatz des wertvollen Realgutes durch das wertlose Symbol seinen Ursprung und seinen Bedeutungszusammenhang; denn in der Magie gibt es für BL keinen Unterschied zwischen Objekt und Nachbildung: Realgut und Symbol sind in Wirkung und Geltung identisch. Erst die Übertragung der sakralen Formen

Konkurrierende Theorien der Geldentstehung

41

in den profanen Verkehr hat den Streit um das substantielle und funktionale Element des Geldes hervorgerufen (Laum 1924, S. 81 ff.). Zusammenfassend zieht BL folgende Schlussfolgerungen aus seinen, auf induktivem Wege gewonnenen, Erkenntnissen: ! Der Ursprung des Geldes liegt im Kultus und nicht im profanen Tausch. ! Das Geld ist ein Geschöpf der Rechtsordnung, wobei eine Übertragung aus der sakralen Rechtsordnung in die profane Rechtsordnung stattgefunden hat. ! Die Zahlungsmitteleigenschaft des Geldes ist historisch älter als die Tauschmittelfunktion, weil Tausch kein verbreitetes System der Güterzuteilung war. ! Die Funktion des Geldes als Wertmesser ist in der religiös-sakralen Sphäre entstanden. ! Der Staat ist deswegen Schöpfer des Geldes geworden, weil er auch Träger der religiös sakralen Sphäre war. 4. Zur Vereinbarkeit der beiden Ansätze 4.1. Ad hoc Vermittlungsversuche Die vorgestellten Ansätze der Geldentstehung erscheinen prima vista unversöhnlich. Es erscheint daher besonders reizvoll, Überlegungen anzustellen, in welcher Verbindung die beiden Theorieansätze zueinander stehen, bzw. ob eventuell eine Verknüpfung der beiden Ansätze möglich erscheint. Diesbezügliche Überlegungen können m. E. auf unterschiedlichen Ebenen ansetzen, die in der Folge skizziert werden sollen. Eine erste Strategie könnte darin liegen, den Konflikt zwischen den beiden Ansätzen mit dem Hinweis aufzulösen, dass ihre Erkenntnisobjekte unterschiedlich sind. Während BL eine historische Erklärung für die Geldentstehung vorlegt, bietet die Transaktionskostentheorie eine allgemeine ahistorische Erklärungstheorie der Geldentstehung an. BL plädiert selbst für diese Form der Auflösung des Konfliktes, wenn er schreibt: „Der Theoretiker nimmt für seine deduktiven Sätze, weil ihre Ergebnisse auf „exaktem“ Wege gewonnen wurden, allgemeine Gültigkeit in Anspruch. Der Historiker ist bescheidener. Er wird nicht behaupten, dass Mengers Theorie nie und nirgends in der Realität verwirklicht sein könne (wäre der „homo oeconomicus“ der Gegenwart vor 3000 Jahren auf der Welt erschienen, er würde das Geld sicherlich Mengers rationalistischen Grundsätzen entsprechend erfunden haben.). Nur das behaupte ich, dass der historische Ursprung des Geldes der Theorie nicht entspricht. Ob dagegen die Ausbildung des Geldes überhaupt so und nicht anders vor sich gegangen sein müsse, wird nicht behauptet“ (Laum 1924, S. 160). Diese Versöhnung ist m. E. nicht überzeugend und aus dem Theoriestand der damaligen Zeit heraus verständlich. Entscheidend ist in diesem Zusammenhang der Erklärungsanspruch allgemeiner Theorien der Geldentstehung. Verstehen sich diese Theorien als Gedankenexperimente, wie unter rationalen Individuen Geld

42

Engelbert Theurl

entstehen würde, dann ist der Widerspruch zu historischen Formen der Geldentstehung tatsächlich nicht gegeben. Dies ist jedoch zu relativieren, wenn diese Theorien dazu herangezogen werden, reale Erscheinungsformen der Geldentstehung zu erklären. Diese Theorien fungieren dann als theoretisches Modell, aus dem Hypothesen für die empirische Überprüfung abgeleitet werden. Ob hier eine Versöhnung möglich ist, hängt meines Erachtens wesentlich mit dem Erklärungsanspruch zusammen, der an Theorien gestellt wird. Wissenschaftstheoretisch lassen sich diesbezüglich unterschiedliche Positionen unterscheiden: ! Ökonomische Theorien sind a priori empirisch gültig (Apriorimus, insbesondere vertreten von vielen Mitgliedern der Österreichischen Schule der Nationalökonomie).3) ! Ökonomische Theorien sind empirisch nur gültig, wenn alle Bestandteile einer empirischen Überprüfung standhalten (Methodologische Position des Kritischen Rationalismus). ! Ökonomische Theorien sind auch gültig, wenn sie unüberprüfbare Annahmen enthalten.4) ! Ökonomische Theorien sind bei guter Prognoseleistung empirisch gültig (Instrumentalismus-These).5) Unvereinbar erscheinen die Transaktionstheorie des Geldes und der Ansatz von Laum insbesondere dann, wenn man die beiden ersten Positionen vertritt. Eine zweite Strategie der Vereinbarkeit könnte darin liegen, den Anfang des Prozesses der Herausbildung von Geld nicht system-funktionalistisch zu erklären. Eine Variante dieser Denkrichtung stellt die Theorie der „Spontanen Ordnung“ bei Hayek und anderen Vertretern der österreichischen Schule der Nationalökonomie dar (Vgl. beispielsweise Hayek 1973). Hayek wendet sich gegen den Ausschließlichkeitsanspruch des konstruktivistischen Rationalismus bei der Erklärung der Entstehung von Institutionen. „While the rules on which a spontaneous order rests, may also be of spontaneous origin, this need not always be the case ... and at 3

4

5

Es wird argumentiert, dass es möglich ist eine allgemeine Lehre vom menschlichen Handeln, die als Praxeologie bezeichnet wird, aus bloßem Denken aufgrund des Ursprungs des Handelns aus der Vernunft zu gewinnen. Wegen dieser Vernunftbegründung des menschlichen Handelns seien die durch widerpruch- und fehlerfreies Denken gewonnenen Sätze der Praxeologie nicht nur vollkommen sicher und unbestreitbar wie die Sätze der Mathematik; sie beziehen sich mit all ihrer Sicherheit und Unbestreitbarkeit auf das Handeln, wie es im Leben und in der Wirklichkeit geübt wird. Die Praxeologie vermittelt Wissen von den wirklichen Dingen. Diese Position wird z.B. von der dialektisch-hermeneutisch vorgehenden Frankfurter Schule vertreten. Sozialwissenschaftliche Theorien sollen nicht auf den Bereich direkt überprüfbarer Aussagen reduziert werden. In den Wirtschaftswissenschaften wird diese Position vor allem von M. Friedman vertreten. Friedman geht davon aus, dass das letzte Ziel einer erklärenden Wissenschaft die Entwicklung einer Theorie ist, „that yields valid and meaningful (i. e. not truistic) predictions about phenomena not yet observed.“ (Friedman 1953, S. 7). Aus dieser Zielbestimmung folgt der genannte instrumentalistische Bewertungsmaßstab für die empirische Geltung von Theorien; die Realitätsnähe der Annahmen, die der jeweiligen Theorie zugrunde liegen, spielt für diesen keine Rolle. „The only relevant test of the validity of a hypothesis is a comparison of its predictions with experience. “ (Friedman 1953, S. 8/9). In general, the more significant the theory, the more unrealistic the assumptions” (Friedman 1953, S. 14).

Konkurrierende Theorien der Geldentstehung

43

it is at least conceivable that the formation of a spontaneous order relies entirely on rules that were deliberately made. The spontaneous character of the resulting order must therefore be distinguished from the spontaneous origin of the rules on which it rests, and it is possible that an order which would still have to be described as spontaneous rests on rules which are entirely the result of deliberate design” (Hayek 1973, S. 45). Dieser Prozess der Herausbildung von Institutionen ohne bewusste Vereinbarung oder Planung lässt zu, dass Institutionen, die in einem anderen Zusammenhang (z.B. in der religiös-sakralen Sphäre) entstanden sind, (zufällig) auf andere Bereiche übertragen werden. Eine dritte Strategie der Vereinbarkeit könnte darin liegen, davon auszugehen, dass die Geldentstehung in nicht ausdifferenzierten Gesellschaften verortet ist. Diese Vorstellung setzt an der Systemtheorie von Luhmann an (Vgl. Luhmann 1994). Luhmann sieht die gesellschaftliche Entwicklung als Ausdifferenzierung von Subsystemen (Religion, Wirtschaft, Wissenschaft, Politik). Diese Subsysteme benötigen, um sich als eigene autopoietische Systeme konstituieren zu können, ein eigenes, nur für sie geltendes Prinzip der Konstitution von Einheit, für das es in ihrer Umwelt keine Entsprechung gibt. Sie folgen eigenen Systemrationalitäten und verwenden eigene Codes der Kommunikation. So gewinnt die Wirtschaft ihre Einheit als autopoietisches, sich selbst produzierendes und reproduzierendes System dadurch, dass sie eine eigene Typik von Elementen verwendet, die nur in der Wirtschaft vorkommen und nur in ihr, das heißt nur in rekursivem Bezug auf andere Elemente desselben Systems ihrer Einheit gewinnen (Vgl. Luhmann 1994, S. 52). Geld hat in einer ausdifferenzierten Wirtschaft demnach nur die Funktion die Transaktionskosten in der Organisation wirtschaftlicher Aktivitäten zu senken. Im Umkehrschluss kann daraus gefolgert werden, dass in nicht ausdifferenzierten Gesellschaften, wie dies die homerische ohne Zweifel war, „Geld“ multiple Funktionen hatte: ! Es diente als Kommunikationsmedium im sakralen Bereich zwischen den Göttern und Menschen durch das Opfer, ! es diente als Kohärenzmedium im labilen, weil wettbewerblich6 und nur eingeschränkt hierarchisch ausgeprägten Verhältnis von Oikosherren und 6

Dazu Ulf: „Die homerischen Epen kennen keinen mit institutionell verankerter Macht ausgestatteten König. Die Figur, die man stets für einen König hielt, ist nur eine der Personen, welche durch besondere Fähigkeiten in verschiedenen Bereichen hervorragen. Jemand ist deshalb Basileus, weil er aufgrund der Summe seiner Qualitäten besser als jeder andere Schwierigkeiten, die den Demos betreffen, zu dessen Vorteil zu lösen imstande ist. Geht er seiner Qualitäten verlustig oder handelt er aus anderem Grund gegen die Interessen des Demos, droht ihm der Verlust der ihm zugestandenen Führungsposition. (...) Jeder der Basilees und diese als Gruppe tendieren dazu, die ihnen aufgrund ihrer Qualitäten zugestandenen Privilegien der Kontrolle durch die Öffentlichkeit zu entziehen und in ihrer Familie zu tradieren. Ist zwar dieser Trend sichtbar, so lässt sich dennoch kein Beispiel erkennen, dass diese Absicht unbestritten erfolgreich gewesen wäre“ Ulf 1990, S. 213/214. “Sie (die Oberbasilees, Ergänzung durch den Verfasser, E. T.) lassen sich daher als big-men interpretieren, die durch persönlichen Einsatz und Leistungsstärke Abhängigkeiten zu erzeugen vermochten, die ihnen diese vergleichsweise labile Einflussnahme auf einen über die eigene Abstammungsgruppe ein großes Stück hinausreichenden Kreis ermöglicht haben. Um diese Anführer gruppieren sich die Hetairoi unterschiedlicher Art, die aber niemals in einer Form der Abhängigkeit erscheinen, die die Aufhebung die-

44

Engelbert Theurl

„Gefolgschaftskreisen“ (Angehörige des Oikos, Hetairoi, Basilees, Geronten, etc. ), ! es diente ursprünglich als Siegespreis7 bei öffentlichen Wettkämpfen, welche allerdings von der religiös-sakralen und politischen Sphäre noch nicht geschieden waren. Aus dem multiplen Funktionszusammenhang von Geld in dieser Gesellschaft können auch Rückschlüsse auf den Entstehungszusammenhang und auf die Entstehungsursachen von Geld gezogen werden. Im Sinne eines systemfunktionalistischen Ansatzes musste Geld multiple Funktionen erfüllen. 4.2.

Der Konnex von Kultur und Ökonomie: ein systematischer Vermittlungsversuch 4.2.1. Der gewählte Zugang Die vierte Stossrichtung ist nicht vollkommen von den bisher dargestellten Vereinbarungsansätzen zu unterscheiden, da sie einzelne Teile davon aufgreift. Sie versucht aber das Problem grundsätzlicher anzugehen. Ausgangspunkt ist dabei die Überlegung, dass im Sinne der Systemtheorie von Luhmann (Vgl. Luhmann 1994) die beiden Erklärungsansätze Transaktionskostentheorie und Opfertheorie des Geldes unterschiedlichen Sphären entstammen, einerseits der ökonomischen Sphäre, andererseits der sakral-kulturellen Sphäre. Dies provoziert die Frage, wie die Ökonomik generell mit den Phänomenen Kultur umgeht. Der Begriff „Kultur“ ist in diesem Zusammenhang relativ umfassend zu verstehen. Kultur sind formlose Institutionen, die der Übertragung von Wissen, Werten und anderen verhaltensrelevanten Faktoren vermittels Lehre und Nachahmung von einer Generation auf die nächste dienen. Die Kultur bietet demnach ein sprachgebundenes begriffliches Bezugssystem zur Verschlüsselung und Deutung von Informationen. „Culture appears to be a mixture of „choices“ from immensely long menus of behavior, though of course in reality individuals become highly conditioned and do not perceive themselves as having free choices” (Jones 1995, S. 271.) Kulturelle Phänomene nehmen in ökonomischen Theorierichtungen unterschiedliche Positionen ein. Auf Jones geht eine Kategorisierung dieser Einstellungen in: ! Cultural Nullity ! Cultural Fixity ! Cultural Reciprocity

7

ses Gefolgschaftsverhältnisses unmöglich oder auch nur besonders schwierig werden ließe“ Ulf 1990, S. 224. Dazu Laum: „Ein wichtiger Teil des Opfers bzw. des Opferfestes war der Wettkampf; bei jedem größeren Feste fanden auch Agone statt. Der Agon ist unmittelbar aus dem Kult erwachsen, ist deshalb ein integrierender Bestandteil des sakralen Aktes, die Kampfspiele hatten religiöse Bedeutung. (...) Da Teilnahme am Wettkampf eine Dienstleistung sakraler Art war, so wird man den vorhergehenden Darlegungen geneigt sein, den Kampfpreis wieder in einem sakralen Gut zu suchen. Das trifft nun in der Tat zu. Bei vielen Agonen erhielt der Sieger einen Anteil am Opfertier als Prämie“ Laum 1924, S. 57.

Konkurrierende Theorien der Geldentstehung

45

zurück (Vgl. Jones 1995, S. 272 ff.). Im folgenden sollen diese drei Grundpositionen kurz charakterisiert und die Auswirkungen auf unsere Fragestellung beleuchtet werden. 4.2.2. Kultur dominiert Ökonomie Das Konzept der „Cultural Fixity“ geht davon aus, „that cultures never change merely that they believe cultures encompass the economy and, insofar, as they change, do so autonomously. This is the usual approach among anthropologists, especially the substantivists, and among many sociologists and historians, though the sociologists probably tend to believe that modernization will eventually win out over tradition. As Clifford Geertz, one of the most voluminous writers in this genre, says, culture is “observable as agriculture”. (…) Whereas Cultural Nullity denies the independence of culture and largely discourages economists from turning their spotlight on it, Cultural Fixity makes the economy a child of culture and excludes the possibility of explaining culture by economic reasoning. In the “fixity” canon, cultures are the living things which dominate and decide; economies essentially arise from them or at lest adapt to them” (Jones 1995, S. 276). Mehr noch, die Wirtschaft ist in die lokale Kultur eingebettet. Im allgemeinen wird in diesem Kontext über die Entstehung und Veränderung von Kultur nicht ausführlich Stellung genommen. Es wird zwar konzediert, dass Kulturen ihre Geschichte haben, aber sie sollen als gegeben angesehen werden und es soll davon ausgegangen werden, dass sich die Wirtschaft an den kulturellen Rahmen anpasst. Akzeptiert man diese Position der Cultural Fixity, dann ist eine Anwendung ökonomischer Theorien, die einen genau spezifizierten ideengeschichtlichen Hintergrund haben, auf Gesellschaften, die eine grundlegend abweichende ideengeschichtliche Basis haben, nicht möglich. Diese Charakterisierung wäre ohne Zweifel für die Transaktionskostentheorie des Geldes gegeben. Sie stellt – wie bereits gezeigt wurde – eine Weiterentwicklung des neoklassischen Paradigmas dar, welches sich zwangsläufig in vielen Bereichen von der griechischen Gedankenwelt – auch des Alltagslebens - unterscheidet. 4.2.3. Ökonomie dominiert Kultur Cultural Nullity ist die Position, die vor allem von Ökonomen in der neoklassischen Tradition und von den Vertretern der Neuen Institutionenökonomik in der Frühphase der Theorieentwicklung vertreten wurde. Die Position hat im wesentlichen zwei Ausprägungen. „The first is that culture, while it may exist „out there“, so to speak, in the realms of anthropology, is extranous and of no economic significance. It may be ignored. One suspects that this position is more forgetful than analytical or even that amnesia is a mere convention, a circular effect of the way many working economists tend to pass over topics that other working economists tacitly agree to pass over, especially if those topics may be presumed to fall under the rubric of some other social science. The second position is little more thoughtful but involves making a rapid judgement that, whereas culture no doubt exists, it lacks analytical substance because it is subordinate to and automatically adjusts to economic requirements, meaning that economists may accord it the merest glance

46

Engelbert Theurl

but then get on with their real task of analysing the economy. These may be different attitudes, strictly speaking, but their practical effect in dismissing the topic is much the same. The doctrinal assumption that all matters can and should be explained within existing theory leads to direct extrusion of culture” (Jones, 1995, S. 273). Zur Position der „Cultural Nullity“ muss letztlich auch der Versuch gezählt werden, kulturelle Phänomene (ausschließlich) ökonomisch zu erklären. Diese Position werde von der Neuen Institutionenökonomik in der Frühphase vertreten. Die Neue Institutionenökonomik (NIÖ) setzt sich mit der systematischen Analyse der Entstehung, des Designs und der Wirkungen von Institutionen auseinander. Sie baut in zentralen Annahmen auf dem Theoriegebäude der Neoklassik auf, versucht aber andererseits auf eine Reihe von Problemen, die von der Neoklassik (bewusst) ausgeblendet werden, Antworten zu geben. Wissenschaftliche Forschungsprogramme lassen sich durch vier Bestandteile abgrenzen: einen harten Kern, der die unverzichtbaren Grundannahmen des Forschungsprogramms umfasst, ein Set von Hilfshypothesen, die den Kern umschließen, eine positive Heuristik, die Forschungswege öffnen soll und eine negative Heuristik, die Forschungswege ausschließen soll. Dieser Ansatz erweist sich als ausgezeichnet geeignet, die Institutionenökonomik in knapper Form zu charakterisieren. Zum harten Kern der NIÖ zählen im Hinblick auf das unterstellte Menschenbild das Individualprinzip und die Rationalitätsannahme. Hinsichtlich der Erklärungsebene folgt die NIÖ dem Prinzip des methodologischen Individualismus. Dies bedeutet, dass soziale Systeme und Phänomene letztlich aus den Eigenschaften und Handlungen von Individuen in Verbindung mit bestimmten Anreizsystemen zu erklären sind. Die NIÖ trifft keine Aussage über das Verhalten genau spezifizierter Individuen sondern stellt das Verhalten von repräsentativen Individuen in den Vordergrund. Daraus resultieren Musteraussagen. Diese Bestandteile des harten Kerns der NIÖ finden sich (bereits) in der Neoklassik. Hinsichtlich der Funktionsbedingungen bzw. –fähigkeit von Institutionen unterscheidet sich die NIÖ jedoch von der Neoklassik. Die NIÖ baut ihre Theorie der Erklärung und Wirkung von Institutionen auf der Existenz positiver Transaktionskosten auf. Unter Transaktionskosten werden dabei alle Kosten subsummiert, die erstens mit der Bereitstellung einer Institution sowie zweitens mit der Nutzung derselben verbunden sind. Es handelt sich dabei vor allem um Kosten öffentlicher Entscheidungen, der Sicherung von Verfügungsrechten bzw. der Aufrechterhaltung von Koordinationsmechanismen. Der zweite Typ von Transaktionskosten besteht insbesondere aus Kosten der direkten Nutzung von Institutionen wie des Marktes, der Unternehmung, öffentlicher Abstimmungsmechanismen, etc… Die Bedeutung der Transaktionskosten für die Gestaltung von Institutionen gipfelt in der Feststellung, dass ohne die Existenz derselben die Auswahl von Institutionen weder möglich noch notwendig sei, da unter Effizienzgesichtspunkten alle Institutionen gleichwertig wären. Der Schutzgürtel der NIÖ enthält Aussagen, die zur Absicherung des skizzierten harten Kerns notwendig sind. Ein Teil dieser Aussagen sind auch Teil der Annahmen des neoklassischen Forschungsprogramms. Eine Erweiterung erfährt das neoklas-

Konkurrierende Theorien der Geldentstehung

47

sische Programm insofern, als Vereinbarungen über institutionelle Arrangements nach dem Konsensprinzip als spezielle Variante des Pareto-Prinzips gesehen werden. Die NIÖ betont im weiteren die Rolle der institutionellen Ausgestaltung für das Funktionieren des Marktmechanismus und für die Optimalität der Bereitstellung von öffentlichen Gütern. Schließlich lässt die NIÖ ein breiteres Spektrum an Verhaltensweisen (Opportunismus, Verfolgung von Eigeninteressen, Gehorsam) von Individuen zu. Hinsichtlich der forschungsleitenden positiven Heuristik steht das Postulat der Trennung von Präferenzen und Restriktionen im Vordergrund. Präferenzen werden in diesem Zusammenhang als relativ stabil und uniform angesehen. Entscheidend für das Verhalten der Individuen und damit für die Existenz sozialer Phänomene ist die Ausgestaltung von Institutionen. Die Wahl des institutionellen Designs (z.B. des Geldwesens) kann wie folgt strukturiert werden. Zur Auswahl stehen mehrere institutionelle Alternativen. Durch Anwendung eines Auswahlkriteriums wird eine bestimmte institutionelle Alternative gewählt. Für den externen Beobachter sind auf Basis der Auswahlkriterien Mustervoraussagen möglich. Wichtig für die Musteraussagen sind die angewendeten Auswahlkriterien. Diese Auswahlkriterien können einerseits explizit durch eine Institution (z.B. eine verfassunggebende Versammlung, eine Regulierungsbehörde) formuliert und angewendet werden. Die Institutionenauswahl kann aber auch evolutorisch8) erfolgen, ohne dass ein Auswahlgremium explizit existiert. In den frühen Theorien der Neuen Institutionenökonomik wird die Institutionenwahl durch das Kriterium der Transaktionseffizienz dominiert: es wird jene institutionelle Alternative gewählt, die die Nettowohlfahrt maximiert.9) Als Nettowohlfahrt wird dabei der Nutzen aus der institutionellen Alternative abzüglich der Kosten für Produktion und Transaktion definiert. Damit die Alternativenwahl tatsächlich durch das Kriterium der Transaktionseffizienz dominiert wird, sind entsprechende Ausgangsbedingungen zu formulieren. Solche sind z.B. die Existenz eines vollkommenen politischen Wettbewerbs, die Maximierung einer sozialen Wohlfahrtsfunktion durch die Entscheidungsträger, die Entscheidung unter dem „Schleier der Ungewissheit“. Von dieser (ausschließlichen) Orientierung an der Minimierung der Transaktionskosten wird auch die Transaktionskostentheorie des Geldes geleitet. Letztlich existiert hier keine explizite Auswahlinstitution in Form einer Organisation (z.B. eine Währungsbehörde). Der Auswahlprozess ergibt sich aus der Interaktion der Wirtschaftssubjekte. Insoweit folgt die Transaktionskostentheorie des Geldes dem Prinzip der Cultural Nullity. Im Rahmen der neueren Entwicklungen in der Neuen Institutionellen Ökonomik hat es allerdings Versuche gegeben, die Kriterien der Institutionenwahl in Abhängigkeit von der Auswahlkonstellation explizit zu machen (Vgl. North 1992):

8 9

Diese Form der Herausbildung von Institutionen wird insbesondere von der Österreichischen Schule der Nationalökonomie betont. Vgl. Menger 1892, Hayek 1973. Vgl. dazu beispielsweise den Erklärungsversuch der mittelalterlichen Wirtschafts- und Gesellschaftsstruktur bei North/Thomas 1973.

48

Engelbert Theurl

So hat die Wahl einer bestimmten institutionellen Alternative, etwa eine bestimmte Form der Zuordnung von Eigentumsrechten in einem bisher gemeinsam genutzten Ressourcenpool (z.B. Weidegebiet, Fischgründe) oder die Wahl eines bestimmten Gutes als „Geld“ nicht nur allokative, sondern auch verteilungspolitische Konsequenzen. Letztere können den Entscheidungsträger direkt treffen/begünstigen. Sie können aber auch über die Verteilung von Gewinnen und Verlusten institutioneller Arrangements auf unterschiedliche Bevölkerungsgruppen zurückwirken und sich in politischen Kosten und Nutzen niederschlagen. ! Im weiteren weisen ökonomische und politikwissenschaftliche Analysen der Funktionsweise von politischen Systemen übereinstimmend auf die Schwierigkeiten hin, Anfangsbedingungen, die eine ausschließliche Orientierung am Kriterium der Allokationseffizienz wahrscheinlich machen, institutionell zu verankern. Unter Verwendung unterschiedlicher Begrifflichkeiten wird daher neben der Transaktionseffizienz ein zweites Auswahlkriterium in die Analyse eingeführt, nämlich das der Politischen Opportunität. Dazu beispielsweise North: „Wenn Wirtschaften Tauschgewinne realisieren, indem sie relativ effiziente Institutionen schaffen, so geschieht das deshalb, weil unter gewissen Umständen die privaten Ziele derjenigen, die genügend Verhandlungsmacht haben, um die Institutionen verändern zu können, institutionelle Lösungen bewirken, die sich als sozial effizient erweisen oder doch zu solchen werden. Die subjektiven Modelle der Akteure, der Erfolg der Institutionen bei der Senkung der Transaktionskosten und das Ausmaß, in dem die Institutionen formbar sind und auf Veränderungen der Präferenzen bzw. der relativen Preise reagieren, bestimmen diese Umstände“ (North, 1992, S. 19 f.). Vielfach wird auch vom “rent-seeking” in den institutionellen Entscheidungssituationen gesprochen. Je stärker das Kriterium der Opportunität zur Geltung kommt, desto mehr Kompetenzen eignen sich die institutionensetzenden Akteure an, auch wenn dies zu ineffizienten institutionellen Arrangements führen sollte. Die Einführung eines zweiten Auswahlkriteriums erhöht die Varietät der möglichen Ergebnisse. Diese Erweiterung ist positiv zu beurteilen, weil das Kriterium der Transaktionseffizienz zu Vorhersagen führt, die keineswegs die in der Realität beobachtbare Varietät in der institutionellen Ausgestaltung aufweisen. Dies auch deswegen, weil zur Bereitstellung ähnlicher Leistungen äußerst unterschiedliche institutionelle Arrangements gewählt werden, die nicht alle transaktionseffizient sein können. Die Einführung der (politischen) Opportunität ist aber andererseits auch negativ zu bewerten, weil Aussagen von größter Varietät möglich sind. Das Kriterium der Opportunität wird vielfach ad hoc eingeführt, wodurch der Erklärungswert des Ansatzes stark eingeschränkt wird. Dadurch entsteht die Gefahr von empirisch nicht überprüfbaren Aussagen. Der Ausweg kann nur darin liegen, die institutionellen Bedingungen, die Opportunität vermuten lassen, unabhängig von der gewählten Alternative möglichst exakt zu beschreiben. Damit kann der Alternativenraum bei unterschiedlichen Kombinationen der beiden Auswahlkriterien hinreichend genau abgesteckt werden. Diese Erweiterung ver!

Konkurrierende Theorien der Geldentstehung

49

harrt letztlich im Konzept der Cultural Nullity, bezieht aber die unterschiedlichen Ausgangsbedingungen in der Institutionenwahl ein. Insbesondere wird der Staat als wichtiger Akteur bei der Wahl von ökonomischen Institutionen integriert. Auch wurde berücksichtigt, dass institutionelle Designs (z.B. eine Geldordnung) den Charakter von Netzwerkgütern bzw. öffentlichen Gütern haben können und daher die Gefahr von Situationen des Gefangenendilemmas und von TrittbrettfahrerVerhalten besteht. Eine systematische Anwendung dieser Erweiterung auf die Geldentstehung müsste in einem ersten Schritt klar machen, dass Geldentstehung nicht als technischer Vorgang der Geldschaffung zu begreifen ist, sondern die Herausbildung einer Ordnung, nämlich der Geldordnung bedeutet. Monetäre Institutionen – auch wenn sie als „primitiv“ eingestuft werden, umfassen letztlich alle Normen, welche die Verwendung von Geld, seine Schaffung und seine Steuerung zum Inhalt haben. Darunter fallen so verschiedenartige Angelegenheiten wie die Maßnahmen und Mechanismen zur Erreichung jener Ziele, die mit dem Geldwesen und seiner Ausgestaltung in einer Gesellschaft erreicht werden sollen, aber auch die grundsätzliche Entscheidung, Geld als Form der ökonomische Koordination zu verwenden. Dabei sind auch die Verbindungen der Geldordnung zu anderen Ordnungen der Wirtschaft (Wettbewerbsordnung, Sozialordnung, etc.) zu thematisieren und die Hierarchie von Ordnungen zu beschreiben. Die Anwendung der NIÖ auf die Geldentstehung bzw. –entwicklung hat dann im Sinne einer „Institutionenwahl“ die Anfangsbedingungen zu spezifizieren, die für die Wahl der Geldausgestaltung bzw. für die Bedeutung der beiden Entscheidungskriterien Transaktionseffizienz und Politische Opportunität von Bedeutung sind. Dabei ist mit zu berücksichtigen, dass mehrere Gruppen im Rahmen der Herausbildung von Geld involviert sind und dabei asymmetrische Beziehungen bestehen können, die Prinzipal-AgentSituationen zur Folge haben, deren Lösung komplexe institutionelle Arrangements benötigt. Die wichtigste Erweiterung, welche die Neue Institutionenökonomik in den letzten Jahren erfahren hat, ist die Einführung informeller Institutionen (vgl. North 1992). Sie können mit dem hier verwendeten Begriff der Kultur gut umschrieben werden. In den verschiedenen Nachbarwissenschaften der Wirtschaftswissenschaften wird der Terminus der informellen Institutionen durch andere Begrifflichkeiten relativ gut abgedeckt. So verwendet Mann in seiner Darstellung der vier Quellen und Organisationsformen von Macht dafür den Begriff der ideologischen Macht (vgl. Mann 1990, S. 46). Er subsummiert darunter drei eng miteinander verknüpfte Sachverhalte. Ideologien sind Stützen der Welterklärung, weil sie sinngebende Begriffe und Kategorien vermitteln. Dies bedeutet auch, dass diejenigen, die das Recht auf Sinngebung monopolisieren kollektive und distributive Macht ausüben. Zweitens sind Normen im Sinne einer verbindlichen gemeinsamen Vorstellung davon, wie Menschen in ihrem Verhältnis zueinander moralisch handeln sollen, für eine länger dauernde und stabile Kooperation unumgänglich. Eine ideologische Bewegung, die das wechselseitige Vertrauen und die kollektive Moral einer Gruppe steigert, kann damit zugleich ihre kollektive Macht vermehren und durch eifrigere Gefolgschaft belohnt werden. Die Monopo-

50

Engelbert Theurl

lisierung von Normen ist somit ein Weg zur Macht. Die dritte Quelle ideologischer Macht sind ästhetische und rituelle Praktiken. Sie lassen sich nicht auf rationale Wissenschaft reduzieren. „Wie jedermann – mit Ausnahme von besonders glühenden Materialisten – weiß, ist es so, dass dort, wo Sinngebung, Normen und ästhetische und rituelle Praktiken von einer bestimmten Gruppe monopolisiert werden, diese eine beträchtliche extensive und intensive Macht ausübt. Sie kann ihre Funktionalität nutzen, um ihrer kollektiven Macht die distributive hinzuzufügen“ (Mann 1990, S. 47.) Das Mann’sche Konzept der ideologischen Macht kommt dem Berger/ Luckmann’schen Konzept der Sinnwelten sehr nahe (Vgl. Berger/Luckmann 1980). Ausgangspunkt bei Berger/Luckmann ist ähnlich wie bei Mann die Tatsache, dass Realität immer gedachte, konstruierte Wirklichkeit darstellt. Der Einzelne bewegt sich vor dem Hintergrund einer Lebenswelt, die die natürliche, unaufhebbare Basis seiner Weltbetrachtung darstellt. Er konstruiert bzw. erfasst die Welt mittels eines Wissensvorrates, der aus Ablagerungen von Erfahrungen besteht. Die Wirklichkeit wird als Vorordnung erfahren. Diese Vorordnung kann aber nicht beliebig sein, sondern ist – mit einer gewissen Streubreite – an die tatsächlich gegebenen Strukturen gebunden. Wesentliches Medium der Kommunikation, Verbreitung und Aufrechterhaltung dieser Wirklichkeitsordnung ist die Sprache. Sie stellt die Intersubjektivität der Wirklichkeitsdeutung her. Sinnwelten stellen zwar ein kohärentes, aber in vielen Fällen nicht ein alle Dimensionen erfassendes Betrachtungssystem dar. Sie konzentrieren sich vielmehr auf zentrale gesellschaftliche Werte. Systeme von Sinnwelten bedürfen der Legitimation. Berger/ Luckmann unterscheiden vier Ebenen der Legitimation, die von einfachen Aussagen ohne jeglichen Beweischarakter über theoretische Postulate in rudimentärer Form, über explizite Legitimationstheorien von gesellschaftlichen Ausschnitten zu symbolischen Sinnwelten reichen. Letztere stellen synoptische Traditionsgesamtheiten dar, die verschiedene Sinnprovinzen integrieren und die institutionelle Ordnung als symbolische Realität überhöhen. Sie rekurrieren damit auf eine Wirklichkeit jenseits der Alltagserfahrung, stellen kognitive Konstruktionen theoretischer Natur dar. Symbolische Sinnwelten sind als Matrix aller gesellschaftlich objektivierten und subjektiv wirklichen Sinnhaftigkeit zu verstehen. Sinnwelten bedürfen für ihre Stabilität Stützkonzeptionen. Mythologie, Theologie, Philosophie und Wissenschaft stellen wichtige Typen für solche Konzeptionen dar (vgl. Berger/ Luckmann 1980, S. 118 ff.). In den Geschichtswissenschaften wird das, was Ökonomen als informelle Institutionen, Soziologen als ideologische Macht bzw. Sinnwelten bezeichnen, als Mentalitätsgeschichte bzw. als Historische Mentalität umschrieben (vgl. beispielsweise Dinzelbacher 1993). „Historische Mentalität ist das Ensemble der Weisen und Inhalte des Denkens und Empfindens, das für ein bestimmtes Kollektiv in einer bestimmten Zeit prägend ist“ (Dinzelbacher, 1993, S. XXI). Solche Ensembles sind nicht unbedingt widerspruchsfreie Systeme, sondern können auch dialektische Komponenten enthalten, die ihrerseits zur Mentalitätstransformation führen können. Zu den Denkinhalten zählen die in einer Kultur allgemein geltenden Grundüberzeugungen, ideologische, politische, religiöse, ethische, ästhetische

Konkurrierende Theorien der Geldentstehung

51

Konzepte, die die Einzelbereiche von Religion, Kultur, Kunst usw. durchdringen, insoweit sie bewusst sind. Diese Inhalte sind prinzipiell verbalisierbar und Gegenstand der diskursiven Reflexion. Allerdings umfassen sie auch faktisch nur bildhaft realisierbare Vorstellungen wie Bilder, Metaphern und Allegorien. Mentalitätsgeschichte ist die Geschichte von der Langsamkeit in der Geschichte. Wie bereits ausgeführt wurde, haben sich die Wirtschaftswissenschaften, insoweit sie sich dem Konzept der „Cultural Nullity“ verpflichtet fühlen, die Existenz von informellen Institutionen entweder als irrelevant abgelehnt oder versucht sie ökonomisch zu erklären. Stigler/Becker (1977) lehnen es beispielsweise ab, ökonomische Phänomene mit Hilfe von Wandlungen in den Präferenzstrukturen zu erklären. Diskussionen über Präferenzen und damit auch über Mentalitäten, Ideologien, Sinnwelten, die zur Reflexion der Präferenzen dienen, werden als unnötig, schädlich, ja sogar als Ausdruck intellektueller Trägheit gebrandmarkt. Sie sind exogen vorgegeben und sind zudem über alle Wirtschaftssubjekte, Kulturen und Zeiten hinweg inhaltlich gleich und konstant. Stigler/Becker drücken dies sehr plakativ mit dem folgenden Zitat aus: „Our title (De Gustibus Non Est Disputandum, Ergänzung durch den Verfasser, E. Theurl) seem to be capable of another and preferable interpretation: that tastes neither change capriciously nor differ importantly between people. On this interpretation one does not argue over tastes for the same reason that one does not argue over the Rocky Mountains – both are there, will be there next year, too and are the same to all men“ (Stigler/Becker 1977, S. 76.) Die wissenschaftstheoretische Botschaft von Stigler/Becker besteht darin, den Wandel ökonomischer und sozialer Phänomene immer mit der Veränderung von Restriktionen (z.B. relative Preise, Einkommen) zu erklären und nicht auf Ad hoc-Erklärungen (z.B. Mentalitätsänderungen) zu rekurrieren. Diese Vorgangsweise macht als heuristisches Verfahren durchaus Sinn. Zu Ende gedacht, führt sie jedoch zum gleichen Ergebnis, wie die Ad hoc-Erlärungen auf der Präferenzebene. Lassen sich nämlich relative Preise nicht mehr intersubjektiv beobachten, sondern stellen sie lediglich subjektive Kostenrelationen dar, dann sind die Hypothesen nicht mehr falsifizierbar. Die Theorie verkommt zur Tautologie. 4.2.4. Kultur und Wirtschaft sind reziprok Eine vermittelnde Position zwischen der „Cultural Nullity“ und der „Cultural Fixity“ stellt das Konzept der „Cultural Reciprocity“ dar. „Cultural Reciprocity is the approach which opens the most promising research agenda. It does not start by assuming, of effectively assuming, that culture and the economy exert no reciprocal influences. Culture is not a given, economics is not necessarily divorced from the cultural context, but not is culture exempt from economic influence. Unlike the implied “fixity” position, culture is a process, not an end-state. This seems the proper scientific starting-point.” (Jones 1995, S. 277/278). Ein Konzept der „Cultural Reciprocity“ umfasst mehrere Bereiche. Es bedeutet, dass die beiden Subsysteme Wirtschaft und Kultur aufeinander einwirken. Teilweise stellen sie Substitute dar, teilweise sind sie komplementär. Diese Wirkung ist in der Neuen Institutionenökonomik mittlerweile anerkannt. Informelle Institutionen können die Transaktionskosten im wirtschaftlichen Verkehr senken, da sie kostenintensive

52

Engelbert Theurl

formgebundene Regelungen substituieren können, da sie das bei der Einführung formgebundener Regeln zwangsläufig auftretende Gefangenendilemma beseitigen helfen, da sie helfen, die negativen Auswirkungen von Informationsasymmetrien zu beseitigen, da sie Entscheidungs- und Kontrollkosten reduzieren, da sie das Free-Rider-Verhalten im Rahmen von Teamproduktionen eindämmen, da sie bestehende Ordnungen legitimieren und stabilisieren und da sie tragische Entscheidungssituationen abschwächen helfen. „Cultural Reciprocity“ bedeutet auch, dass Veränderungen in den beiden Bereichen im jeweils anderen Bereich bzw. durch das Zusammenwirken der beiden Bereiche ausgelöst werden können. Eine solche Form der Reziprozität wurden beispielsweise von Hirschman vorgestellt (vgl. Hirschman 1984). Hirschman verwendet dafür das Konzept hierarchischer Präferenzstrukturen und unterscheidet zwischen Präferenzen erster und zweiter Ordnung. Präferenzen erster Ordnung sind Präferenzen für Güter im neoklassischen Sinne. Wesentliche Aufgabe der Präferenzen zweiter Ordnung – Metapräferenzen – ist die reflexive Selbstbewertung der Präferenzen erster Ordnung. Die genannten Konzepte der Sinnwelten, der ideologischen Macht und der historischen Mentalität stellen in diesem Konzept Präferenzen zweiter Ordnung dar. Aus der Interaktion der beiden Ebenen können dann Änderungen im ökonomischen Verhalten, aber auch Veränderungen in den informellen Institutionen resultieren. Cultural Reciprocity bedeutet letztlich auch eine Absage an einen umfassenden Erklärungsanspruch von wissenschaftlichen Disziplinen. Wissenschaften werden zwar nach dem Erkenntnisinteresse abgegrenzt und sind daher vom Erkenntnisgegenstand her offen. Dies bedeutet aber nicht, dass einzelne Wissenschaften nicht bei der Erklärung bestimmter Phänomene und Entwicklungen Vorteile gegenüber anderen haben. 5. Schlussfolgerungen Welche Schlussfolgerungen können aus diesen Überlegungen gezogen werden? Die Diskussion der Frage, ob Geld aus seiner Fähigkeit entstanden ist, Transaktionskosten zu senken oder ob es der sakralen Sphäre entstammt, führt direkt zu fundamentale Fragestellungen der wissenschaftlichen Theoriebildung. Die Auffassung wird im wesentlichen davon abhängen, welche der drei geschilderten Positionen vertreten wird. Dabei erscheint die Position der Reziprozität zwischen Kultur und Ökonomie am fruchtbarsten, gleichzeitig aber auch mit den größten Herausforderungen verbunden zu sein. Sie ist mit zahlreichen dialektischen Beziehungen konfrontiert. Die Leistungsfähigkeit der Neuen Institutionenökonomik bei der Erklärung von Geldordnungen ist allerdings diesbezüglich noch nicht ausreichend genutzt worden. Gerade die jüngeren Entwicklungen in der Währungsunion zeigen, dass ohne Rückgriff auf die Mentalitätsgeschichte Entwicklungen in der Geldordnung nicht adäquat erklärt werden können. Geldsysteme sind und bleiben neben ihrer Funktion der Transaktionskostensenkung auch Interpretationsgemeinschaften wirtschaftlicher und politischer Phänomen.

Konkurrierende Theorien der Geldentstehung

53

Literatur Aristoteles, Politik, übersetzt und mit erklärenden Anmerkungen versehen von Eugen Rolfes, Hamburg 1981. Brunner, K., Meltzer, A. H. (1971), The Use of Money in the Theory of an Exchange Economy, American Economic Review, Vol. 60, S. 784 – 805. Dinzelbacher, P. (1993), Europäische Mentalitätsgeschichte – Hauptthemen in Einzeldarstellungen, Stuttgart. Friedman, M: The Methodology of Positive Economics, in: Friedman, M. (ed.), Essays in Positive Economics, Chicago-London 1953, S. 3 – 43. Hayek, F. A. (1973), Law, Legislation and Liberty (Vol. I: Rules and Order), London-Henley. Hirschman, A. O. (1984), Engagement und Enttäuschung. Über die Schwankungen des Bürgers zwischen Privatwohl und Gemeinwohl, Frankfurt. Heinson, G., Steiger, O. (1997), Kontroversen der Geldentstehung: Streit um die Anfänge des Geldes, IKSF-Discussion Paper No. 11. Jones, E. L. (1993), Culture and its Relationship to Economic Change, Journal of Institutional and Theoretical Economics, Vol. 151/2, S. 269 – 285. Jones, R. A. 1976), The Origin and Development of Media of Exchange, Journal of Political Economy 1976, Vol. 84, S. 757 – 775. Knapp, G. F. (1905), Staatliche Theorie des Geldes, München-Leipzig. Laum, B. (1924), Heiliges Geld: Eine historische Untersuchung über den sakralen Ursprung des Geldes, Tübingen. Luhmann, N. (1994), Die Wirtschaft der Gesellschaft, Frankfurt. Mann, M. (1990), Geschichte der Macht, Bd. 1, Von den Anfängen bis zur griechischen Antike, Frankfurt. Menger, C. (1883), Untersuchungen über die Methode der Sozialwissenschaften und der politischen Ökonomie, Leipzig. Menger, C. (1909), Geld, in: Conrad, J., et al., (Hrsg.), Handwörterbuch der Staatswissenschaft, 4. Bd., Jena, S. 555 – 610. North, D. C., (1990), Institutions, Institutional Change and Economic Performance, Cambridge. North, D. C., Thomas, R., P. (1973), The Rise of the Western World: A New Economic History, Cambridge. Smith, A. (1776), An Inquiry into the Nature and Causes of the Wealth of Nations, herausgegeben von E. Cannan, New York (1904). Stigler, G. J., Becker, G. G. (1977), De Gustibus Non Est Disputandum, American Economic Review, Vol. 67, S. 76 – 90. Ulf, Ch. (1990), Die homerische Gesellschaft – Materialen zur analytischen Beschreibung und historischen Lokalisierung, München.

ECONOMIC THEORIES AND THE ANCIENT NEAR EAST Marc Van De Mieroop Economic history is no longer a second-rate discipline in ancient Near Eastern studies, as it used to be in the first half of the twentieth century when the study of religious ideology was considered more important than that of how the people lived (Gelb 1967). The changed attitude is clear from the enormous number of books and articles devoted to the subject that have appeared in the last decades. Within the ancient world the empirical data provided by the cuneiform tablets of Mesopotamia and its neighbors is virtually unparalleled. Only Egypt in the Ptolemaic and Roman periods can compete. In addition to the analytical studies that have appeared, there have been some attempts to formulate theoretical frameworks that can be used to provide a structure for the interpretation of economic actions.1 There have been many discussions of how we can interpret the ancient Mesopotamian economy (mostly focused on whether or not markets and money existed), but these often are not useful as theoretical bases for the study of the economy in general. Moreover, no true economic history of the ancient Near East has ever been written and many analyses of economic material are published without a clearly acknowledged theoretical basis. I have become increasingly skeptical that a framework convincing the majority of scholars can be developed. We can, and we need to, develop structures that enable us to contextualize interpretations, but we should acknowledge that these are constructs of our minds that are not provable. All scholars working in economic history need to comprehend the intellectual background of the structures their colleagues use, in order to make possible debates that lead to a better understanding of the past. I will discuss here some of the most often used theoretical bases for economic studies of the ancient Near East, especially their intellectual sources of inspiration. This is thus primarily a historiographic paper. I cannot claim to cover all current theories, as there are many variants. My hope is to address the most prominent ones, which I will call Marxian, primitivist, and modernist. In Marx’s own economic theory, “class” was a crucial concept, determined by one’s access to the means of production. In any pre-industrial society that refers to land, and the question of land ownership is a crucial one for a Marxian economic analysis. This is a difficult subject in ancient Near Eastern studies: we can identify three types of ownership, but not how prevalent any one was at a particular moment in time. The three types of landownership are communal, private, and institutional, and can be documented in varying measures for almost every period of ancient Near Eastern history (Renger 1995). There are traces — often vague — of village communities owning land in common and restricting its alienation to individuals. Private ownership of land entails an individual’s full freedom to do with it what he or she wants, including selling it (Diakonoff 1982, 8-13). That type of ownership is somewhat better documented through sales records of agricultural 1

E.g., Liverani 1976, Renger 1994.

Marc Van De Mieroop

55

land, something we find rarely in the third millennium, but with increasing frequency later on. Institutional ownership is the best documented in the ancient Near Eastern record, but its nature is perhaps the most difficult to comprehend as we have to determine as well the economic role of the institution in society in general. We can easily ascertain that an institution, such as the temple or the palace, owned land — but what is the importance of that organization to the people living in the same territory? The relationship between institutions and the state needs to be established. Too often the two seem to be considered identical in scholarship. The idea that the early Babylonian city was fully dominated by the temple, and that a typical state then was a temple-city, was popular for a long time, but has now mostly been abandoned.2 An equation of the palace and the state is still common, however.3 Even under the Assyrian empire, when the palace held an enormous amount of power and owned huge tracts of land, it did not represent the entire state economy. The latter was more encompassing, incorporating the activities of all organizations, including temples and private households. Institutions are to be regarded as households that existed side-by-side other households, institutional and private. The interactions between these households define the economy and in the societies of the ancient Near East they were very widespread and complex. The various types of households were not neatly categorized. An individual could easily take care of the affairs of an institution at the same time as those of his own household. The two were folded together, oftentimes without a strict boundary. It would be anachronistic to speak of a national economy in ancient Mesopotamia, as there were no real nations but often heterogeneous territories held together by the ruler. The question of the economic nature of the Mesopotamian state is far from clear and should be one of the fundamental topics of research for the modern historian. In Marx’s view of history, and that of his collaborator Engels (1884), there was an evolution from communal to private in the ownership of the means of production. The development of private property was a historical event that coincided with the dissolution of the community into nuclear families. Private ownership grew over the ages to find its culmination in the capitalist stage. Does the ancient Near East present a long period of transition between communal and private ownership? There seems to have been a shift in the nature of land ownership over time, with an increased importance of private property, but the existence of communal land long after the attestation of private land, places doubt on such an evolutionary model. Marx simplified matters and the data known to him did not support a view that there was a universal evolution through the historical stages he posited. Hence he developed the confused notion of the Asiatic Mode of Production, which would explain how a large part of the world did not participate in the de2 3

The bibliography on this issue is large and the question not fully settled; see the short survey in Snell 1997:148-9. For example, a collection of conference papers entitled State and Temple Economy in the Ancient Near East (Lipinski 1979), actually deals with palace and temple economies.

56

Economic Theories

velopments he saw in the west. He argued that regions like India, where the community was pivotal, were wrenched from a primitive condition to a capitalist stage imported by colonial powers. But the desire to develop a model that could be applied globally and that made the arrival of communism a historical necessity was so great that the exceptional character of the world outside western Europe was ignored by Engels and by many subsequent Marxists, and the concept of the Asiatic Mode of Production died out.4 Marxian thought has much to contribute to the student of Near Eastern economics. First, it stresses the importance of economic history, and the practitioner can feel that he or she is at the center of historical research. Moreover, it forces us to look at production as a core element in the economy, something that is often ignored with other theoretical frameworks, which concentrate on exchange. More contentious in the field of ancient Near Eastern studies, and in that of ancient studies in general, has been the theory that the ancient economy was so fundamentally different from the modern one that no tools of analysis or concepts developed for the latter can be used in the study of antiquity. The person outside the field of ancient studies most often identified with this idea, and most routinely criticized, is Karl Polanyi, but his ideas have a long and distinguished pedigree, including the works of the classical scholar Karl Bücher and the sociologist Max Weber (Van De Mieroop 1999, 115-8). They argue that the economy needs to be studied in its social context, and that the activities we observe have very different meanings in different social contexts. Polanyi focused his attention on exchange, positing the existence of three systems: reciprocity, redistribution, and the market. The latter’s importance was a modern development, and in antiquity the market’s role was minimal and not influenced by such elements as supply and demand. It is important to remember the context of Polanyi’s work on antiquity and the non-western world when evaluating this proposition. His most important book, The Great Transformation was originally published in 1944 and attempted to explain Word War I and the subsequent rise of fascism in his own lifetime. These disasters were due, in Polanyi’s opinion, to a combination of nationalism and the free market economy. “Market economy implies a self-regulating system of markets; in slightly more technical terms, it is an economy directed by market prices and nothing but market prices.” (Polanyi 2001, 45) He had thus a very specific definition of the word market in mind when he stated that it was a nineteenth century invention, and this has been overlooked in subsequent discussions in the field of Near Eastern studies. Polanyi was highly critical of unfettered market liberalism as well as of a fully centralized state-economy. He looked thus for a “third way” which would protect the individual in an economy embedded in the social structures. This, by the way, led to a revival of his writings since 1990, and he has become an idol of the anti-globalization movement. It is within this context that we need to see his work on antiquity, which was primarily undertaken late in his life. Just as Marx and Engels looked for a primitive communist society in early 4

The literature on the Asiatic Mode of Production is enormous and contentious. In ancient Near Eastern studies it has been most extensively discussed by Zaccagnini 1981.

Marc Van De Mieroop

57

antiquity, Polanyi sought a better economic system in that era. Modern scholars often imagine the world they dream of in the distant past, when factual evidence is limited and interpretations can vary freely. Polanyi did not investigate trade in Hammurapi’s time, determine that it was marketless, and then postulate that economies could be based on non-market exchange. Rather, he was convinced that the ideology of the free market was flawed, disliked what he saw in the recent history of the world, and wanted to find great cultures of the past where the market had no role. Thus he interpreted the data to fit his ideas. That does not mean that he was completely wrong, certainly not with respect to the modern market economy. The student of the ancient world should follow his basic precept that the study of an economy needs to be contextualized within the social structure of the society under investigation. Marxians and primitivists share, among other things, a belief that capitalism represents a unique historical situation. The explanation of how and why it ever developed is a concern of numerous historians and economists. We have to remember that when we read their statements about pre-capitalist economies: the differences with the capitalist system in which all authors lived or live are stressed, as are those elements that contributed to the rise of the new economic structure. Thus Max Weber, one of Polanyi’s inspirations, focused on trade and exchange because he saw the capitalist spirit develop from a coalescence of western cities trading their manufactures and a Protestant ethic that wanted to use money for the sake of making more money rather than for the display of wealth (Weber 1983). In order to make that uniqueness clearer, he stressed the nonproductive role of the cities in antiquity, which did take rents and taxes from the countryside but did not use the income for productive purposes. Especially in Weber’s case, the argument is often based on polar oppositions: what is present in one of his ideal types is absent or entirely the opposite in the other. For example, the ideal type of the Medieval city was characterized by extensive manufacture for export, thus the ideal type of the ancient was characterized by an absence of craft production on a large scale and a lack of exports. This procedure of reasoning contains a great danger for those using empirical data: if the concern is to define the uniqueness of a situation best known to the scholar, in this case capitalism, then the other, presented as a polar opposite, will not be depicted in its own right but in the negative, as a foil. It would be a mistake to see such reasoning as a coherently argued description in its own right. Adherents of modernist interpretations of the economy, finally, do not necessarily deny the uniqueness of the capitalist economy, but take a pragmatic stance in the study of antiquity: tools of modern economic analysis can be used when studying ancient data, and we can understand the people of antiquity because they were not driven by entirely different economic motives as we are today. This stance is rarely explicitly argued in ancient Near Eastern studies, but underlies many analytical studies of economic data. When terms such as profit motive, investment, supply and demand, and so on are used, there is an underlying assumption of a system that parallels our modern one.

58

Economic Theories

In the study of antiquity in general the validity of doing so has been much debated since the famous Bücher - Meyer controversy of the late nineteenth century (Schneider 1990). Again we should contextualize that debate: German and Austrian economists at the same time were involved in a polemic over whether or not there was a universal validity to economic analyses employed at the time. The Germans insisted on the uniqueness of all economic situations in order to be able to plead for protectionism of the developing German industry, against the laws of liberal economic theory. They found support for their ideas in historicism, insisting that each historical period is unique and that models cannot be used across chronological or cultural borders. Thus the free market, which had been absent in many historical situations, did not need to be the goal of the contemporary German economy either. On the opposite end there was the idea of the universal law of maximization of economic resources, which could be used in the analysis of any economy. Such debates continue today. The use of models, developed to explain contemporary situations, has many dangers for the study of antiquity. The depiction of the past in historical models is not for the sake of explaining that past world, but to portray something that differed from and may have led to the modern capitalist system in the long run. Long-term teleological histories, such as those of Marx and Weber, have been under attack since the 1970s and, while perhaps not dead, are under severe suspicion. On the other hand, modernists can be accused of having a static view of history, as if historical circumstances do not change radically. Since the work of Michel Foucault has gained worldwide recognition in the 1980s, it has become increasingly clear how peoples’ perceptions can fundamentally change from one century to another, how instead of progress in history, we find processes that often include rifts and reversals: thus the casting of a modern point of view on ancient peoples is also a mistake. Historians today often aim to write histories that take into account all the particular circumstances of the people they investigate, political, economic, social, religious, sexual and so on. That is indeed a laudable goal, but an elusive one, since those same structures in which to place the data also dissolve because of a distance in time and familiarity. One needs to situate what can be observed into a wider context that is partly, or sometimes greatly, hypothetical, and this is done through analogy with better known cases. Those analogies are by definition anachronistic and their use biases our understanding of the data. Scholars often suggest that the evidence for wider conclusions could be available and that partial data rather than the nature of the evidence itself prevent us from a complete reconstruction of the ancient economy. With a few examples, I will argue that this is a false idea. It is the form of the ancient evidence, rather than its contents, that prevents us from understanding the economy as a whole. The examples will show that the evidence always reveals one aspect of economic activity at the expense of others that probably co-existed. The examples I use all deal with modes of exchange, as this question is the most controversial in the study of the ancient Near Eastern economy. I will address Polanyi’s three systems of exchange redistribution, reciprocity, and market exchange studying how they

Marc Van De Mieroop

59

are attested in different periods of Near Eastern history, and how the data from these periods fully bias our views. Redistribution is a mode of exchange that is very well documented throughout the history of Mesopotamia. It requires that an institution has access to enormous resources, which it subsequently hands out to people. In certain periods, institutional control over economic resources seems nearly all-encompassing, almost to the exclusion of other sectors. The Ur III period (the twenty-first century BC in southern Mesopotamia) is often regarded as one of these periods: the extensive documentary record available to us illustrates that the palace directly controlled an enormous amount of agricultural land, the very basis of the economy, and distributed much of its income to thousands of dependents, from the king down to the baby of a lowly weaver. These ration texts document the issue of barley, wool, clothing, and oil to long lists of people, who seem to have been fully reliant on the palace for their survival. In order to obtain the resources needed for these distributions, the palace seems to have owned the majority of the land in the state’s territory. One single record, for example, indicates that an area of 837.5 sq. km. in the province of one city alone was directly administered by the palace and by temples acting on its behalf (Van De Mieroop 1999, 123-4). From the available record, one might easily conclude that in this century the palace controlled all productive resources and that the majority of people survived from their redistribution. The amounts registered are so massive that this conclusion seems utterly reasonable. Moreover, there is virtually no record of any economic activity outside the institutional sphere, which seems to corroborate this conclusion. But it can be contested on at least two counts. First, the idea that dependent laborers relied fully on institutional rations for their survival is suspect. We can determine that at least some groups, such as craftsmen (Steinkeller 1996), were given rations only part of the year. What happened during the remaining months? Did they hire themselves out to the institution for a salary rather than a ration, or did they have a business on the side, their labor paid for by private customers? The latter option, which is quite likely, would not be attested in the available record, and thus cannot be proven. Secondly, the palace’s control over all the agricultural resources can also not be conclusively established. Although huge tracts of land in a province such as Lagash are documented as supervised by the palace, some scholars believe that there was ample space for privately owned land (van Driel 1999-2000).5 The debates over this are hopeless, as the documentation does not exist to prove whether or not all the land of the region is accounted for. Consequently, we can state only that redistribution was an important activity in Ur III times, but we cannot determine whether or not it was at the exclusion of any other system of exchange. If it were not exclusive, then its importance cannot be calculated, as we never know the full extent of the economy in any period of Mesopotamian history. This is not a consequence of the fact that we have insufficient data, but due to the kind of data we have: the institutional archives did not bother to record property outside their purview. 5

Other scholars strongly contest that idea, e.g., Steinkeller 1999.

60

Economic Theories

Another type of exchange is reciprocal: people give one another goods and services that are considered equal in use value, sometimes with a delay in time. These transactions can be sufficient to fulfill certain needs and are guided by a value system that is not necessarily based on what we would describe as “price.” There is nothing unusual about reciprocity we all exchange gifts with friends and family. Can it be an important economic factor, however? In ancient Near Eastern history there are certainly examples where it was. Most eloquent is the case of the late Bronze Age, c. 1500 -1200 BC, when kings of the various great states were actively engaged in gift exchange of precious goods, as documented by the Amarna letters from mid-fourteenth century Egypt. The king of that country was the sole supplier of gold to a group of peers who were in need of the metal for their building activities and other projects at home. In order to obtain gold, the other kings provided him with presents of the precious items available to them. They sent to Egypt horses, copper, craft goods, and so on, with the understanding that they would receive gold or ivory in return. The fiction that these were “presents” was carefully maintained, although everyone knew that access to rare goods was the intent. Thus some seemingly irrational practices can be observed: The king of Alashiya, for instance, sent a small amount of ivory along with a large shipment of copper and wood to Egypt the land where ivory was abundant. He did so in order to indicate clearly to his colleague that he hoped to be repaid in ivory (Liverani 1972). The gift exchange, based on rules of reciprocity, thus had a commercial goal. While the idea of commercial value was not explicitly expressed, the kings kept track of what they gave and received and often complained bitterly if they felt cheated. Much of this was griping and probably unjustified, but still the kings maintained some balance in the value of what they gave one another. It may seem that the gift exchange was the only way in which certain precious goods could be acquired, but this cannot be proven and there are indications to the contrary. Tusks of ivory, for example, were found in the (admittedly somewhat later, i.e., late fourteenth century) shipwreck at Ulunburun off the southern Anatolian coast, and that ship seems to be evidence of merchants travelling on their own behalf (Pulak and Bass 1997). Another network of exchange co-existed with reciprocity and we cannot establish how economically important either one was. The nature and the importance of market exchange, the third mode, and the ancillary question of the existence of money in the ancient Near East, has generated the most debate in the discipline, and scholars still hold very different opinions on the matter. The bibliography on it is now enormous, but the discussions often resemble restatements of previously expressed opinions, and have not led to a fruitful exchange of ideas.6 To an extent this situation results from the different 6

The literature can be divided as expressing two diametrically opposed opinions. On one side scholars of the Near East follow Polanyi’s statements that there was no market or true money (e.g., Renger 1995b), on the other side they recognize these economic features in the Near Eastern record and consider them to have been very important (e.g., Powell 1999, Goddeeris 2002, 382-92). The issue emerges in almost every overall discussion of the economy and the same arguments and counter-arguments are employed. See, for example, Renger 2002 and

Marc Van De Mieroop

61

meanings given to the term market. These have ranged from a place where exchange occurs, to exchange itself, to price equivalents and rates for the exchange of goods determined by the laws of supply and demand (Zaccagnini 1987-90). Today’s ideology of market liberalism would have the entire world’s economy ruled by market forces, and prices would be solely determined by supply and demand. The question of prices in the ancient Near East is tricky, but price fluctuations cannot be explained as the result of market forces. Perhaps the best record available to us is provided by price quotations in the astronomical diaries of the first millennium BC, which provide a sequence over some six centuries (Slotsky 1997). Analysis of the prices of agricultural products does not show a decrease in times of abundance, that is after the harvest, or any other pattern that would suggest that supply and demand dictate what is going on.7 But neither does an entirely free market exist in the contemporary world, despite official rhetoric. Ideology does not reflect actual practice. Behavior connected to market exchange can be observed in the ancient Near Eastern record. One group of records that extensively demonstrates this point derives from the Old Assyrian merchant colony at central Anatolian Kanesh, including more than 20,000 tablets dating to the first centuries of the second millennium BC, many of them letters. They were written by merchants from the city of Assur, which was the central point of a network that traded tin from the east, textiles from Babylonia, and silver and gold from Anatolia. Here, men and women collected funds for their activities by seeking investments and loans, they took commercial risks, and could either make substantial profits or incur losses. These activities were not carried out under the auspices of the palace, but were regulated through an organization the merchants set up and ran themselves. The goal of their work has been described by one leading specialist on this material as “filthy lucre,” and the city of Assur has been compared to such European mercantile centers as Genoa (Larsen 1982). This case is the prime example of Polanyi’s weak control over the empirical data: he argued that the Kanesh material shows administered trade under palace control, with the merchants only receiving commissions and being protected from losses because the palace employed them (Polanyi 1957). He was demonstrably wrong (Veenhof 1972, 349-57), but the Old Assyrian case does not fully support a view that the market economy dominated in the ancient Near East either. To say that the merchants were driven by profit motives similar to those we associate with capitalism, is an assumption we cannot demonstrate. I have given these examples to show that we can find different spheres and types of economic interaction throughout ancient Near Eastern history, and that we cannot prove that one existed to the exclusion of others at any time. Most scholars would agree, I think, that they co-existed. I also argue that the documentary basis does not allow us to show how dominant one was, even when we are

7

the comments in the same volume on p. 283, where both sides are represented. A detailed survey of the issue by van Driel (2002) was not available to me at the time of writing this article. Alice Slotsky, who is preparing a study of price fluctuations, provided this information to me.

62

Economic Theories

overwhelmed with material. We are never in a position to reconstruct the economy of a region, only of a segment of society whose records we happen to have recovered. The limitations of the documentary basis should always be kept in mind, although we should be happy there is this much. I encourage a skeptical attitude toward the grand theories of economic history, although not a full rejection of them. Even if there was an increase in the knowledge about the ancient Near East and antiquity in general from the time of Marx to Weber to Polanyi, we have to remember that those periods of history were not the primary concerns of those thinkers. They wondered about, and sought to explain, their own present. The past was a world with differences that were interesting chiefly for the contrasts they provided. Their theories contain important tools of analysis, however. They urge us to look at questions with a particular focus. To use a Marxian analysis of the ancient economy does not mean that one accepts that anything Marx said about the topic was correct that would set scholarship back more than a century but his ideas can be useful guides for our approaches to historical questions. The study of history shows us that each society has its own characteristics and that all elements we observe need to be placed in their local context. The challenge is to find such a context, and this can be impossible. By rejecting grand theories, we can become stuck in a post-structuralist impasse, and it is here that I want to recommend pragmatism and also tolerance. We need to place our studies, even an analysis of five loan contracts, in a wider context and that context will remain explicitly hypothetical. We should be aware about what its inspiration is, however, and be candid about it. I do not suggest that each edition of a document should be preceded with a statement of the author’s view on the structure of the economy, but our language should be clear for its intellectual genealogy. Moreover, we should acknowledge that an approach inspired by another ideology can have its benefits. Thus, the use of tools of modern economic analysis can be helpful, as long as we do not create the impression that the ancient economy was just like the modern one. The study of the economic history of the Near East still has an enormous number of questions and data to be explored. It should continue at the rate we observe in recent decades. I urge scholars from other historical disciplines to look at the ancient Near East more than they have done so far. As I stated in the beginning of this article, we have an unparalleled riches of material and we should mine it as much as we can.

Marc Van De Mieroop

63

Bibliography Diakonoff, I. M. 1982. “The Structure of Near Eastern Society Before the Middle of the 2nd Millennium BC.” Oikumene 3:7-100. Driel, G. van. 1999-2000. “The Size of Institutional Umma.” AfO 46/47:80-91. Driel, G. van. 2002. Elusive Silver: In Search of a role for a market in an agrarian environment; aspects of Mesopotamia's society. Leiden: Nederlands Instituut voor het Nabije Oosten. Edzard. D. O. 1960. “Die Beziehungen Babyloniens und Ägyptens in der mittelbabylonischen Zeit und das Gold.” JESHO 3:38-55. Engels, F. 1884. The Origin of the Family, Private Property and the State. In The Marx-Engels Reader, edited by. R. C. Tucker, 2nd ed./ 1978: 734-59. New York: W. W. Norton. Gelb, I. J. 1967. “Approaches to the Study of Ancient Society.” JAOS 87:1-8. Goddeeris, A. 2002. Economy and Society in Northern Babylonia in the Early Old Babylonian Period (ca. 2000 - 1800 BC). Louvain: Uitgeverij Peeters and Departement Oosterse Studies. Larsen, M. T. 1982. “Caravans and Trade in Ancient Mesopotamia and Asia Minor.” Bulletin of the Canadian Society of Mesopotamian Studies 4:33-45. Lipinski. E. 1979. State and Temple Economy in the Ancient Near East. Louvain: Uitgeverij Peeters. Liverani, M. 1972. “Elementi ‘irrazionali’ nel commercio amarniano.” OA 11:297317. Liverani, M. 1976. “Il modo di produzione.” In L’alba della civiltà. vol. 2: L’economia, edited by S. Moscati: 1-126. Turin: UTET. Polanyi, K. 1957. “Marketless Trading in Hammurabi’s Time.” In Trade and Markets in the Early Empires, edited by K. Polanyi, C. M. Arensberg, and H. W. Pearson: 12-26. Chicago: Henry Regnery Company. Polanyi, K. 2001. The Great Transformation. 2nd paperback ed. Boston: Beacon Press. Powell, M. 1999. “Wir müssen unsere Nische nutzen: Monies, Motives, and Methods in Babylonian Economics.” In Trade and Finance in Ancient Mesopotamia, edited by. J. G. Dercksen: 5-23. Instanbul: Nederlands HistorischArchaeologisch Instituut. Pulak, C. and Bass, G. 1997. “Ulunburun.” In The Oxford Encyclopedia of Archaeology in the Near East, edited by E. Meyers, vol. 5: 266-8. New York and Oxford: Oxford University Press. Renger, J. 1994. “On Economic Structures of Ancient Mesopotamia.” Orientalia 63:157-208. Renger, J. 1995a. “Institutional, Communal, and Individual Ownership or Possession of Arable Land in Ancient Mesopotamia from the End of the Fourth to the End of the First Millennium B.C.” Chicago-Kent Law Review 71:269319. Renger, J. 1995b. “Subsistenzproduktion und redistributive Palastwirtschaft: Wo bleibt die Nische für das Geld?” In Rätsel Geld. Annäherungen aus ökonomi-

64

Economic Theories

scher, soziologischer und historischer Sicht, edited by W. Schelkle and M. Nitsch: 271-324. Marburg: Metropolis Verlag. Renger, J. 2002. “Wirtschaftsgeschichte des Alten Mesopotamien: Versuch einer Standortbestimmung.” In Material Culture and Mental Spheres, edited by A. Hausleiter et al.: 239-65. Münster; Ugarit Verlag. Schneider, H. 1990. “Die Bücher - Meyer Kontroverse.” In Eduard Meyer. Leben und Leistung eines Universalhistoriker, edited by W. M. Calder and A. Demondt: 417-45. Leiden: Brill. Slotsky, A. 1997. The Bourse of Babylon. Market Quotations in the Astronomical Diaries of Babylonia. Bethesda: CDL Press. Snell, D. 1997. Life in the Ancient Near East. New Haven: Yale University Press. Steinkeller, P. 1996. “The Organization of Crafts in Third Millennium Babylonia: The Case of the Potters.” Altorientalische Forschungen 23:232-53. Steinkeller, P. 1999. “Land-Tenure Conditions in Third-Millennium Babylonia: The Problem of Regional Variation.” In Urbanization and Land Ownership in the Ancient Near East, edited by M. Hudson and B. Levine: 289-329. Cambridge, MA.: Peabody Museum of Archaeology and Ethnology. Van De Mieroop, M. 1999. Cuneiform Texts and the Writing of History. London: Routledge. Veenhof, K. R. 1972. Aspects of Old Assyrian Trade and its Terminology. Leiden: Brill. Weber, M. 1983. “Protestantism and the Spirit of Capitalism.” In Max Weber on Capitalism, Bureaucracy, and Religion, edited by S. Andreski: 111-25. London: George Allen & Unwin. Zaccagnini, C. 1981. “Modo di produzione asiatico e Vicino Oriente antico. Appunti per una discussione.” DialArch NS 3/3:3-65. Zaccagnini, C. 1987-90. “Markt.” In RLA, edited by. D. O. Edzard, vol. 6: 421-26. Berlin and New York: Walter de Gruyter.

MODERN ANCIENTS Morris Silver Ancient man was quite peculiar. His economic “ethics” were different from our own. However, the peculiarities of ancient man reflect adaptations that made economic man workable. I refer to the entire complex of ancient institutions and practices, most notably emphasis on the sacred1, that limited transaction costs— that is, the resources used up in exchanging ownership powers, including costs of communication, acquiring and disseminating information, and designing and enforcing contracts—and thereby enlarged the social space within which markets and economic motivations and, consequently, economic analysis might function. Hence, my title “Modern Ancients”. Classical scholars such as Finley and Cartledge (1998: 7) are quite wrong in believing that “the categories of neoclassical economic analysis” have “no useful application to ‘the ancient economy’.” Near Eastern scholars such as Garfinkle (2000: 254) are simply misinformed when they assert: “The differences in the relationship among the available mechanisms of exchange (redistribution, reciprocity, and the market) between the ancient and the modern worlds decisively rules out the application of modern economic theory to the study of the ancient world.” This paper surveys some of the space occupied by the ancient economy. The first part gives attention to the role of supply and demand in the markets for goods and loans. The second part is intended to show that ancient economies were capable of making “efficient” adaptations to economic forces. By “efficiency” the economist means maximization of output/result for a given input of resources or, the other side of the same coin, minimization of resource cost for a given output/result. Illustrations are chosen from different places and times. The third part of the paper considers an “inefficient” adaptation to government regulation in Nuzi’s loan market. Finally, several examples of economic misconceptions in the literature are discussed. The aim here is not to criticize individual scholars but to show that even rudimentary knowledge of modern economic analysis is capable of enhancing our understanding of ancient societies.

1

The important role for the sacred in the making of contracts; the performance of magical technology; the substitution of memory, recitation, and symbolic gestures for general literacy; the emphasis on professional standards and maintaining a good name; the prominence of women in entrepreneurial roles; and, more generally, the elevation or extension of familial ties and other departures from impersonal economics in the markets for both consumer goods and productive factors must be understood as major structural adaptations permitting advanced cooperation in ancient economic life. These peculiar behavior patterns of ancient economic man must be understood not as social constraints on an otherwise autonomous economy, but as facilitators of economic growth and well-being in a world of otherwise high transaction costs.

66

Morris Silver

1. Response of Prices to Changes in Supply and Demand A. Goods 1. Letters from Nippur dated to the mid-eighth century provide indications of market-influenced values. A few examples should suffice: a. “Offer me (an amount of wheat worth) four and one-half minas according to the rate of exchange there and send (it)” (Cole 1996: 128) b. “Give wheat to PN and let him sell to the house which he prefers. (But) who will offer a higher price than the market place? (mannu k ma mach ri ishaqqâ, literally “Who will be high like the market place?”) (Cole 1996: 106). c. “Concerning the property of my Lord – in terms of silver it has gone up in value” (anu muchhi kaspi elû) (Cole 1996: 140). 2. Changes in supply conditions due to political disorder or the initiation or lifting of sieges might be accompanied by steep changes in grain prices. A famous reflection of this fact is found in 2 Kings 7. 1, wherein the ninth-century prophet Elisha announces that a Syrian siege will be lifted, and “tomorrow about this time a measure of soleth (fine wheat flour) shall be sold for one shekel, and two measures of barley for a shekel in the gates of Samaria.” Earlier, in 2 Kings 6.25, it is reported that the head of a donkey sold for 80 shekels and “one-quarter kab” of “doves' dung” for 5 shekels. In short, Elisha recognizes that an increase in the quantity of grain supplied will lower market prices (in terms of precious metals). In Sumerian Ur III times, there is an indication of destabilization of the grain market during an invasion by the Mardu. The royal agent Ishbi-Erra, who had already purchased some 72,000 bushels of grain, complains to his ruler Ibbi-Sin (2028-2004) that “The market price of grain has reached one gar (per shekel)” (translation of Michalowski cited by Frayne 1997: 367). Similarly, a Sumerian literary text of as early as 2000 called “The Curse of Agade” causally links exorbitant prices of grain, oil, wool, and fish with the breakdown of land and sea communications and drought and adds that the latter commodities were sought like “good words.” To digress somewhat, the meaning of “good words,” I believe, also reflects concern with economic conditions. It emerges from 1 Kings 12, wherein the Israelites ask King Rehoboam to lighten the “heavy yoke” and “grievous service” that had been imposed on them by his father Solomon (v. 4) whereupon Rehoboam's advisers urge him to “speak good words to them, then they will be your servants forever” (v. 7) (see Weinfeld 1982). To speak “good words” to the Israelites was to release them from corvée. Similarly, in Greece, Rose (1959: 184) explains, the time of “good words” was a time when “no work must be done, not only by human inhabitants of the farm but the draught-cattle enjoying a holiday.” In the “Tomb Robbery Papyri of the twelfth century,” an Egyptian woman cross-examined by the court concerning gold found in her home explains, “We got it by selling barley during the year of the hyenas, when people were hungry” (Montet 1981: 74-75). Evidently she enriched herself by selling when grain prices were unusually high.

Modern Ancients

67

3. The ancient Near East is known to have experienced periods of steep price inflation. Of special interest in the present connection is Egypt’s inflation under Rameses VII (1149-1142) ( erný 1954: 911, 921; Janssen 1975: 551-52). The price data, covering some 150 years, is distilled with difficulty from papyri and ostraca found at Deir el-Medina. During the later Ramesside era the availability of gold, silver, and copper increased as a result of the looting of temples and tombs. At the very least this is a suggestive coincidence of events. Let us not forget that a rise in commodity prices in the face of an increase in the supply of precious metals would be consistent with the existence of price-making markets (compare Bleiberg 1995: 1376). This topic needs additional research. 4. Climatic conditions were well understood to impact supply and hence price. In a partially preserved stele of the eighth-century from Aksaray in the Anatolian plateau, one Kiyakiya expresses his gratitude for the low price of barley. This expression is prefaced by the statement “and m[uch] came down from the sky, and much came up from the earth” (Hawkins 2000: 124). A prominent priest assured the Assyrian ruler Esarhaddon (680-669) of good climatic conditions and “good prices.” Assurbanipal boasted . [The god] Adad sent down his rains for me, [the god] Ea opened his fountains for me. Grain grew 5 cubits in its furrow, the ear was 5/6 cubits long. … In my reign there was prosperity aplenty, in my years there was fullness to overflowing: 12 homers of barley, 2 homers of wine, 2 s!t of oil, 1 talent of wool. Throughout my land the rate of exchange was excellent, (these items) were bought for one shekel of silver. (Fales 1996: 23) Similarly, the king of Uruk wrote in the mid-nineteenth century about the low prices during his reign: “verily in the market (-price/place) of his (the king's) land, 1 shekel of silver bought 3 gur of barley [instead of the usual 1 gur], or 12 minas of wool, or 10 minas of copper, or 3 ban of sesame oil! May (all) his years be years of abundance!” The point of these examples is not that these prices are historical. 5. There is evidence of seasonal variation in grain prices in Mesopotamia and, possibly, in Egypt. The Babylonian price data show that the price of grain rose before the harvest and declined after the harvest. This pattern of prices is, of course, the result of upward-and-to-the-left shifts in the supply curve of grain in periods after the harvest, due to positive storage and interest costs of holding grain. B. Interest Rates In an unregulated loan market the seasonal decline in the price of grain would cause the interest rate on barley to exceed the rate charged on silver. Indeed, if the seasonal decline in price were 0.10 and the interest rate on silver were 20 percent, we would expect a barley interest rate of 331/3 percent. It is, of course, well known that in late third- to early second-millennium Mesopotamian loan contracts the interest rate on grain loans (331/3 percent) is 131/3 percentage points higher than on loans of silver. There are, however difficulties with respect to the estimate

68

Morris Silver

of the seasonal decline in price.2 This evidence does indicate that the ancient loan market responded in the usual way to the usual economic forces of supply and demand. Or perhaps I should be more cautious and say only the ancient economy was capable of responding in the usual way. In southern Mesopotamia in ca. 1870 there reportedly was an unexplained decline in the barley interest rate from 331/3 percent to 20 percent while the silver interest rate remained at 20 percent. It seems doubtful that this can be explained by some environmental factor, say a change in the south of the seasonal decline in the price of barley. If it were, on the other hand, the result of regulation of the loan market by southern rulers, we would expect grain loans to become quite rare. Admittedly, there is little evidence demonstrating the role of changes in the demand for or supply of loanable funds in the determination of the rate of interest. Skaist, indeed, denies that market forces played any role in the determination of interest rates. Basing himself on a thorough study of Old Babylonian interest rates, Skaist (1994: 140-41) concludes: Consideration of the loan rates per se disproves the view of interest as the price of a loan set by the market. The interest rate on silver loans remained constant at 20% from the early Ur III period, c. 2100 B.C.E., through the reign of Hammurapi, who died in 1750 B.C.E., a period of over three hundred years… There is a similar constancy in the rate of interest on barley loans. In the North the rate of 331/3 goes back to Ur III times and remains in use through the reign of Hammurapi… In the South the rate of 20% remains constant from c. 1870 B.C.E.

2

More concretely, assume an interest rate of 20 percent on silver, set the price of one unit of barley at sowing time at one unit of silver, and let X be the seasonal fractional decline in the price of barley. Then a loan of one unit of silver would (upon repayment) increase the lender's command over barley by 100[(1.20/1-X) – 1] percent. If X equals 0.10 a silver loan at 20 percent would increase the lender's command over barley by 331/3 percent. To do as well, the lender would have to charge 131/3 percentage points of interest more on a barley loan than on silver. The problem here lies in the 0.10 estimate of the seasonal decline in grain prices. It is not totally unreasonable to judge by an eighteenth-century-B.C.E. Babylonian seasonal price change cited by Leemans (1950b: 28-9; 1954: 32-3) or, for that matter, by seventeenthcentury C.E. price changes in England and Belgium (McCloskey and Nash 1984: 182). Leemans (1950b: 29) calculates the post-harvest price decline by subtracting the post-harvest price from the pre-harvest price. The pre- and post-harvest prices are taken from account texts, albeit for two different years. The post-harvest price decline is equal either to 16.6 percent or to 5.7 percent. (This difference results from alternative readings of a number in the pre-harvest text). However, Farber (1974: 36, 118-19l 1978: 18-21) presents Old Babylonian data suggesting post-harvest price declines of 20 percent, 40 percent, or even 47 percent. Price declines of these magnitudes would call for the interest rate on barley loans to exceed the 20 percent rate on silver by much more than the 131/3 percentage points observed in antiquity. However, Farber’s post-harvest prices must be regarded as suspect because, unlike Leemans’, they are not actual prices paid from account texts. Instead, Farber’s “prices” are estimates of prices paid made from difficult to understand credit sale and loan contracts. Given the present state of the evidence, I prefer Leemans’ estimate to Farber’s.

Modern Ancients

69

through the early years of Samsuiluna, a period of approximately 150 years. Such constancy seems inconsistent with a market system. It does make one wonder if royal decree or custom set interest rates. However, it is well to remember that market forces might be active and even potent without generating a long-term trend in interest rates. Such a trend might manifest itself if the marginal propensity to consume out of current income continued to rise or fall over time. Or, alternatively, if the marginal productivity of investment continued to rise or fall over time. However, in the absence of such trends there is little reason to expect a trend in interest rates, especially in “real” interest rates (adjusted for the rate of inflation). In this very connection, Sidney Homer long ago noted the stability of interest rates over several centuries even in the United States (Homer and Sylla 1996: 58-9). I would agree with Skaist (1994: 141) that it is quite reasonable to expect some intermediate term trends when, for example, profitable new markets arose or existing ones disappeared. Changing risk levels might also generate a trend of this kind. One might also expect shorter- term fluctuations in the interest rate, especially in the “money” rate of interest due to inflation or deflation of prices. Let us consider some evidence for the money rate of interest. To begin with note should be taken of the fact that in many loan documents the payment of interest is understood by the inclusion of the terms ur5-ra or, later on, mas gi-na (Sumerian) and (c)hubullum (Akkadian) but the numerical rate of interest is not stated (see Garfinkle 2000: 66ff). Is the reason for this omission to achieve an “economy of writing” (Garfinkle 2000: 77) in a milieu where interest rates were fixed by custom and therefore commonly known? Or is it that they might be variable and subject to individual negotiation? Was the aim, perhaps, to conceal the actual interest rate from the palace? Presumably it would have been a costly matter to check on the agreed interest rate with the witnesses to loan transactions. The answers are not obvious to me. It is known, however, that rulers reviewed loan tablets in enforcing their m sharum-edicts. There are Ur III barley loan interest rates of 301/3, 25, and 20 percent. During the reign of Ammiditana (1683-1647), one of Hammurapi’s successors, there is a barley loan bearing an interest rate of 100 percent (YOS 13, 436). Also within Skaist’s time frame but from outside Mesopotamia proper we find interest rates of 15, 30, and 40 percent in the Old Assyrian texts from Cappadocia. Consistently, with the operation of market forces the b t k!rim charges the relatively low 15 percent Old Assyrian rate to larger, credit worthier merchants. Apparently, ancient creditors took differences in risk levels into account in setting interest rates. Yet we see uninformed denials that such calculations were made on the ground that “This was the Bronze Age, not modern Wall Street or the City of London”! Interest rates of 25 percent are found in Syria at Alalakh during the eighteenth century (Wiseman 1953: 3). So, within Skaist’s approximate time frame we do find evidence of variations in interest rates. At Nuzi, in eastern Assyria, loan documents reveal that the interest rate (strangely) on both silver and grain was usually 50 percent (Owen cited by Jordan 1990: 83). In a few cases there is a 30 percent interest rate on barley loans. Data

70

Morris Silver

provided by Jordan (1990) make it possible to estimate an upper limit for the interest rate implicit in Nuzi’s tidenn"tu contract. Jordan (1990: 79-80) reports that the average loan is 15.05 silver shekels annually and the average gross income from the land is 37.02 silver shekels annually. Obviously, at the very least, cultivation expenses would have to be deducted from the gross income to better approximate the unknown rental value of the field. However, if we use the average loan figure and the average gross income to estimate average rental value, the upper limit for the interest rate is, very crudely, a healthy 146 percent.3 Much later, in Neo-Babylonian times, the usual interest rate on silver remained 20 percent. This rate was expressed as “every month one shekel of silver will be added to one mina” where twelve shekels equal one fifth of a mina. However, despite the traditional Babylonian formulation and metrics there are examples of rates ranging from 5 to 240 percent (Petchow cited by Jursa 2002: 198). Van De Mieroop (1995: 359; 2002: 85) has raised a basic issue that is relevant with respect to observed fluctuations in the interest rate. He notes that among all our numerous Old Babylonian loan texts there is no indication at all that the amounts of interest stated were annual, and that the debtor needed to pay only a fraction of the amount if the duration of the loan was less than a year. The contracts merely state the amount of interest to be added. Different formulae appear. For instance: “Ten shekels of silver, an interest of two shekels is to be added”, or “Seven shekels of silver bearing interest, the interest is one fifth”. In short, the contracts do not state an interest rate but only the absolute amount of interest that will be added to the principal. (Garfinkle [2000: 83-4] agrees with Van De Mieroop and suggests that his conclusion also applies to the Ur III period.) Thus, if Van De Mieroop were correct, the actual interest rate would vary with the period of the loan. The many loans made for periods of less than one year would have (annual) rates higher, perhaps much higher, than 20 or 331/3. “A tenday loan at 20 percent, not unusual in the documentary record [for the Old Babylonian period], would amount to an annualized 720 percent in our reckoning, not even taking compound interest into account” (Van De Mieroop 2002: 85). Van De Mieroop (1995: 362) suggests that interest rates might be extremely high for consumption loans taken out immediately before the harvest. Jursa (2002: 199) offers support for Van De Mieroop’s suggestion by noting that in Neo-Babylonian times the interest rate on barley might be 20 percent “but often it was not 20 percent per annum, but a flat 20 percent rate, irrespective of the ‘life’ of the loan”. On the other hand, Vargyas (2000: 1102), argues that the Babylonians were well able to compute interest on a monthly basis and he concludes that Babylonian interest rates “were calculated on a yearly basis, just as today.” Here I must leave this question. Interest rates do exhibit variation and there is room for market determination. 3

Jordan (1990: 84), utilizing the (some 101) individual Nuzi land-field tidenn"tu contracts, calculates an average annual interest rate of 327 percent. The median value for the 101 observations on the interest rate is 251 percent. Again, recall that agricultural expenses have not been deducted from the gross income from the land.

Modern Ancients

71

However, I have been able to find only one case in which a textual source explicitly indicates a role for supply and demand. I refer in this connection to a decree of the later fifth century B.C.E. in which Plotheia, a district in Attica, makes available a considerable sum of money and calls for it to be lent out to the borrowers offering the highest interest rate (ll. 15-18; see Millett 1991: 173-74). Given the decree’s open-ended stipulation regarding the interest rate, I find it difficult to follow, Millett’s (1991: 176) conclusion that “the deme leased and lent how and when it suited them best and were not responsive to changing patterns of demand, even from their own demesmen.” I should append to this discussion that I have not found any evidence, textual or otherwise, attesting to the nonoccurrence of market forces in the determination of interest rates. 2. Economically Efficient Adaptations in the Ancient Economy A. Deposit Banking in the ANE and Greece In connection with deposit banking, in the ANE Oppenheim (1969) calls attention to cuneiform sources of the first half of the second millennium and the seventh to sixth centuries that refer to sealed bags of silver (kaspum kankum) deposited with persons who used the silver in various transactions. Excerpts from Old Assyrian letters are revealing in this respect: “seal and give the x minas of silver and the interest on it to PN”; “two minas of refined silver and the interest on it for ten years”; and “for thirteen years the silver has been accumulating interest with you” [CAD S/1a 158-9 s.v. sibtu]. There is some evidence suggesting that in the later Neo-Babylonian period, promissory notes were employed to transfer money from third parties to a lending house (the Egibi). The productive use of deposits of money would have been advantageous to both the depositor and the depositee. I find it difficult to believe that, in an economic system with the sophisticated credit instruments and techniques known in the ANE, depositors invariably would have insisted not upon the return of equal value, but upon the same physical ingot (or coin) they had deposited. Ancient businesspersons were not shy about pursuing gain. Therefore, absent evidence to the contrary, it is reasonable to assume that deposits were employed productively. Dandamayev (1999: 374), however, states unequivocally that the Egibi and other Neo-Babylonian business houses “did not use the money entrusted to them on deposit as a means of credit but worked with their own resources.” He does not explain how he knows this to be the case. No doubt Dandamayev means that no textual source directly attests to this practice. It is true that sometimes the Egibi received deposits in leather sacks and returned them with intact seals. Wunsch (2002: 247) maintains: “There is no evidence that the Egibis borrowed money to lend at a higher interest rate so as to achieve a profit from the margin.” Did the Egibis, on the other hand, use deposits to make investments in wholesale commodity trade, food processing, land, and slaves? Wunsch (2002: 248) notes in tantalizing fashion that when an Egibi “used a deposit or part of it for his own purposes,

72

Morris Silver

he had to pay interest on it (e.g., Nbn 44).” A significant clue in favor of deposit banking is provided by the use in the Old Babylonian period of the verb qi!pu to mean both “to lend” and “to deposit” (see CAD Q/A 3-4 95-7 s.v. qâpu). Westbrook (1991: 121) has observed, citing Szlechter, that this pairing of meanings is consistent with the existence of the “depositum irregulare, that is, the transfer of generic goods of which the transferee becomes the owner, with an obligation to restore not the same goods but the same quantity of like goods at a later date.” The “irregular” or “non-sealed” deposits were a significant asset of the Roman argentarii “deposit banks” (Andreau 1999: 40). Westbrook’s hypothesis finds support in an Old Babylonian text: “even if he (the partner) entrusts (the silver) for trade or lends it (to a third party), the creditor will not accept (that as an excuse), he (the partner) has to pay the silver to the holder of his note” (CAD Q/ A 3b 96 s.v. qâpu). Under the specified circumstances “the partner” cannot pay out the same physical silver that was entrusted to him by “the creditor”. Further, with respect to the possible productive use of deposits, note should be taken of the rather imprecise maxim of the Egyptian scribe named Any at the beginning of the first millennium or, perhaps, as early as the middle of the second millennium: “If wealth is placed where it bears interest it comes back to you redoubled” (Lichtheim 1976: 11: 135). Literally: “Possession should be placed on its place of interest, so that it may come back to you enlarged” (Joachim Quack, personal correspondence dated February 15, 2002). Another lead, again difficult to pin down, is provided in the Odyssey (3.36568), wherein the disguised goddess Athena announces that she will go to the Kaukônas, apparently in the Pylos area, “where a debt owed to me has been piling up, it is not a new thing nor a small one” (Lattimore 1965; West 1988: 183). For Athens in the fourth century B.C.E., we have direct evidence that one large banker unquestionably lent out his deposits. A speech of Demosthenes reveals that more than 20 percent of the banker Pasiôn’s loans came from deposits (Millett 1991: 203). Unfortunately, with the exception of Pasiôn, there are no balance sheets offering explicit testimony to the extent that deposits were commingled with the assets of banker-lenders. However, additional nonquantitative examples of commingling may be cited. For example, Demosthenes (36.11) also suggests that a judgment against the banker Phormiôn would result in losses to depositors in his bank. As Cohen (1992: 65, 176, n.268) points out, this argument would make no sense unless Phormiôn had commingled his assets with those of his depositors (cf. Andreau 1999: 39-41). These examples demonstrate that deposit banking was practiced in the second half of the fourth century B.C.E. and probably much earlier. Given that: (1) Demosthenes expresses no surprise or disbelief in mentioning the above cases and (2) that the state-of-the-art in monetary technology surely made money fungible and (3) a modicum of rationality, we may assume that deposit banking was commonplace (compare Millett 1991: 8-9). Indeed, to the best of my knowledge, the orators do not provide even a fleeting example of a trapezit#s “banker” who denies or refuses to make productive use of deposits. Why did Greeks make deposits in banks? Obviously, they did so to keep their

Modern Ancients

73

money safe or to conceal it from the tax collectors. But this is not the whole story. Cohen (1992: 112) demonstrates that in some cases trapezitai offered depositors a direct monetary return and in others they provided benefits in the form of banking services and access to business opportunities (such as participation in maritime loans). B. Adaptations to New Economic Opportunities: The Case of Babylonian Agriculture4 Changes in agricultural land usage and settlement patterns in the ancient world may reflect changing opportunities for trade rather than, as usually believed environmental or ethnic variables. This section illustrates the kinds of profound economic transformations that often accompany the opening of new markets for new agricultural products. Paleobotanical and textual evidence strongly suggests that by the end of the third millennium, southern Babylonian agriculture had experienced a drastic reorientation, away from the cultivation of wheat and into that of barley. Wheat declined to 2 percent of the crop and then disappeared in the first half of the second millennium.5 (Possibly southern Babylonia became a net importer of wheat during the Old Babylonian era.) This change has been interpreted as a reaction to soil salinization due to widespread irrigation agriculture, with barley being more salt tolerant than wheat (see especially Jacobsen 1982: 9-11, 16, 57-60, 67; Powell 1985). On the other hand, although agricultural documents of this period are abundant, they do not, in contrast to those of the third millennium, refer to soil salinity. Note in this connection the term ki-mun “ground of salt.” Moreover, as Adams (1981: 149-52) explains, agriculturalists would, in any event, have cultivated more barley to provide fodder for their enlarged herds of sheep. Texts from Ur III Sumer frequently mention barley-fed sheep. There is indeed evidence of a revival in the export of woolen garments to Tilmun (often identified with Bahrain). Butz thinks it possible that Tilmunites were actually settled near Eridu and the Hor (al Hammar), where Ur’s Nanna and Ningal temples had pastures (cited by HowardCarter 1987: 89). These locations would have permitted Tilmunite merchants to monitor the packing of the wool they purchased, as in thirteenth-century England (Silver 1984: 113), or even to participate directly in wool production. 6 4 5

6

This section is adapted from Silver (1995: 189-91). Adams (1981: 151-52) and Jacobsen (1982: 39) present data indicating that grain yields declined from ca. 2400 to ca. 2100 and, perhaps, to ca. 1700. But, aside from the intrinsic measurement problems, such changes need not be due to deterioration in soil quality. If, for good economic reasons, cultivators decided to increase the intensity of land use (relative to labor) in the cultivation of grain, the result, other things equal, would be lower yields per unit of land (see Pettinato and Waetzoldt 1975 and Silver 1983b: 641-2). Less frequent fallowing of land would operate to reduce its yield. Sources for concentration of land ownership, trade, and sheep herds: Adams (1981: 149-50); Hallo (1965); Leemans (1950a: 65-66; 1960a: 18-22; 1960b: 13, 36, 54, 117; 1968: 178-79; 1975: 139-40; 1983: 93-94); Potts (1983: 128); Stone (1977: 284).

74

Morris Silver

A variety of qualitative indicators and quantitative data on real wages (in terms of silver and barley) suggest that in the earlier second millennium Babylonia enjoyed significant prosperity if not, as some believe, a “golden age” (see, e.g., Farber 1978: 38-40; Leemans 1950a: 113). Indirect evidence of increased meat consumption is provided by Oppenheim's (1967: 44-45) observation that “references to fishing and the role of fish as a staple diet begin to become rare in the second half of the Hammurabi Dynasty,” suggesting that another “protein-rich source of food came newly within reach.” Indeed, a nineteenth-century text from Larsa shows “fat-tailed sheep” being consumed, apparently as part of the remuneration of canal-diggers (Crawford 1973: 232-34; Gelb 1973: 82-83). These considerations open the possibility that specialization in stockbreeding and land consolidation may have been triggered by increased external demand for wool and textiles, combined with an increased demand for meat in response to higher incomes. An economic change explanation of the shift from barley to wheat is also strengthened by the fact that salinization is by no means inevitable. It can, as Adams (1981: 149-52) points out, be controlled by appropriate land use and irrigation practices. That this fact was understood at the time is hinted at by the recommendation of a fallow system and elementary forms of drainage in a Sumerian “agricultural manual,” actually a literary text inscribed in ca. 1700 B.C.E. Indeed, texts from Girsu in Lagash show us as early as the twenty-fourth century the effort to combat soil salinity by means of a weed fallow system to dry the soil deep down. Powell (1985: 37-38) has brought together additional evidence of measures to control salinization. The evidence is consistent with the perspective that the decision by ancient agriculturalists to channel scarce investment resources into building up flocks and converting fields into pastures instead of investing in antisalinization projects (weed fallows, application of irrigation water in excess of immediate crop needs, intensive drainage systems) was a rational (in cost-benefit terms) response to newly emerging market opportunities. Note further that the rising trend in stockraising, a relatively land-intensive production activity, may well have contributed to a decreasing trend in the population in the former heartland of southern Mesopotamia (Brinkman 1984: 172-74). Predictably this change in economic specialization would also have caused an increase in the importance of the extended family relative to the nuclear family organization. Lemche (1985: 193) comments that documents gathered by Liverani “seem to indicate that the extended family dominated Mesopotamian society around 2000”. C. Geographic Concentration of Trades Marketplaces—the geographic concentration of transactions—are a predictable and easily implemented adaptation to high information and transportation costs. In a world without daily newspapers, the location of similar trades in a compact area would have reduced the cost to consumers of acquiring information

Modern Ancients

75

about prices and product characteristics. The benefits to consumers were not forgone. There is ample evidence for marketplaces in antiquity. 7 Several of Jerusalem's gates appear to have specialized in particular kinds of merchandise: the “Fish Gate” (Zephaniah 1.10; 2 Chronicles 33.14; Nehemiah 3.3), the “Sheep Gate” (Nehemiah 3.1, 32; 12.39), and the “Pottery Gate” (Jeremiah 19.2). That Egypt was also familiar with specialized marketplaces emerges from Montet’s (1964: 97) observation that in “the scenes depicting the various arts and crafts they are almost always shown in groups on tombs of all periods.” Indeed, Old Kingdom Egyptian tombs depict several sellers of the same product extolling their wares to buyers (Müller-Wollerman 1985: 142). A text of the Fifth Dynasty places an areret nehep “gate of potters” at the solar-temple of Neferikare. An indication of pronounced locational specialization is found at Athens in the inclination of Athenian writers to identify places in the Agora with the goods sold there (wine, olive oil, pots, garlic, fish, perfume, clothes). Rome of the early Empire had a number of markets specializing in different types of slaves. D. Urban Real Estate Market in Old Babylonian Sippir With respect to the urban real estate market there is evidence that in Old Babylonian Sippir “roofed areas” were generally more expensive than “open areas,” including unbuilt lots, courtyards, and unimproved land (see Van De Mieroop 1999: 270-1). This differential is as expected. However, Van De Mieroop (1999: 274) adds “It seems rare that someone moved into a neighborhood and bought himself a house as we do today.” This probabilistic statement seems to go far beyond the evidence. The texts do not disclose whether the buyer of a house is or is not a total stranger. Kozyreva’s (1999) findings are of interest in this connection. In some 1,200 private urban real estate transactions in southern Mesopotamia dating to the early Old Babylonian period, the god most frequently mentioned in the seal inscriptions was the West Semitic deity Amurru. Therefore, “It seems logical to conclude that a considerable proportion of urban real estate buyers were the people who had moved into the cities rather recently, i.e., newcomers or their descendants” (Kozyreva 1999: 356). Van De Mieroop’s rebuttal to the modernistic implications of Kozyreva’s logic does not convince me. More basically, there is ample evidence of an urban real estate market including the sale and rental of houses or parts of houses (see e.g. Greengus 2001: 260-2). 3. Nuzi’s Loan Market: An Inefficient Adaptation to Palace Regulation Nuzi’s tidenn"tu contracts were in all likelihood ingenious subterfuges or creative options designed to overcome legal obstacles to lending transactions viewed by the palace as “exploitative”. The adaptations were economically inefficient (relative to an unregulated loan market) because they raised the cost of making loans and consequently reduced the availability of credit. 7

The discussion of marketplaces is adapted and revised from Silver (1995: 153-6).

76

Morris Silver

Note that government intervention in the economic sphere is reflected by the inclusion in many contracts, among them sale-adoption and tidenn"tu contracts, of a sh"d"tu clause: “This tablet was written in Nuzi after the proclamation” (see, e.g., Müller 1971: 56-58: Zaccagnini 1975: 197, 200). The sh"d"tu clause itself appears in the contracts only after a certain point in time. Further, several texts refer to “the new proclamation.” In one legal text, an individual is accused of having violated the sh"d"tu. A trial document hints vaguely at control over grain prices (or interest rates) by local governments. The dispute involves the advance of a shekel of gold, to be repaid; it appears, after the harvest in barley at the going market price. But in his defense the borrower successfully refers to a statement by the “elders(?)” of Tupshani(ni) that the lender must take barley “according to our price” (after Müller 1981: 446). Basically speaking, in the land-field tidenn"tu contract the landowner (debtor) surrenders the use of his field to a creditor in return for the loan of cash. When, after a definite or contractually unspecified period, the landowner returned the creditor’s cash he regained control over his field. To illustrate, assume that the landowner receives a loan of 100 silver shekels and turns over to the creditor for one year a field with an annual rental of 150 silver shekels. Then the implicit annual rate of interest is 50 percent (see Ellickson and Thorland 1995: 395). The economic result of the transaction is the same as an ordinary loan contract specifying repayment of 150 shekels or 150 shekel’s worth of agricultural produce or specifying an annual interest rate of 50 percent. (Ordinary loan contracts were well known in Nuzi [Jordan 1990: 83].) However, the tidenn"tu form of loan contract had three salient advantages over a straightforward loan: 1. The tidenn"tu form concealed the interest rate charged from persons uncertain about the rental value of the field, most importantly legal authorities seeking to enforce a ceiling on interest rates (cf. Silver 1983a: 238-9). 2. Direct working of the field by the creditor concealed from the legal authorities that the tidenn"tu is a loan transaction. Hence the creditor did not run the risk of default when the legal authorities, as they were wont to do, issued a proclamation canceling repayment of ordinary loans. 3. In the event of default on an ordinary loan the creditor might seize the assets of the debtor or his person. The protection of the creditor was reduced when, as was probably the case at Nuzi, the legal authorities erected obstacles to the alienation of fields. In this legal context the creditor in a tidenn"tu contract reduced default risk by keeping the produce from the field (compare Ellickson and Thorland 1995: 396-99). With respect to the tidenn"tu and m!r"tu transactions, the main lesson is that when ancient governments sought to stamp out economic exploitation, ancient men and women sought in their economic interests to find legal expedients by means of which they might continue to exploit or be exploited.

Modern Ancients

77

4. Economic Principles and Economic Misunderstandings The aim of this discussion is to make a plea for improved understanding of basic economics not to criticize outstanding scholars. Mistakes are inevitable when scholars work outside their fields. A. Role of Speculators Van Driel (1999: 33, n.21) believes that “The (private) hoarder [of grain] exacerbates the shortage and profits from it. Joseph in Egypt is an excellent example.” This is economically naïve and completely misunderstands the crucial role that speculation plays in a market system. The point to remember is that speculators not only buy, they sell. Private speculation serves to even out the consumption of grain over time. Grain prices fall after the harvest as farmers put their grain on the market. The decline in prices encourages consumers to purchase and consume more grain, including for feeding it to livestock. This is of course good for consumers. But what will happen tomorrow when the harvest has been mostly sold and consumed? The answer is that prices will rise and some consumption needs will not be fulfilled. The role of the speculator is to purchase grain after the harvest and store it. This grain storage limits the immediate decline in price, which is bad for consumers. Some consumption needs must go unfilled. On the other hand, the speculator sells grain later in the year, which limits the rise in price. This is good for consumers. The speculator profits to the extent that he correctly anticipates the level of storage costs and of future grain prices. To the extent that he anticipates accurately the speculator also performs a useful social function that was no part of his intention. Of course, competition among speculators reduces their profit and increases the benefit to consumers. When speculative activity is monopolized, including by the palace, the balance of benefits is shifted away from consumers towards the speculator. The fact remains, however, that to make a profit “Joseph” must sell grain. B. Transport Costs and Trade in Staples Despite evidence of various kinds to the contrary, some scholars of antiquity seek to demonstrate that due to high transport costs overland trade in staples was seldom undertaken. Hopkins (1983: 102-5), for example, is justly skeptical of the extent to which Diocletian’s Edict provides a reliable guide to actual transport costs. His criticisms are somewhat exaggerated, however. For example, in disputing the estimate that overland transport of wheat for 300 miles roughly no more than doubled its cost, Hopkins (1983: 105) reasons as follows: To judge from scattered Roman evidence and comparative data, twice the normal price was common in famines. [Then] wheat could have been sent overland to relieve a local famine within a radius of 300 Roman miles (444 km.). But during a serious famine at Antioch in AD 362/3 this did not happen, or not until

78

Morris Silver

the emperor Julian intervened personally to secure large quantities of wheat from towns only 50 and 100 km. distant by land from Antioch. Hopkins, like Finley (1973: 127; 1985, 245, n.8), does not take into account that, despite the enlightened protests of Libanius and others, Julian had responded to rising grain prices caused by a severe and prolonged drought at Antioch with an edict of maximum prices and the sale of imported grain at prices below the market-clearing level. These well-meant but counterproductive measures served mainly to misallocate the available stock of grain (see Downey 1951: 315-19; de Jonge 1948). The available grain simply went elsewhere. The problem here was not transport costs but a much more significant problem: Failure to understand the economic facts of life. C. Productive Nature of Exchange Assertions in the literature that only the lender profited from Nuzi’s tidenn"tu contract (and discussions about whether the adopter or adoptee instigated m!r"tu transactions) are economically naive. An uncoerced exchange benefits both parties. Unless each contractor views his postexchange position to be superior to his preexchange position, exchange will not take place. Contrary to the Marxist perspective, exchange is productive. Specifically, trade rearranges an existing stock of goods in a way that enables each participant to become better off as measured relative to his own values at the time of deciding to trade. The creative nature of trade is little appreciated by scholars untrained in basic economic principles. 8 Moreover, assertions about which party to the exchange benefited more are not very helpful. The gains from trade are subjective and cannot be calculated by comparing the number or value of oranges and apples exchanged. Any attempt to compare subjective gains raises the thorny problem of interpersonal comparisons of utility/satisfaction. Even if we ignore this difficulty the results may be surprising. Thus, based upon seemingly unbalanced terms of trade, it is usually assumed that a wealthy industrial nation which imports (say) bananas gains more than the poor, less developed country which produces them. For example, although the assumptions of “unequal exchange” hardly seem to apply in this case, King and Stager (2001: 190) speak of Phoenicia “exploiting” Judah. This reasoning ignores the “law” of diminishing marginal utility of income. That is, because they are poor the citizens of the poor country may gain more utility/satisfaction from consuming their export proceeds than the citizens of the rich country gain from consuming their bananas. 9 8

9

The services of the middleman in “making markets” are also productive. In many cases it is less costly for some individuals to specialize in acquiring information about preferences and costs than for all traders to do so. Garfinkle (2000: 218-19) suggests “In the modern economy we require mediation between buyers and sellers far less frequently than was the case in the ancient world, and this is in part because more of the population is in a position to engage in economizing choices.” This is an interesting suggestion. On the one hand, information is much more widely diffused today than in antiquity. This would reduce the need for the middleman. On the other hand, we are more specialized today, which would increase the need for intermediation. Note in this connection Stager (2001: 629): “Asymmetrical relations of economic advantage

Modern Ancients

79

D. Technological Progress and Efficiency Why, to take a favorite primitivist example, did Rome persist in using animalpowered mills in its bakeries long after the invention of water-powered milling? The reasonable explanation is that to relocate bakeries to sites with sufficient water and then to transport the bread over longer distances to consumers was simply not cost-effective (see Greene 1990: 215). It is of some importance to offer some clarification here concerning the meaning of productivity and efficiency. According to Eyre (1999: 34), a distinguished Egyptologist: There is no evidence for efficient water-raising devices in the [Egyptian] Pharaonic period. The saqia (water-wheel) and the Archimedean screw are not attested until well into the Ptolemaic period. The shaduf [lever-and-bucket], is not efficient. The requirement for a productive method or process to be economically efficient is that, given the costs of the participating inputs/factors of production, it minimizes the total factor cost of producing a given output/result or maximizes the output/result from a given total factor cost. Economic efficiency is always measured relative to available technologies and prevailing factor prices. That later times may have known superior water-raising technologies does not mean that the shaduf was not “efficient” in Pharaonic times. E. Opportunism and Shirking versus Exploitation Marxist and other scholars often find exploitative motives behind actions that are simply adaptations to the costs of making and enforcing contracts in a world in which individuals behave opportunistically. To take an example with biblical implications, note the preference among contemporary nomadic peoples for employing family members as herdsmen rather than strangers (Jamieson 1985: 42325). Among the market-oriented Komachi nomads of southern Iran, hired herdsmen are permitted to run their own animals with their customer's herd but are contractually denied the right to own female breeding stock. Bradburd (1980), an anthropologist, interprets this prohibition in a sinister light: The employing class seeks to alienate its proletariat from the means of production.10 More reasonable than the “Marxist” conspiracy-theory is that the denial of female breeding stock prevents theft of newly born animals and disputes over their ownership. Herdsmen in the ancient Near East typically received a share of the newborn animals as payment. A Babylonian contract of the early second millennium calls can be seen almost from the start because of the system of exchange which operated from the larger underdeveloped hinterland to the major commercial center, the Mediterranean seaport, the command center of information and decision making which translated into real economic power.” This certainly sounds rather ominous. It is another question, however, whether Stager’s “model’ of “port power” tells us something overlooked by standard models of economic development that stress entrepreneurship and adaptations to market incentives. 10 Bradburd’s article is cited with approval by Lemche (1999: 93, n. 7) in his discussion of the relevance of class in ancient Israelite society.

80

Morris Silver

for the shepherd to keep 20 percent of the increase (Finkelstein 1968: 33). For herding Laban's flock, Jacob was to receive the newly born “brown” sheep and variegated color goats (Genesis 30.32-33). Jacob explained that under this innovative arrangement, when Laban came to look over his herd “every one that is not speckled and spotted among the goats, and dark among the sheep ... shall be counted as stolen.” Again, Hammurapi’s Code (Paragraphs 263-67) and herding contracts of his era show that a variety of precautions were taken by owners to prevent thefts of livestock or shirking by shepherds (Postgate 1975: 6-7).11 F. Monopoly Power and the Villager Generally speaking monopolists increase their wealth by reducing quantities offered for sale and raising prices. There is little information on which to base estimates of the importance of monopoly power in the ancient Near Eastern economy. Sumerian texts of about the middle of the third millennium hint that it may not have been great. The seller is “he who gives, who delivers, who eats the purchase price,” and the buyer is “he who measures out the purchase price for good X” (lu.X.sa) or “he who makes or fixes the purchase price” (lu.sa.ak) (see Malul 1985). This terminology probably implies that the seller is typically a price-taker, not that the buyer is typically a price-maker.12 On the other hand, there is evidence that Old Assyrian Assur sought to monopolize the production of woolen cloth for the Anatolian market. Larsen (1982: 41) explains that at one point the Anatolians started the production of a type of textile, which somehow could replace the most common type of import from Assur. Obviously this constituted a major threat, and when Assyrian traders began to conduct trade in these local products, the reaction of the city-assembly was swift and harsh. We have a letter that tells us the assembly had considered the matter and had prohibited Assyrian trade in local Anatolian textiles. The traders who had already engaged in such activities were fined very severely, one of them 10 pounds of silver, which even then was a lot of money. Of course, we do not know whether the guilty Assyrian traders were spoiling the market by passing off the (lower quality?) Anatolian cloth as having been made in Assur or Babylonia. In any event, it is not difficult to see that Renger’s (1984: 73) belief that “certainly the [Mesopotamian] villager had not much choice. He had to pay any ‘price’ if he needed ... [a] hoe for survival” rests on a fundamental misunderstanding of elementary economics. Even if the villager’s demand curve for hoes was perfectly inelastic with respect to price (i.e., vertical) because he “needed the hoe 11 The Hudson’s Bay Company faced a related problem in the eighteenth century. The right of employees to engage in private trapping led to the substitution of low-quality Indian furs for the Company’s high-quality furs. Private trapping was finally declared illegal in 1770 (Carlos and Nicholas 1990: 866-67). 12 We may find an indication of superior bargaining power in a Sumerian proverb dated to the Isin-Larsa period (SP 18.6 = SP 26 rev. i 2 [restored]): “He who pays with strong silver (valid) silver can buy with a strong mouth” (Alster 1996: 5). I would take this to mean that the buyer who pays cash can obtain a better price from the seller.

Modern Ancients

81

for survival,” the market equilibrium market price of hoes might be “low” (relative to the villager’s total income) provided that there were a number of competing (noncolluding) sources of supply. Indeed, even if the palace monopolized the sale of hoes the villager nevertheless might manage to retain some of his income by making the hoe himself. Along similar lines, Van De Mieroop (1995: 362) believes that many of the loans we find attested in the Old Babylonian sources were obtained in times of dire need. In the last month before the harvest a farmer who could not feed his family any longer, needed to borrow grain. The creditor could set his terms, as he or she knew that the borrower had no other choice. It may be true that the interest rates paid before a harvest were relatively high. However, Van De Mieroop’s economic analysis is simplistic. Supply must be considered as well as demand in determining price. The creditor could “set his terms” only in the absence of competing lenders. Van De Mieroop presents no evidence that the Old Babylonian loan market was monopolized. Garfinkle (2000: 38) maintains that in Ur III times “creditors not only took advantage of the opportunities available in town but also profited from the needs of the agrarian poor, who were extraordinarily exposed to the risks of crop failure, etc.” The other side of this coin of exchange is, of course, that the “agrarian poor” took advantage of the “need” of urban (and rural) creditors to make profitable use of their capital! (Elsewhere Garfinkle [2000: 75] correctly notes that the collection of interest was in the self-interest of the lender.) No evidence is presented by Garfinkle that the Ur III credit market was monopolized. However, given the documented importance of the palace in the Ur III period, I would not exclude this possibility. Concluding Remark The fact that the ancients did not formulate a body of abstract economic principles does not mean that, if only by means of trial and error and imitation, they did not conform to economic laws. Calculation, after all, is costly and more exact calculation is more costly. To carry calculation beyond the point at which its marginal benefit equals its marginal cost is economically irrational. Economic actors who simply ignore or misunderstand changes in costs, returns, tastes, and the like, are less likely to flourish and leave their mark on the economy than those actors who, however imperfectly, heed trends in economic variables. Economic actors who refuse to imitate successful economic actors or are incapable even of discerning them are more likely to fail. As Alchian explained in a seminal article first published in 1950. Like the biologist, the economist predicts the effects of environmental changes on the surviving class of living organisms; the economist need not assume that each participant is aware of, or acts according to, his cost and demand situation. These are concepts for the economist’s use and not necessarily for the individual participant’s, who may have other analytic or customary devices, which, while of interest to the economist, serve as data and not as analytic meth-

82

Morris Silver

ods. (Alchian 1977: 34) To attain a more balanced view of the ancient economy it must be recognized that economic theory is concerned primarily with prediction of the direction of changes in economic behavior and in orders of magnitude. It is inappropriate for Polanyist scholars to seek to delegitimize or preempt the research of professional economists by maintaining that the ancient sources are insufficiently available in transliteration and translation (see e.g., Renger 2001: 414). This is simply false and, in fact, the Internet has opened a treasure of resources for nonlinguistic scholars. Sadly, it is true, however, that only a mere handful of professional economists have so far chosen to immerse themselves in the study of ancient economies. The full participation of professional linguists and historians in this enterprise is therefore essential and welcome. Assyriologist Johannes Renger (2001: 414) suggests, “we have to take the burden of being our own, self-made, economic historians”. I would agree with Renger provided that his “burden” includes taking an introductory course in economics or simply reading a principles text before issuing authoritative pronouncements about economics.

Modern Ancients

83

References Adams, Robert McC. (1981). Heartland of Cities. Chicago: University of Chicago Press. Alchian, Armen A. (1977). Economic Forces at Work. Indianapolis, Indiana: Liberty Press. Alster, B. (1996). “He who Pays with Valid Money: On the Status of Merchants in Early Mesopotamia.” In Ö. Tunca and D. Deheselle (eds.), Tablettes et Images aux pays de Sumer et d’Akkad. Liège: Université de Liège, 1-6. Andreau, Jean. (1999). Banking and Business in the Roman World. Cambridge: Cambridge University Press. Bleiberg, Edward. (1995). “The Economy of Ancient Egypt.” In Jack M. Sasson, John Baines, Gary Beckman, and Karen S. Rubinson. (eds.), Civilizations of the Ancient Near East, Vol. III. New York: Scribner’s Sons, 1373-85. Bradburd, Daniel A. (1980). “Never Give a Shepherd an Even Break: Class and Labor among the Komachi.” American Ethnologist, 7, 603-20. Brinkman, J.A. (1984). “Settlement Surveys and Documentary Evidence: Regional Variation and Secular Trend in Mesopotamian Demography.” JNES, 43, 16980. Carlos, Ann M., and Stephen Nicholas. (1990). “Agency Problems in Early Chartered Companies: The Case of the Hudson's Bay Company.” Journal of Economic History, 50, 853-75. Cartledge, Paul. (1998). “The Economy (Economies) of Ancient Greece.” Dialogos, 5, 4-24. erný, Jareslav. (1954). “Prices and Wages in Egypt in the Ramesside Period.” Journal of World History, 1, 903-21. Cohen, Edward E. (1992). Athenian Economy and Society. A Banking Perspective. Princeton, New Jersey: Princeton University Press. Cole, Steven W. (1996). Nippur IV: The Early Neo-Babylonian Governor’s Archive from Nippur. Chicago: Oriental Institute. Crawford, H.E.W. (1973). “Mesopotamia's Invisible Exports in the Third Millennium.” WorldArch, 5, 232-41. Dandamayev, Muhammad A. (1999). “Land Use in the Sippar Region during the Neo-Babylonian and Achaemenid Periods.” In Hudson and Levine. (eds.) Urbanization and Land Ownership in the Ancient Near East, 363-87. Downey, Glanville. (1951). “The Economic Crisis at Antioch under Julian the Apostate.” In P.R. Coleman-Norton (ed.), Studies in Roman Economic and Social History. Princeton, New Jersey: Princeton University Press, 312-21. Van Driel, G. (1999). “Capital Formation and Investment in an Institutional Context in Ancient Mesopotamia.” In Jan Gerrit Dercksen (ed.), Trade and Finance in Ancient Mesopotamia. Leiden: Nederlands Historisch-Archaeologisch Instituut te Istanbul, 25-42. Ellickson, Robert C. and Charles DiA. Thorland. (1995). “Ancient Land Law: Mesopotamia, Egypt, Israel.” Chicago-Kent Law Review, 71, 321-411. Eyre, Christopher J. (1999). “The Village Economy in Pharaonic Egypt.” In Alan

84

Morris Silver

K. Bowman, and Eugene Rogan. (eds.), Agriculture in Egypt: From Pharaonic to Modern Times (Proceedings of the British Academy 96). Oxford: Oxford University Press, 1-32. Fales, Frederick Mario. (1996), “Prices in Neo-Assyrian Sources.” State Archives of Assyria Bulletin, 10, 11-53. Farber, Howard. (1974). “An Examination of Long Term Fluctuations in Prices and Wages for North Babylonia during the Old Babylonian Period”. Unpublished MA thesis. De Kalb, Illinois: Northern Illinois University. Farber, Howard. (1978). “A Price and Wage Study for Northern Babylonia during the Old Babylonian Period.” JESHO, 21, 1-51. Finkelstein, J.J. (1968). “An Old Babylonian Herding Contract and Genesis 31.38f.” JAOS, 88, 30-36. Finley, Moses. (1973, 1985). The Ancient Economy. Berkeley: University of California Press. Frayne, Douglas (1997). The Royal Inscriptions of Mesopotamia: Ur III Period (2112- 2004 B.C.). Toronto: University of Toronto Press. Garfinkle, Steven J. (2000). “Private Enterprise at the End of the Third Millennium BC.” Unpublished Ph.D. dissertation. New York: Columbia University. Gelb, I.J. (1973). “Prisoners of War in Early Mesopotamia.” JNES, 32, 70-98. Greene, Kevin. (1990). “Perspectives on Roman Technology.” OJA, 9, 209-19. Greengus, Samuel. (2001). “New Evidence on the Old Babylonian Calendar and Real Estate Documents from Sippar.” JAOS, 121, 257-67. Hallo, William W. (1965). “A ‘Persian Gulf Seal’ on an Old Babylonian Mercantile Agreement.” Assyriological Studies, 16, 199-203. Hawkins, J.A. (2000). “1. ‘Ideal Prices’ (2.20).” In William W. Hallo (ed.), The Context of Scripture, Volume II, Monumental Inscriptions from the Biblical World. Leiden: Brill, 123-4. Homer, Sidney and Richard Sylla. (1996). A History of Interest Rates. 3d. ed. revised. New Brunswick, New Jersey: Rutgers University Press. Hopkins, Keith. (1983). “Models, Ships, and Staples.” In Peter Garnsey and C.R. Whittaker (eds.), Trade and Famine in Classical Antiquity. Cambridge: Cambridge Philological Society, 84-109. Howard-Carter, Theresa. (1987). “Dilmun: At Sea or not at Sea? A Review Article.” JCS, 39, 54-115. Hudson, Michael and Baruch A. Levine. (eds.) (1999). Urbanization and Land Ownership in the Ancient Near East. Cambridge, Massachusetts: Peabody Museum of Archaeology and Ethnology, Harvard University. Hudson, Michael and Marc Van De Mieroop. (eds.) (2002). Debt and Economic Renewal in the Ancient Near East. Bethesda, Maryland: CDL Press. Jacobsen, Thorkild. (1982). Salinity and Irrigation Agriculture in Antiquity. Malibu, California: Undema. Jamieson, J.W. (1985). “ ‘Simple’ and ‘Advanced’ Pastoral Societies Contrasted.” Mankind Quarterly, 25, 419-33. Janssen, Jacob J. (1975). Commodity Prices from the Ramessid Period: An Economic Study of the Village of Necropolis Workers. Leiden: Brill.

Modern Ancients

85

de Jonge, P. (1948). “Scarcity of Corn and Corn Prices in Ammianus Marcellinus.” Mnemosyne, 1, 238-45. Jordan, Gregory D, (1990), “Usury, Slavery, and Land Tenure: The Nuzi tidenn"tu Transaction.” ZA, 80, 76-92. Jursa, Michael. (2002). “Debts and Indebtedness in the Neo-Babylonian Period: Evidence from the Institutional Archives.” In Hudson and Van De Mieroop (eds.), Debt and Economic Renewal in the Ancient Near East, 197-220. King, Philip J. and Lawrence E. Stager. (2001). Life in Biblical Israel. Louisville Kentucky: Westminster John Knox Press. Kozyreva, Nelli V. (1999). “Sellers and Buyers of Urban Real Estate in Southern Mesopotamia at the Beginning of the Second Millennium B.C.” In Hudson and Levine (eds.), Urbanization and Land Ownership in the Ancient Near East, 353-61. Larsen, Mogens Trolle (1982b). “Caravans and Trade in Ancient Mesopotamia and Asia Minor.” Bulletin of the Society of Mesopotamian Studies, 4, 33-45. Lattimore, Richmond. (1965). The Odyssey of Homer. New York: Harper & Row. Leemans, W.F. (1950a). The Old Babylonian Merchant. Leiden: Brill. Leemans, W.F. (1950b). “The Rate of Interest in Old Babylonian Times.” Revue Internationale des Droits de l'Antiquité, 5, 7-34. Leemans, W.F. (1954). Legal and Economic Records from the Kingdom of Larsa. Leiden: Brill. Leemans, W.F. (1960a). Foreign Trade in the Old Babylonian Period. Leiden: Brill. Leemans, W.F. (1960b). Legal and Administrative Documents of the Time of Hammurabi and Samsuiluna. Leiden: Brill. Leemans, W.F. (1968). “Old Babylonian Letters and Economic History.” JESHO, 11, 171-226. Leemans, W.F. (1975). “The Role of Land Lease in Mesopotamia in the Early Second Millennium.” JESHO, 18, 134-48. Leemans, W.F. (1983). Trouve-t-on des “communautés rurales” dans l'ancienne Mésopotamie? Recueils de la societe Jean Bodin pour l'histoire comparative des institutions, XLI. Paris: Dessain et Tolra. Lemche, Niels Peter. (1985). Early Israel: Anthropological and Historical Studies on the Israelite Society before the Monarchy. Leiden: Brill. Lemche, Niels Peter (1999). “The Relevance of Working with the Concept of Class in the Study of Israelite Society in the Iron Age.” In Mark R. Sneed (ed.), Concepts of Class in Ancient Israel. Atlanta, Georgia: Scholars Press, 89-98. Lichtheim, Miriam. (1976). Ancient Egyptian Literature: A Book of Readings. Vol. 2. Berkeley: University of California Press. McCloskey, Donald N., and John Nash. (1984). “Corn at Interest: The Extent and Cost of Grain Storage in Medieval England.” American Economic Review, 74, 174-87. Malul, Meir. (1985). “The bukannum-Clause-Relinquishment of Rights by Previous Right Holder.” ZA, 75, 66-77.

86

Morris Silver

Millett, Paul. (1991). Lending and Borrowing in Ancient Athens. Cambridge: Cambridge University Press. Montet, Pierre. (1964). Eternal Egypt. New York: Praeger. Montet, Pierre. (1981). Everyday Life in Egypt in the Days of Rameses the Great. Philadelphia: University of Pennsylvania Press. Müller, Manfred. (1971). “Sozial- und wirschaftspolitsche Rechterlässe im Lande Arrapha.” In Horst Klengel (ed.), Beiträge zur sozialen Strucktur des alten Vorderasien. Berlin: Akademie Verlag, 53-60. Müller-Wollerman, Renata. (1985). “Warenaustausch im Ägypten des Alten Reiches.” JESHO, 28, 121-68. Oppenheim, A. Leo. (1967). “Essay on Overland Trade in the First Millennium B.C.” JCS, 21, 236-54. Oppenheim, A. Leo. (1969). “Review of R. Bogaert.” JESHO, 12, 198-99. Pettinato, Giovanni, and Hartmut Waetzoldt. (1975). “Saatgut und Furchenabstand beim Getreidenbau.” Studia Orientalia, 46, 259-90. Postgate, J.N. (1975). “Some Old Babylonian Shepherds and Their Flocks.” JSS, 20, 1-18. Potts, Daniel T. (1983).“Barbar Miscellanies.” In Daniel T. Potts (ed.), Dilmun: New Studies in the Archaeology and Early History of Bahrain. Berlin: Reimer, 127-39. Powell, Marvin A. (1985). “Salt, Seed, and Yields in Sumerian Agriculture: A Critique of the Theory of Progressive Salinization.” ZA, 85, 7-38. Renger, Johannes M. (1984). “Patterns of Non-Institutional Trade and NonCommercial Exchange in Ancient Mesopotamia at the Beginning of the Second Millennium B.C.” In Alfonso Archi (ed.), Circulation of Goods in NonPalatial Context in the Ancient Near East. Rome: Dell’ateneo, 31-127. Renger, Johannes M. (2001). “When Tablets Talk Business: Reflections on Mesopotamian Economic History and its Contribution to a General History of Mesopotamia.” In Tzvi Abusch, et al. (eds.) (2001). Historiography in the Cuneiform World (Proceedings of the XLVe Rencontre Assyriologique Internationale, Part I). Bethesda, Maryland: CDL Press, 409-15. Rose, H.J. (1959). Religion in Greece and Rome. New York: Harper. Silver, Morris. (1983a). Prophets and Markets: The Political Economy of Ancient Israel. Norwell, Massachusetts: Kluwer-Nijhoff Silver, Morris. (1983b). “A Non-Neo Malthusian Model of English Land Values, Wages, and Grain Yields Prior to the Black Death.” Journal of European Economic History, 12, 631-50. Silver, Morris. (1984). Enterprise and the Scope of the Firm: The Role of Vertical Integration. New York: Blackwell. Silver, Morris. (1995). Economic Structures of Antiquity. Westport, Connecticut: Greenwood Press. Skaist, Aaron. (1994). The Old Babylonian Loan Contract, Its History and Geography. Ramat Gan: Bar-Ilan University Press. Stager, Lawrence E. (2001). “Port Power in the Early and the Middle Bronze Age: The Organization of Maritime Trade and Hinterland Production.” In Samuel

Modern Ancients

87

R. Wolff (ed.), Studies in the Archaeology of Israel and Neighboring Lands. Chicago: Oriental Institute, 625-38. Stone, Elizabeth C. (1977). “Economic Crisis and Social Upheaval in Old Babylonian Nippur.” In Louis D. Levine and T. Cuyler Young (eds.). (1977). Mountains and Lowlands: Essays in the Archaeology of Greater Mesopotamia. Malibu, California: Undema., 267-89. Van De Mieroop, Marc. (1995). “Old Babylonian Interest Rates: Were they Annual?” In K. Van Lerberghe and A. Schoors (eds.), Immigration and Emigration within the Ancient Near East: Festschrift E. Lipi$ski. Leuven: Peeters, 357-64. Van De Mieroop, Marc. (1999). “Thoughts on Urban Real Estate in Ancient Mesopotamia.” In Hudson and Levine (eds.), Urbanization and Land Ownership in the Ancient Near East, 253-75. Van De Mieroop, Marc. (2002). “A History of Near Eastern Debt?” In Hudson and Van De Mieroop (eds.), Debt and Economic Renewal in the Ancient Near East, 59-94. Vargyas, Péter. (2000). “Babylonian Interest Rates: Weren’t they Annual?” In Simonetta Graziani (ed.) (2000). Studi sul vicino Oriente Antico: Dedicati alla memoria di Luigi Cagni, 4 vols. Napoli: Istituto Universitario Orientale, Napoli.,Vol. II, 1095-1105. Weinfeld, Moshe. (1982). “The Council of the ‘Elders’ to Rehoboam and Its Implications.” MAARAV, 3, 27-53. West, Stephanie. (1988). “Books I-IV.” In Alfred Heubeck, Stephanie West, and J.B. Hainsworth (eds.), A Commentary on Homer's Odyssey, I, Introduction and Books I-VIII. Oxford: Oxford University Press, 51-245. Westbrook, Raymond. (1991). Property and the Family in Biblical Law. Sheffield: Sheffield Academic Press. Wiseman, D.J. (1953). The Alalakh Tablets. London: British Institute of Archaeology at Ankara. Wunsch, Cornelia. (2002). “Debt, Interest, Pledge and Forfeiture in the NeoBabylonian and Early Achaemenid Period: The Evidence from Private Archives.” In Hudson and Van De Mieroop (eds.), Debt and Economic Renewal in the Ancient Near East, 221-55. Zaccagnini, Carlo. (1975). “The Yield of Fields at Nuzi.” Oriens Antiquus, 14, 181-225.

II. MESOPOTAMIEN IM 3. JAHRTAUSEND V.CHR./ MESOPOTAMIA IN THE THIRD MILLENNIUM B.C.

TOWARD A DEFINITION OF PRIVATE ECONOMIC ACTIVITY IN THIRD MILLENNIUM BABYLONIA* Piotr Steinkeller If hope is the perception of the infinite — if it is the discovery of how the unlimited possibilities of our species emerge in history through a series of trials and experiments — sometimes the work of the historian can come very close to it. Aldo Schiavone, The End of the Past: Ancient Rome and the Modern West The Problem As is evident from its title, this paper addresses the question of private economic activity in Babylonia during the Third Millennium BCE. Here I need to point out that the designation “Third Millennium” in practice means only the last three centuries of that millennium, i.e., the period between 2300 and 2000 BCE. This is for the simple reason that no written evidence of any substance for this issue is available beforehand. In particular, I will be dealing with the period of the Third Dynasty of Ur (ca. 2100-2000 BCE), which, as is well known, is exceedingly well documented. In spite of the fact that the Ur III period was unusual and even unique in some respects, it is nevertheless fully representative of how the early Babylonian society and economy were organized and functioned. Thus, most of the conclusions about Ur III times are also applicable to the preceding, i.e., PreSargonic and Sargonic, periods. It is generally recognized that two schools of thought dominate on the issue of private or independent economic activity. One group of scholars assumes that such activity played an exceedingly limited — if any — role in the economic life of early Mesopotamia and judges it, therefore, to have been of only marginal importance. This position has to a large extent been influenced by the work Karl Polanyi and his collaborators and various followers. The other camp thinks that, next to the state-owned and -operated economic enterprises, there existed a large and thriving private economy, whose existence is simply obscured by the bias of written records, which, as unquestionably is the *

Abbreviations used are those of the Assyrian Dictionary of the Oriental Institute of the University of Chicago and of the Sumerian Dictionary of the University Museum of the University of Pennsylvania with the following additions: McNeil Messenger Texts = R. C. McNeil, The “Messenger Texts” of the Third Ur Dynasty (unpublished PhD dissertation, University of Pennsylvania, 1971). Sigrist Yale = M. Sigrist, Texts from the Yale Babylonian Collections, Parts 1 and 2, Sumerian Archival Texts 2 and 3 (Bethesda, 2000). Touzalin M. = Touzalin, L’administration palatiale à l’époque de la troisième dynastie d’Ur: Textes inédits du Musée d’Alep (unpublished PhD dissertation, Université de Tours, 1982).

92

Piotr Steinkeller

case, favor the activities of large public institutions. 1 As for the character of that putative economy, some scholars think that it constituted something very close to a capitalistic model, while others visualize it more along the lines of a collective or communal system. The proponents of the latter view usually, if not uniformly, use the term “private sector” to describe that independent area of economic activity.2 This terminological usage is highly significant, since it reflects an assumption that the economy in question represented a completely independent entity, which was physically separate from the official or state economy. In practical terms, this would necessarily mean that virtually every professional group fell under two sub-categories: those who worked exclusively for the state and those who were self-employed respectively. To offer a concrete example, this position would have it that, next to the craftsmen, let us say, carpenters, in the employ of the so-called “great institutions,” there also existed carpenters who owned private workshops and worked exclusively for themselves. Such an understanding of private economic activity also presupposes a physical co-existence of institutional and private or communal land. In other words, in the same community there would be state-owned fields, and just next to them one would find tracts of private or communal land. This is a very simplified description, of course, but this is essentially how the private or independent economic sphere is usually imagined. Even though I have on occasion been accused of overstressing the role of the state in the Ur III economy3 — which may have persuaded some that I am a member of the former camp — in fact I would be the first to argue that there was a great deal of private economic activity in early Babylonia. That was particularly true of the Ur III period, which is the focus of this presentation. But that private activity manifested itself in quite a different manner than usually thought by scholars. Public and Private in Ur III Times Rather than representing a completely separate entity, the private economic activity was an extension or, more precisely, the other side of the state economy. The best analogy I can offer to illustrate the relationship between the two is the 1

2

3

See, e.g., G. Van Driel, “Land in Ancient Mesopotamia: ‘That what remains undocumented does not exist,’” in Landless and Hungry?: Access to Land in Early and Traditional Societies, ed. by B. Haring and R. de Maaijer (Leiden, 1998), 19-49. For a corrective view, see Steinkeller, “Money-Lending Practices in Ur III Babylonia: The Issue of Economic Motivation,” in Debt and Economic Renewal in the Ancient Near East, ed. by M. Hudson and M. Van De Mieroop (Bethesda, 2002), 115. See, e.g., M. Van De Mieroop, JNES 59 (2000) 42: “… I would suggest that the public, communal, and private sectors of the economy coexisted throughout Mesopotamian (and ancient Near Eastern) history in general with ever-changing relations and importance; yet never was one dominant to the exclusion of the others.” I assume that I am one of the scholars at whom Van De Mieroop, Or. NS 62 (1993) 448, directs the following criticism: “… the Ur III economy, [is] a subject that still suffers from an excessive emphasis on the state’s role.”

Toward a Definition

93

double helix of the DNA structure. If one visualizes the Ur III economy and society as an all embracing vessel shaped as a pyramid, with the king at its apex, one could say that this entire pyramid was woven out of intermeshing threads of public (or state) and private (or independent) activity. For this reason, the term “private” is not only useless but also confusing and harmful when applied to ancient realities, particularly as far the Ur III economy and society are concerned. In fact, I would argue that much of the controversy surrounding the Ur III organization is simply a misunderstanding, which is directly attributable that unfortunate usage. Since the label “private” unavoidably conjures up all the modern meanings and connotations carried by this word — especially the notion of “private” as an exclusive category — to avoid imposing those concepts on alien situations it is be best to abandon this label altogether — unless one understands that “private” when applied to the Ur III situation means something specifically different. Needless to say, one should also dispense with the term “sector” when talking of the various areas of the early Mesopotamian economy, since this term is even more suggestive of sharp borders and mutual exclusiveness. More about the Ur III Organization To continue my discussion of the Ur III organization, it must be emphasized that the Ur III state was a classic example of the patrimonial system. As defined by Max Weber, in a patrimonial state all the economic and human resources are integrated into a single socio-economic organism subordinated to one ruling body. In spite of its apparent monolithic nature, such a system is actually a sum of individual households linked together by a network of mutual rights and obligations. All of those households form a single pyramidal structure, at whose top stand the king and his family. From an economic perspective, the most important point about a patrimonial state is that its economy is necessarily embedded in social relations.4 As for the Ur III economy specifically, it is clear that under the Ur III kings all the arable land, including the holdings of temple estates, constituted the property of the king. This land was distributed by the crown among the dependents of the state in the form of subsistence allotments (ŠUKU), depending on their social position and profession in exchange for services. This principle was in force throughout the entire society, excluding here, of course, slaves and the lowest ranks of the working class — the menials. The native term that served to designate a state dependent is éren. Although in the extant documentation this term is usually applied to the lowest-ranking dependants of the state, it is clear that in its broad sense it means any subject of the king. Even the members of the

4

For the Weberian model of patrimonial domination and its applicability to the societies of the Ancient Near East, see the recent book by J. D. Schloen, The House of the Father as Fact and Symbol: Patrimonialism in Ugarit and the Ancient Near East (Chicago, 2001).

94

Piotr Steinkeller

royal family ranked as éren vis-à-vis the king. Because of this, one could even describe the Ur III society as an erenage system. The Ur III quota system Another key feature of the Ur III economy is that it operated according to a quota system, which determined each individual’s obligation via-à-vis the state, depending on his specific social and occupational position. During the period of their employment, state dependents were alimented with grain, wool, and oil allotments. As I described it earlier, the higher-ranking among them were in addition provided with the plots of arable land. After their particular obligation or work-duty was fulfilled, they had complete freedom to engage in an independent economic activity.5 The Craftsmen In the case of craftsmen, for example, this meant that, having delivered the required number of man-days to the state, they were free to work entirely for themselves and to sell or barter their wares on a free market, so to speak. Here a good case in point are the Ur III potters. In a fairly recent article,6 I was able to demonstrate that these craftsmen owed six months (or fifteen days per month in practical terms) of full-time labor to the state. Furthermore, it is clear that, rather than being part of state-owned enterprises, they worked in familyowned workshops, and were organized into family groups. Thus, they had at their disposal not only the time but also the material means — the means of production, if you will — to work independently for themselves.7

5

6 7

One is reminded here of the system of compulsory deliveries which operated, at different times and in various forms, in the former Soviet block, especially in agriculture. Very much like in Ur III Babylonia, in communist Poland the independent farmer was required to deliver to the state a portion of his produce, for which he was paid a nominal price. The remainder he could theoretically sell freely, though not in a real free-market environment, since the state reserved the right of preemption, and since it regulated prices. Unlike in the Soviet system, however, whose character was unmistakably predatory, in the Ur III economy the quotas were set at reasonable levels, indicating an essentially equitable nature of this arrangement. “The Organization of Crafts in Third Millennium Babylonia: The Case of Potters,” AOF 23 (1996) 232-53. In this connection, it may be noted that the same mixture of “private” and “state” elements was posited for the craft production of ancient Egypt by Ch. J. Eyre: “The existence of a free market in manufactured goods does not necessarily imply the existence of ‘free’ craftsmen running purely private enterprises. Nor does the dependence of craftsmen and craft production on institutional structures — temple, king, or the estate of a great lord — exclude them from private marketing” (“The Market Women of Pharaonic Egypt,” in Le commerce en Égypte ancienne, ed. by N. Grimal and B. Menu, Bibliothèque d’Étude 121 [Cairo, 1998],176).

Toward a Definition

95

Local Markets in Third Millennium Babylonia? I hasten to offer the following caveat, however. There is no written evidence that the potters or, for that matter, any other category of craftsmen, actually sold or bartered their products. But, in fact, one does not expect to find such records, since it is difficult — if not impossible — to imagine any circumstances that would occasion the recording of such transactions. This notwithstanding, the conclusion that the commercial activity of this kind did exist, and that it was in fact exceedingly common, is unavoidable — and even necessary — since otherwise there is no way of explaining how ordinary people obtained their household goods, such as pots and furniture, various personal articles, such as shoes and garments, and foodstuffs other than cereals, such vegetables, fruits, dairy products, meat, and spices. This follows from the simple fact that none of the above products were distributed in any fashion by the central authorities. Thus, the only explanation possible is all these products were obtained through purchase or barter in a local market setting. As we shall see later, there are even grounds to think that some of these goods were held on hand and sold by professional traders. Although no direct information on barter practices and local markets in the Third Millennium Babylonia is available — apart from the terms for the peddlers of salt, alkali, and kohl8 — indirectly such evidence is provided by the Egyptian depictions of market scenes,9 which show (and sometime describe verbally) people engaged in buying and selling. The goods sold or exchanged in such scenes are precisely those I have posited for the hypothetical Ur III market. Victuals — vegetables, fruits, fish, bread, and beer — predominate among them, but a wide assortment of manufactured goods is in evidence as well: furniture, pottery vessels, sandals, fish-hooks, fans, and garments. While the foodstuffs are usually exchanged in a classic (commodity for commodity) barter fashion, manufactured goods tend to be paid for in grain.10 With good reason, Christopher Eyre thinks that “a local market [of this type] was of structural necessity for the distribution of perishables, and commodities not produced within the [private] household.”11 This exchange, he concludes, was “small in scale, but exchange, not

lú-mun-sa10, lú-naga-sa10, lú-šimbi-sa10, “sellers of salt, alkali, and kohl” (Early Dynastic Lu List E lines 179-181 = MSL 12, 19). Cf. J. Krecher, ZA 63 (1974) 151 n. 1; Steinkeller, Sale Documents of the Ur III Period, FAOS 17 (Stuttgart, 1989) 157 n. 457. 9 The majority of such representations date to the Old Kingdom; some come from the New Kingdom. See W. Helck and E. Otto, eds., Lexikon der Ägyptologie, Band III (1980) 119194; I. Hodjash and O. D. Berlev, “A Market-Scene in the Mastaba of D!d!-m-‘n¦ (Tp-mn¦),” AFO 7 (1980) 31-49; Ch. J. Eyre, “Work in the Old Kingdom,” in Labor in the Ancient Near East, ed. by M. A. Powell, AOS 68 (New Haven, 1987), 31-32; idem, “Market Women,” 173-91; B. J. Kemp, Ancient Egypt: Anatomy of a Civilization (London, 1989), 25355. I owe all these references to Dr. Mark Lehner. 10 Hodjash and Berlev, “Market Scene,” 48-49. 11 Eyre, “Market Women,” 185.

8

96

Piotr Steinkeller

redistribution.”12 I believe that these characterizations, like the Egyptian representations of market scenes, are apt descriptions of what the Ur III situation must have been like. Here it is important to realize that the allotments of barley with which state dependents were regularly alimented by the state did not — as commonly thought by Assyriologists — constitute a rationing system properly speaking. The use of the term “rations” to describe these payments is incorrect, since the volumes of grain distributed in this way vastly exceeded the dietary requirements of their recipients. Because of this, they should more accurately be classified as salaries. Although the principal part of such a barley salary — called še-ba in Sumerian — would be consumed as food by its intended recipient and his dependents, enough of it was left to be used as a means of exchange to acquire other foodstuffs and whatever else might have been needed by the household. More about the Quota System The Ur III quota system operated across the board, as is demonstrated by the examples of other professional groups. One such group were the foresters, who were concerned with the management and exploitation of the thickets or copses growing along rivers and canals.13 Like the craftsmen, the foresters also operated in family groups. And they too worked for the state during half of the year. Most of their labor was spent on producing the prescribed volumes of forest products, which included, apart from timber, various grasses and a spice-plant called gazi in Sumerian (kasû in Akkadian), though occasionally they were assigned to other tasks as well. In exchange for their services, they received barley, oil, and wool salaries and were provided with the plots of arable land. It is virtually certain that during the remainder of the year these individuals worked exclusively for themselves, harvesting the same kinds of products. Although explicit information again is lacking, we may assume that they exchanged or sold those products on local markets. We even have some suggestive data that one of the parties involved in such transactions were the merchants — about whom I will talk shortly. The evidence in question is the fact that is one of the items appearing in the accounts of merchants is the gazi plant, which, as I noted earlier, is known to have been harvested by the foresters. Another professional group that worked according to the quota system were the shepherds. The Ur III shepherds were part of a contractual arrangement with 12 Ibid., p. 188. 13 See Steinkeller, “The Foresters of Umma: Toward a Definition of Ur III Labor,” in Labor in the Ancient Near East, ed. by M. A. Powell, AOS 68 (New Haven, 1987), 73-115; idem, “Archival Practices at Babylonia in the Third Millennium,” in Ancient Archives and Archival Traditions: Concepts of Record-Keeping in the Ancient World, ed. by M. Brosius (Oxford, 2003), 49-52; W. Sallaberger, “Ur III-Zeit,” in Mesopotamien: Akkade-Zeit und Ur III-Zeit, ed. by P. Attinger and M. Wäffler, OBO 160/3 (Fribourg, 1999), 326-30.

Toward a Definition

97

the state, in which temple- or state-owned herds of sheep and cattle were consigned to them for herding.14 According to this arrangement, the shepherds took care of such herds on a nearly permanent basis, and were obliged to deliver to the state prescribed quantities of livestock and dairy products. Once this obligation was met, they were free to keep the surpluses for themselves. As we shall see later on, still other examples in this connection were the fishermen, the collectors of salt, and the growers of fruit-trees and vegetables. The Merchants But by far the best illustration of the dual nature of the Ur III economy, that particular mixture of public and private elements, is provided by merchants or traders (Sumerian dam-gàr).15 As everybody else in the Ur III state, merchants enjoyed the status of éren, i.e., state dependents.16 As such, they held plots of subsistence land and were beneficiaries of other forms of alimentation by the state.17 Their work for the state entailed the procurement of foreign goods and, 14 See R. K. Englund, “Regulating Dairy Production in the Ur III Period,” Or. NS (1995) 38384, 388, 394. 15 The basic studies of the Ur III merchants and their activities are H. Neumann, “Handel und Händler in der Zeit der III. Dynastie von Ur,” AOF 6 (1979) 15-67; idem, “Zu den Geschäften des Kaufmanns Ur-Dumuzida aus Umma,” AOF 20 (1993) 69-86; D. C. Snell, Ledgers and Prices: Early Mesopotamian Merchant Accounts, YNER 8 (New Haven, 1982); S. J. Garfinkle, Private Enterprise in Babylonia at the End of the Third Millennium BC (unpublished PhD dissertation, Columbia University, 2000); Steinkeller, “Archival Practices,” 52-55; Van Driel, Elusive Silver: In Search of a Role for a Market in an Agrarian Environment Aspects of Mesopotamia’s Society (Leiden, 2002), 3-30. While it has been slow in coming, the recognition that “public” and “private” are largely useless categories when applied to the activities of Ur III merchants is gaining more and more ground in Assyriology. See J. N. Postgate, Early Mesopotamia: Society and Economy at the Dawn of History (London, 1992), 219-21, and, especially, M. Jursa, Prywatyzacja i zysk?: Przedsi"biorcy a gospodarka instytucjonalna w Mezopotamii od 3 do 1 tysi#clecia przed Chr. (Pozna!, 2002), 66-75. Of particular relevance here is the following statement by Jursa: “Thus, economically speaking, it is not very important if the merchants are considered state agents or private entrepreneurs; they were both, in a certain sense, and elements of a planned economy in their dealings with the institutional sector at home blended easily with free, costconscious and profit oriented trading otherwise” (ibid., 69 — the English translation kindly supplied by Jursa). 16 The Umma tax-census TCL 5 6166 i 6-7 includes, among the 3,610 tax-paying éren listed there, sixty-seven merchants. Cf. also below n. 20. A detailed study of this document will be offered by this author elsewhere. 17 Plots of the subsistence land (ŠUKU) in the hands of merchants are documented at Nippur (Owen NATN 166) and Lagaš (MVN 7 274:15; MVN 11 65:15 [the holder is a ga-eš8, “seafaring merchant”]; ASJ 4 [1982] 118-19 no. 19 iv 8’-9’). From Umma, we have the records of rental land (GÁNA apin-lá) leased to the merchants (Jones-Snyder SET 243 i 2223, ii 47, iv 97-99; Watson Birmingham 2 234:9; MVN 16 682:3-6, rev. 1’-2’; MVN 18 374 iii’ 4’-8’; etc.). Since the leasing of rental land was generally restricted to the holders of subsistence plots, one can be certain that the Umma merchants held ŠUKU plots as well. At the very least, it is known that they had such plots at Nippur (Owen NATN 166:13’-15’, discussed

98

Piotr Steinkeller

even more importantly, the distribution throughout the state economy of perishables and other commodities that could not efficiently be handled by the central redistributive mechanisms.18 The same individuals, in their free time so to speak, were involved in purely private commercial activities, such as moneylending and, possibly, a limited form of retail trade. Since the merchants offer a wonderful insight into how the Ur III economy was organized and operated, it will be instructive to examine their activities in detail. The best textual evidence on these professionals comes from the city of Umma, the capital of the one of the largest provinces of the Ur III state.19 The Umma government employed some thirty merchants,20 whose main task was to procure for it a wide assortment of goods not available locally, and to facilitate the distribution of these goods throughout the provincial economy. In addition, the merchants participated in the collection and distribution of various local products (primarily perishables), such as fruits, vegetables, salt, animal fats, and fish, a task that was too small and cumbersome for the central administration to handle.21 Since this particular facet of the merchants’ activities is of particular interest for the question of the existence of a “market economy” in Ur III times, we shall examine it in detail later on. First, however, a description of the merchants’ standing vis-à-vis the local government and of their modus operandi is in order.

18

19

20 21

below p. 96). For other forms of the state alimentation, note, for example, Sigrist Rochester 160 ii 32, where the well-known Umma merchant Šeš-kala receives a garment as part of general garment-distribution. It may be taken for granted that, apart from providing those professional services, the merchants were also required to make corvée-labor contributions to the state. Like the other types of the higher-ranking state dependents, they would usually comply with this requirement by providing substitutes. However, in some instances they apparently contributed such labor themselves, as in Sigrist Yale 829, where the merchant Ur-Ištaran is classified as a half-time worker. Significantly, the person taking charge of Ur-Ištaran in this text is Ur-Dumuzida, who very likely is identical with the well-known Umma merchant of that name. For the Umma merchants, see the bibliography listed in n. 15. However, none of these studies may be considered fully adequate, since all them — beginning with Snell’s Ledgers and Prices and ending with Van Driel’s Elusive Silver — treat their subject in a strictly monographic way, i.e., in isolation from the overall structure of Umma’s economy and society. As I believe, no understanding of these professionals’ activities (both public and private) is possible without considering the entire picture of their interactions with the local government and the Umma society at large. Such a study is yet to be written. Much of the ensuing discussion of the Umma merchants goes back to my unpublished paper “Commercial Activity in the Ur III Period and the Issue of Prices,” read at the 9th International Congress of Economic History, Bern, 1986. A summary of this paper was offered by Neumann, “Ur-Dumuzida aus Umma,” 73-76. This estimate is based on the mentions of merchants in the records of the Fiscal Office. I assume that the figure of sixty-seven merchants given in TCL 5 6166 (see above n. 16) includes the junior members of their families. Yet another service that the merchants provided to the Umma government was their participation in the collection and delivery of the bala taxes. This aspect of their activities is poorly known and deserves a detailed study. See, provisionally, Van Driel, Elusive Silver, 7; T. M. Sharlach, Provincial Taxation and the Ur III State (in press).

Toward a Definition

99

The Merchants and the Umma Institutional Economy In their dealings with the Umma government, the merchants were directly subordinated to the so-called Fiscal Office, which was concerned with the collection of taxes and very likely served as the command center of the entire provincial economy.22 The relationship between the merchants and the Fiscal Office was governed by the following basic principles. The Fiscal Office had a standing account with each merchant, into which it periodically funneled bulk capital, in the form of grain, silver, and wool. The transfers of capital were duly recorded in sealed receipt tablets, which were retained by the Fiscal Office. At the same time and completely independently, various offices and departments of the Umma economy made withdrawals, according to their particular needs, of the goods that the merchant kept on hand in his warehouse. These transactions were recorded in another set of sealed receipts, which were kept by the merchant. At yearly or shorter time intervals the merchant presented the receipts in his possession to the Fiscal Office. The Fiscal Office then digested its own set of receipts,23 calculated the total of the advanced capital against the merchant’s expenditures, and balanced his account. The end product was a document commonly known as a “merchant balanced account,” numerous examples of which survive. Apart from this standard procedure, in which the movement of capital and the movement of goods proceeded in two separate channels, the Fiscal Office could also place specific purchase-orders with the merchant. Such transactions usually involved either non-standard commodities or large volumes of standard wares. The capital advanced to the merchant to make such purchases was sometimes included in the merchant’s account, either among his assets24 or among his debits.25 In most cases, however, “special orders” were recorded separately, in standard receipt tablets.26 Those, like the merchant's other receipts, would eventually be digested in the merchant's account among his assets. Also unrelated to the standard procedure were the transactions in which the Fiscal Office

22 See Steinkeller, “Archival Practices,” 42. 23 This was done by grouping the receipt tablets according to individual recipients. See MVN 15:127:1, which concerns the receipts of an administrator named Ur-Šulpae: a list of commodities kišib Ur-dŠul-pa-è ki dam-gàr-ne-ta Ur-dNun-gal ba-an-dib, “the receipt-tablets of Ur-Šulpae (i.e., tablets recording the disbursements of the commodities in question to UrŠulpae) Ur-Nungal (received) from the merchants (and) passed further on (in the accounting chain)” (MVN 15 127:1-40). Cf. Sigrist Syracuse 483; AUCT 1 540. 24 See, e.g., TCL 5 6056:24-25. 25 See, e.g., Chiera STA 22 iii 28 - iv 2. 26 A good example here is YOS 4 47, in which the merchants Ur-Dumuzida and Ur-Šulpae, father and son (see MVN 13 860 seal), receive from Lu-kala, the head of the Fiscal Office, 8 1/2 minas of silver to buy gold: 8 1/2 ma-na kug-babbar kug-zi-ga (for kug-sig17) sa10-sa10-dè ki Lú-kal-la-ta Ur-dDumu-zi-da ù Ur-dŠul-pa-è šu ba-ti. Outside of Umma, such records are MVN 5 281 (100.0.0 še gur níg-sámàm gi-šè) and Sauren New York Public Library 45 (42 2/3 ma-na 9 gín lá igi-6-gál kug-babbar níg-sám-ma šim-gišeren).

100

Piotr Steinkeller

consigned to the merchants particular items for sale, the best documented examples here being those dealing with consignments of slaves.27 In accordance with the standard Ur III accounting procedure, the receipts that were used to compile merchant balanced accounts would subsequently be passed on to other Umma offices and economic establishments to compile or to verify their own records.28 At the end of the accounting chain, they would have been sent back to the Fiscal Office, where, after having been sorted according to the merchants' identities, they would have been stored in individual containers, each pertaining to the activities of a single merchant. In order to make my explanation of the modus operandi of the Umma merchants plausible, two points need to be demonstrated: 1) that they owned their own capital; and 2) that they owned (or at last that they had access to) extensive storing facilities. The evidence in support of both points is provided by the Umma text Nikolski 2 447,29 dated to the eleventh month of Amar-Suen’s third regnal 27 See, e.g., 3 1/2 gín kug-babbar sámàm Nin-ú-šim-e dumu-SAL Al-lu ki Lugal-sig5 dam-gàr-ta mu-DU (JRAS 1939, BM 105412:1-4); 10 gín kug-babbar lá-NI su-ga Inim-ma-ni-zi dam-gàr sámàm sag … kug mu-DU (MVN 9 212:6-10); 8 [gí]n kug sámàm árad ki Šeš-kal-la-ta (Nikolski 2 401:8-9). 28 See the sources cited above in n. 23. 29 See Englund, Organisation und Verwaltung der Ur III-Fischerei, BBVO 10 (Berlin, 1990), 4142, for an edition and translation. Cf. also Jursa, Prywatyzacja i zysk?, 70. I offer herewith a new edition, since, as believe, my interpretation furthers the understanding of this exceedingly important source: 1) 45.0.0 µe gur lugal 2) 1 dug-kur-ku-dù ì 3) kug-bi (blank) (space) 4) é A-kal-la kur-gá-ra-ta 5) 3 dug-kur-ku-dù ì 6) 1 pisan dub µu 7) 1 pisan im dub sila-a gál-la 8) dam Ur-Ab-zu-ka-ke4 in-du8 9) é-ganba Ur-sila-luh-ka-ta 10) níg-gur11 Ur-sila-luh-ka 11) Ur-Ab-zu ù dam Ur-Ab-zu-ka-ke4 12) á bí-dar ba-an-de6 13) lú-kin-gi4-a énsi-ka-ke4 14) é-ganba Ur-sila-luh-!ha?!¬-ka 15) kiµib mi-ni-gá-ar 16) dam Ur-Ab-zu-ka-ke4 in-du8 17) ba-gi-in 18) igi énsi-ka-µè 19) igi Ur-kug-nun-na dumu Árad-da-ni-šè 20) igi A-kal-la nu-bànda-µè 21) igi Lú-dNanna dumu Inim-dŠára-šè 22) igi Sipad-kug-ge dumu Ìr-hu-la-šè 23) igi Ur-gišgigir nu-bànda-šè 24) igi Inim-dInana dumu Gu-du-du-šè 25) igi Ur-dSuen dumu Gu-du-du-šè 26) igi Gù-dé-a nu-bànda-šè

Toward a Definition

101

year, which records a legal case concerning the estate of the merchant Ur-silaluh. As one can conclude from the Ur-silaluh’s balanced account which was prepared, subsequent to his death, by the Fiscal Office in the thirteenth month of Amar-Suen’s second year,30 Ur-silaluh must have died sometime during the year Amar-Suen 2. Nikolski 2 447 thus deals with the events that happened subsequently. According to that source, a certain Ur-Abzu and his unnamed wife seized and carried away the property of Ur-silaluh, which had been kept in his warehouse or store (éganba). The property in question included forty-five bushels of barley and four kurkudu jars of oil, as well as two containers with tablets. The wife of Ur-Abzu later released the confiscated goods.31 Those were subsequently put back in Ursilaluh’s warehouse under the seal of the representative of the governor of Umma. Finally, the case was investigated and verified in the presence of the governor and 27) igi Lú-dNanna ugula dam-gàr-ne-šè 28) ba-gi-in (space) 29) iti-pap-ú-e mu kug gu-za dEn-líl-lá ba-dím (AS 3/xi) 45 bushels of barley (and) 1 k. jar of oil, its silver value being unknown, (have been released) from the house of A-kala, the minstrel. (In additon), the wife of Ur-Abzu has released (from her own house?) 3 k. jars of oil, 1 basket with the cancelled/old tablets, (and) 1 basket with the tablets (recording) outstanding transactions. Ur-Abzu and the wife of Ur-Abzu sequestered (these goods originally) and took them away from the warehouse of Ur-silaluh, from among the property of Ur-silaluh. The messenger of the governor (of Umma) has now sealed the warehouse of Ur-silaluh. It has been verified that the wife of Ur-Abzu has indeed released (and returned all these goods). All this has been verified before 10 witnesses [who include the governor of Umma and the foreman of the merchants]. Date. Although A. Falkenstein, Gerichtsurkunden 3, 90, and, following him, PSD A/2, 50-51, assume that á … dar means “to seize illegally,” the meaning of this expression is “to sequester” or the neutral “to take hold of.” This is demonstrated conclusively by the texts Forde Nebraska 1 = MVN 4 71 (+ Yildiz-Gomi Umma V 3119, matching one of the entries of these two sources), in which various royal officials sequester (i.e., seize lawfully) reeds, willow and poplar wood, and bur-zi vessels from the governor of Umma. The sense “to sequester” is also clear in the following example: 100.0.0 še gur lugal dÌr-ra-ku-ra-ad-e á bíin-dar dÌr-ra-ku<-ra>-ad-e Ur-dLi9-si4-ra su-su-dam, “Erra-qurad has sequestered 100 bushels of barley; Erra-qurad will now restore (this barley) to Ur-Lisi (i.e., the governor of Umma)”; seal: dÌr-ra-[ku-ra-ad] / zadim dNin-líl-lá / lú-DUN / dEn-líl-lá, “Erra-qurad, the lapidary of Ninlil, the subordinate of Enlil” (Sigrist Yale 2199:1-6 and seal). Cf. also še á dar-ra in Forde Nebraska 6:15. 30 Snell, Ledgers and Prices, pl. I no. 1. 31 Since no mention is made of Ur-Abzu, he was either no longer alive at that time or, more likely, away from Umma. It is tempting to speculate that Ur-Abzu too was a merchant; a merchant of that name is in fact documented at Umma (Yildiz-Gomi Umma V 3336:4 [Šu-Suen 3/iv]). If so, Ur-silaluh and Ur-Abzu may have been partners, which would explain why the latter had legal claims to Ur-silaluh’s estate. The seized property was stored by Ur-Abzu’s wife in two different locations, one of which appears to have been her own residence. The other location was the house of the minstrel A-kala, who may have been her relative or acquaintance.

102

Piotr Steinkeller

various other high officials. The latter included, quite revealingly, the “foreman of the merchants” (ugula dam-gàr-ne). Given the fact that at the time of his death Ur-silaluh owed only two shekels and 140 grains of silver to the Fiscal Office,32 the goods stored in his warehouse unquestionably represented his own property. Since Nikolski 2 447 mentions only the goods that were seized by Ur-Abzu and his wife, it is possible that Ur-silaluh’s total property was considerably larger and of more complex composition. In the foregoing discussion I have assumed that the Fiscal Office kept a separate account with each of the merchants who worked for the Umma government. But this may have been true only as far as the accounting procedure was concerned. It appears that, in reality, in their dealings with the Fiscal Office the merchants acted as a corporate body, which was collectively responsible for all merchant transactions. The data at hand do not indicate that the Umma merchants shared a common warehouse. Rather, as Nikolski 2 447 suggests, each of them owned separate storing facilities.33 There are also strong reasons to think that they carried on their business activity as families centered on individual households.34 Nevertheless, there is sufficient evidence to demonstrate that their resources were (at least occasionally) pooled together,35 and that the Fiscal Office contracted with them collectively. For the last point, note that in certain instances the merchants are referred to not individually by name but by the collective dam-gàr-ne.36 This approach was advantageous both to the Fiscal Office and the merchants, as it assured that the latter could always satisfy the current needs of the Umma government. For the purposes of accountability, however, it was necessary for the Fiscal Office to balance merchants’ accounts on an individual basis. In fact, the Umma merchants appear to have been associated in a guild or a similar type of corporate body, which would explain why the local government treated them collectively. The existence of this organization is strongly indicated by the presence in Umma of an official called “foreman of the merchants” (ugula dam-gàr-ne) (see Nikolski 2 447 discussed earlier). An Ur III tablet of uncertain

32 Snell, Ledgers and Prices, pl. I no. 1:19. 33 That the Ur III merchants owned private storing facilities is further shown by the Lagaš text TLB 3 53, which concerns a huge volume of wool (14 talents and 33 minas) that was withdrawn from the house of the merchant Lu-Kinunir. 34 It is also known that the Umma merchants owned their own ships, since on occasion they are reimbursed by the Umma administration for the use of their ships. See, e.g., Jean Šumer et Akkad LXXVI:134 iv 8-10: 9.4.0 gur á má dam-gàr-ne kišib Lugal-ba-an-šag5. Further, note TCL 5 6047 iv 3-5, where the merchant Ur-Dumuzida sells a large ship, apparently to the military organization (1 má 60.0.0 gur Ur-dDumu-zi-da dam-gàr-šè ba-an-ši-sa10 má éren-na ì-me-a Šu-dNin-mug-ga nam-érim-e ba-sum). 35 See, e.g., Sauren New York Library 335, where the merchant Ur-Dumuzida delivers to the Fiscal Office silver on behalf of his colleagues Lu-Inana and Lugal-niglagare. 36 As in Sigrist Syracuse 483, MVN 15 127, and Watson Birmingham 2 134.

Toward a Definition

103

provenance names a related title ha-za-núm dam-gàr-ne, “mayor of the merchants,”37 showing that similar organizations existed elsewhere in the Ur III state. Such guilds may even have had their own headquarters. This is suggested by the fact that in the Nippur text Owen NATN 511,38 which records a legal dispute between the merchants Ur-Nuska and Ada’a, the proceedings are said to have taken place in the é-dam-gàr, evidently the headquarters of the Nippur guild. We may speculate that these merchant organizations were self-governing bodies, which represented the merchants vis-à-vis the local government, regulated the distribution of capital among their members, coordinated their purchasing operations, and mediated conflicts among them. They probably also bore legal responsibility for the actions of their members and vouched for the honesty of prices charged to the state. Importantly, the membership in such self-governing bodies did not prevent the merchants from being at the same time institutionally tied to the state. Thus the well-known Umma merchant Ur-Dumuzida39 — and very likely many of his colleagues as well — was a member of the household of the god Šara.40 In another instance, a source of uncertain provenance divides fourteen merchants (who very likely too had their own organization) into the men of the governor and the dependents of the managers of the temple-households.41 That a person could have such a “dual” membership should not surprise us; in fact, this situation is absolutely typical of Ur III social conditions. Self-governing organizations like the merchant guilds were in evidence throughout the society, but, as I have stressed elsewhere, such bodies were always embedded in the state organization; they never operated outside of it.42 Since the merchants were institutionally part of the provincial organization, it follows — if only from the Weberian model! — that they also fell under the administration of the central government. This is demonstrated by the Nippur text NATN 166, which lists subsistence plots of the merchants from Adab, Umma, and Uruk. This source shows, firstly, that the merchant guilds of those three provinces had branch offices in Nippur — a point of considerable interest in itself. More important, however, is the fact that the plots in question must have been direct grants from the state, since they involved non-Nippureans. The obvious implication of this is that the Ur III merchant, apart from working on behalf of his native province, provided similar services to the central government. 37 Steinkeller, Sale Documents, 324-25 no. 125:14 (republished by T. Gomi and S. Sato in GomiSato British Museum 220). 38 For this text, see also below p. 97. 39 See Neumann, “Zu den Geschäften des Kaufmanns Ur-Dumuzida aus Umma,” AOF 20 (1993) 69-86. 40 Ur-dŠul-pa-"è# / dumu Ur-dDumu-zi-da / dam-gàr dŠára-"ka# (MVN 13 860 seal). 41 8 merchants, receiving jointly 168 bushels of sesame, dam-gàr lú énsi-me<-éš>, kišib PN1; 6 merchants, receiving jointly 80 bushels of sesame, dam-gàr sanga-me-éš, kišib PN2; šu-nígin 248.0.0 <še giš-ì> šu-ti-a dam-gàr-e-ne šag4 é dDa-mu (Sigrist Yale 2219:1-19). 42 See the following description, where “state organization” should be substituted for “temple Millennium Southern Babylonia,” to appear in Robert McC. Adams Festschrift, ed. by E. C. Stone (Los Angeles, 2004).

104

Piotr Steinkeller

How the Merchants acquired their Wares Not surprisingly, the documentation extant bears only on those facets of the merchants' activities in which they directly interacted with the government. There is virtually no information on how they acquired their wares, either local or foreign. In the case of the former, a circumstantial picture may be constructed based on the indirect sources — and I will return to this problem later. As for the foreign goods, we are in a nearly complete darkness, though it may be assumed — quite confidently, in my view — that the merchants or their agents traveled outside the province (and perhaps even abroad) to obtain them. While no records of trips made by Umma merchants survive, we know that their colleagues from Nippur ventured quite afar. According to the text Owen NATN 551, which records a legal dispute between the merchants Ur-Nuska and Ada’a, both of whom are well-documented as money-lenders at Nippur, Ur-Nuska had sent to Ada’a three minas of silver to purchase 120 bushels of sesame in Zimudar, a locality in the Diyala Region. The text makes it clear that Ada’a stayed at that time in Zimudar, since he communicates with Ur-Nuska through his messenger, a certain Ušpurani. While discussing long-distance trade, it will be useful to note that an institutional form of long-distance trade also operated in Ur III times. The trader Pu’udu, who shipped barley to Makkan (modern Oman) on behalf of the state43 and supplied precious stones to the court of Ur, 44 appears to have run an equivalent of the modern foreign-trade ministry. He had under his command an extensive navy organization, which included eight “captains of big ships” (nubànda má-gal-gal-m[e]) and six “officers in charge of sixty men (each)” (ugula [géš]-!da-me¬) (meaning the combined personnel of 360 men).45 Pu’udu was a person of exceedingly high standing, as is underscored by the fact that his son KugNanna appears to have married into the royal family.46 Another son, Lu-Enlila, held the title of “sea-faring merchant” (ga-eš8 a-ab-ba-ka) (which he apparently inherited from his father) and officiated as a judge at Ur.47 Lu-Enlila’s seal48 was of the extremely rare in-na-ba type, which represented a personal gift from the king. Since in a text from Ur Lu-Enlila pays a large volume of grain to the state as 43 600.0.0 še gur gún Má-gan-šè ki énsi Gír-suki-ta Pù-ú-du šu ba-ti kišib Ur-gi6-par4 dumu Šuna-ka ì-dub A-šag4-NI-zi-na (ITT 2 776:1-8). 44 1 pair of fancy sandals presented to Pù-ú-du ud na4duh-ši-a mu-ni-ku4-ra-a, “when he brought in the duhšia gems” (MVN 13 672:1-3). Cf. Steinkeller, ZA72 (1982) 249 n. 40. 45 M. Hilgert, Drehem Administrative Documents from the Reign of Šulgi, OIP 115 (Chicago, 1998), 161-62 no. 210:1-18. 46 A circumstantial case to that effect is presented by the following set of data, which suggest that Kug-Nanna married the princess Geme-Nanna: Géme-dNanna dumu-lugal (CTMMA 17:16 [Amar-Suen 4/vii]); McNeil Messenger Texts, 135, 139 NBC 782:9 [Amar-Suen 8/ix]); Géme-dNanna é-gi4-a Pù-ú-du šag4 úrimki-ma (PDT 2 1068:2-4 [Šulgi 46/ix]); mu Géme-dNanna é-gi4-a Pù-ú-du-šè gìr Kug-dNanna sukkal (Legrain TRU 344:6-7 [Amar-Suen 6/iv]); Kug-dNanna dumu Pu-ú-du (PDT 1 691:3 [Šu-Suen 3/ii]). 47 UET 3 41:13 and seal = Steinkeller, Sale Documents, 302-03 no. 109. 48 UET 3 41 = Steinkeller, Sale Documents, 302-03 no. 109.

Toward a Definition

105

the “tithe of sea-faring trade,”49 some of his foreign ventures were purely private in character. As these data strongly suggest, in the area of long-distance trade too “public” and “private” were two sides of the same coin.50 Merchants’ Independent Economic Activity Our sources are even more silent as regards the purely private enterprises of the Umma merchants. We can be certain, however, that such activities did exist. As we have seen earlier, in their dealings with the Umma administration the merchants functioned very much like bankers, since the arrangement in question provided them with a constant supply of liquid capital. Although the merchant would have spent most of this capital to keep his warehouse fully stocked, he could use the remainder to finance his own ventures or investments. The most obvious way in which he would put this capital to work was to advance it to private individuals as interest-bearing loans, as was the case during the same period in the city of Nippur. Unfortunately, however, the few private loan documents that come from Umma cannot be linked confidently with any of the known Umma merchants.51 Chances are, nevertheless, that such documents remain stored in the merchants' private houses at Umma, which are yet to be excavated. Significantly, this kind of commercial activity was not an exclusive prerogative of merchants. Across the social and professional spectrum, individuals of means and ambition, such as, for example, a chief shepherd named SI.A-a,52 enthusiastically — and to all appearances very successfully — engaged in moneylending, as well as in a peculiar, but not unique to the Ur III period, type of realestate speculation.53 Merchants’ Participation in Local Trade While banking operations may have been one element of the merchants’ “private” activities, another such element — and possibly an equally important one — was

49

50 51

52 53

240?¬+30.0.0 še gur lu[gal] mu-D[U] !zag-10¬ nam-ga-eš8 a-a[b-ba(-ka)] ki Lú!-dEn-líl-lá dumu Pù-ú-du-[ta] (UET 9 962:1-5). Other sources concerning the activities of Lu-Enlila are UET 3 702, 704, 751, 1171, 1511, 1666, and 1689, the last four of which were discussed by A. L. Oppenheim, JAOS 74 (1954) 13. Here note that the seafaring merchants (ga-eš8) too held subsistence plots, which proves that (at least some of them) were state dependents. See MVN 11 65:15 cited above in n. 17. The best candidates for such documents are YOS 4 54, MVN 15 30, and the unpublished tablet cited below in n. 63, which involve a lender Šeš-kala, who possibly is identical with the Umma merchant of that name. However, since Šeš-kala is an extremely common name, this is far from certain. See Steinkeller, “Money-Lending Practices,” 118-19; Garfinkle, Private Enterprise, 45-118. Steinkeller, “Money-Lending Practices,” 118-24. !

106

Piotr Steinkeller

connected with their handling of the various commodities produced locally,54 which, as already noted, were mostly perishables, such fish, fats, and various fruits. Of central importance here is the fact that the suppliers of those commodities were, apparently without an exception, institutionally connected with the Umma government. Among those suppliers were the producers of salt,55 the growers of fruit-trees, vegetables, herbs, and sesame, the foresters, the processors of fats, and the fishermen, the last supplying, apart from fish and various related products, also bird plumage (pa mušen in Sumerian). All such producers, it needs to be emphasized, were an integral part of the overall economic and social structure, in that they, like the other types of state-dependants, were required to deliver a portion of their particular product to the state and to make corvée-labor contributions; in exchange, they held subsistence fields and received food and other forms of alimentation. As I have stressed elsewhere,56 the incorporation of such marginal (both in the geographical and social sense) groups into the state structures was a hallmark of the Third Millennium social and economic organization of southern Babylonia, particularly in Ur III times.57 As required by their status, the professional groups in question made prescribed deliveries of their products to the local government, more specifically, to Umma’s Fiscal Office. There survive many records of such deliveries, among them those of the gazi plant, fish, and salt.58 It is significant that the same 54

“Locally” means that they were naturally available in southern Babylonia. It should be stressed, however, that most of these products came from marginal ecological niches. 55 D. L. Potts, Mesopotamian Civilization: The Material Foundations (Ithaca, 1997), 105, speculated that “[Amorite] nomadic groups may also have been employed by the Ur III state to gather salt.” Cf. also Postgate, BiOr 60 (2003) 7. While it is possible (and even likely) that the semi-nomadic Amorites with no institutional ties to the state were actively involved in salt-gathering in Ur III times, and that the state did obtain some salt from such groups occasionally, it is notable that the regular suppliers of salt to the Umma government were firmly part of the state organization, as demonstrated by the their being holders of ŠUKU plots and tax-payers (see below n. 59). This does not mean that they could not have been of Amorite extraction. Two of the known salters bore names — Gu’ugug and Na’u’a (see below n. 59) — that are certainly foreign though not demonstrably Amorite. It is also certain (because of their trade) that those salters lived and operated in a marginal geographical area, but this did not make them social outsiders. 56 “Land-Tenure Conditions,” 291-93. 57 It is unlikely that this situation continued into Old Babylonian and later times. 58 See, e.g., N. Koslova, Ur III-Texte der St. Petersburger Eremitage, SANTAG 6 (Wiesbaden, 2000), 259-70 no. 340, a balanced account of the spices, onions, fish, and fowl handled by the Fiscal Office (níg-ŠID-ak mun-gazi Gu-du-du iti 12-kam). The income section of that source lists the gazi plant delivered by the foresters (ii 29 - iii 1); the gazi, spices, onions, and fowl delivered by the gardeners and other individuals (iii 2 - iv 9, iv 18 - v 2); and the fish supplied by the fishermen (iv 10-18). For other deliveries of the gazi by the foresters, corresponding closely to the amount mentioned in the account just cited, see Steinkeller, “Foresters,” 92, 96, 110-11 no. 42. Similar regular deliveries came from the Umma producers of salt (for whom see also the following note). See BIN 5 166 (Šulgi 46), 169 (Šulgi 48), and MVN 20 66 (Amar-Suen 1), where the unnamed “salters” (lú-mun) deliver in each case ca. 1 bushel of salt to the well-known Umma administrator Lanimu.

Toward a Definition

107

professionals also make payments in silver in lieu of their products, likewise to the Fiscal Office.59 Since the amounts of silver involved are consistently high, it is unlikely that these payments60 represented a tax or some other due levied additionally on the products in question. We have to assume, therefore, is that the quota owed the state is likewise meant in such instances, indicating, in turn, that 59 Among the contributors of these payments, the best-documented ones are the producers of salt. A salter named Gu’ugug paid his share, designated as “the silver of the salt,” over a period of nine years: 11 1/4 shekels in Amar-Suen 8 in lieu of the payment due for the year Amar-Suen 7 (MVN 1 247:1-2, 5-6); 2 shekels in Šu-Suen 1 as a repayment of the outstanding balance (Nikolski 2 400:4-5); 15 shekels in Šu-Suen 2 (Sigrist Yale 1275); and 10 shekels in Šu-Suen 6 (Jean Šumer et Akkad XCVI:56 lines 1-2). Note that in Sigrist Rochester 160 ii 33 the same Gu’ugug is allotted a single garment. Other known salters are Na’u’a, whose payments are documented for the years Šulgi 37, 40 and 41 in the amounts of 3, 1, and 3 shekels respectively (MVN 14 26; Sigrist Syracuse 12); and Lu-Enlila, who paid 10 shekels for the year Amar-Suen 7 (MVN 1 247:3-6). In other instances the payers are simply identified by their professional name lú-mun, “salters” (Sigrist Princeton 541:9-10 [10 shekels]; WZKM 59/60 [1963/64] 111 no. 7 [10 shekels]; BIN 5 109:1-2 [60 shekels]; BIN 5 304 [40 shekels]). Importantly, in the first two examples the payment is described as kug gún-na, “silver of the tribute/tax.” In the case of Gu’gug, information on his ŠUKU holdings survives. According to Orient 21, BM 106075 iii 25, Gu’ugug’s share of the produce from his ŠUKU plot was 3 bushels of barley. Another professional group whose payments are amply documented is the fishermen. For example, a fisherman Hun-DU.DU, who is otherwise known to have been a member of the temple-household of Šara (Hu-DU.DU šu-ku6 dŠára — Sigrist Rochester 160 iv 36-38), delivers 10 shekels of silver as kug ku6 a-šag4 dŠára, “silver of the fish from the fields of Šara” (BIN 5 109:5-6). He apparently was one of the seven fishermen of Šara that were part of the operation run by the chief fisherman Ur-Suen (AnOr 1 88:326-336). We also know the size of his ŠUKU allotment, which was 9 iku of land (Orient 21 BM 105330 iv 27’-28’). Other named fishermen making payments to the Fiscal Office were Lugal-kugani, Lu-duga, Adaga, and the above mentioned Ur-Suen. Lugal-kugani delivered 10 1/3 shekels of silver as kug pa mušen, “silver of the bird plumage” (Nikolski 2 401:11) and [x] minas of silver as kug enkud, “silver of the fisheries inspector” (Sigrist Princeton 541:1-3). The payments of Lu-duga are recorded in VO 8 (1989) pl. XII no. 67:1-2, Watson Birmingham 2 81:1-2, and Watson Birmingham 2 82:9-10, in the amounts of 5 shekels, 12 1/2 shekels and 3? grains, and 4 5/6 shekels of silver respectively. Adaga once delivered 10 shekels of silver (Sauren New York Public Library 100:1-4). As for Ur-Suen, three of his payments are documented: 10 shekels of silver mu ku6 pa mušen-[šè], “in lieu of the fish (and) bird plumage” (Sauren New York Library 367:1-2); 6 shekels of silver as kug ku6 A-šag4-lá-tur “the silver of the fish of the field Ašag-la-tur” (MVN 14 157:4-6); and 11 2/3 shekels and 24 grains of silver without any designation (MVN 9 212:3-4). We also have information on Ur-Suen’s ŠUKU allotment: according to Orient 21, BM 105330 iv 31’-33’, he held 6 iku of land; his actual harvest share was 10 bushels of barley (Orient 21, BM 106075 ii 24). Similar dues are represented by kug zú-lum(-ma), “silver of the dates” (MVN 14 39; Sigrist Syracuse 413, 416, 421; TCL 5 6045 i 11; Grégoire AAS 67; BIN 5 147; VO 8 [1989] pl. XII no. 66; Touzalin, 455 M 3719, 459 M 3920:1-2; etc.), kug gišpèš, “silver of the figs” (Touzalin, 459 M 3920:3, 460 M 3777:3-4); kug gišhašhur, “silver of the apples” (Sigrist Princeton 547; TCL 5 6045 i 12), and the deliveries of silver made by the producers of sesame (engar giš-ì(-ka)-ke4-ne) (Watson Birmingham 2 78; Sigrist Princeton 559; Szlechter TJA, 55 IOS 26, 57 IOS 29; etc.). 60 Englund’s speculation, Ur III-Fischerei, 162-64, that these are simply silver equivalencies, rather than the actual payments of silver, is without any foundation.

108

Piotr Steinkeller

the producer made his payments to the state either in kind or in silver. In the latter case, he undoubtedly had first sold the state’s share of his product to a third party, since this is the only way in which he could have obtained silver. As for that third party, it almost certainly was the Umma merchants, for the simple reason that the products in question are identical with the wares handled by the latter. Tentatively, then, the triangular arrangement between the producer, the merchant, and the Fiscal Office may be reconstructed as follows. The merchant bought from the producer the bulk of his product, including the share the producer owed to the state. The equivalent of that share, converted into silver was subsequently paid — either by the producer himself or (more likely) the merchant61— to Umma’s Fiscal Office. As for the merchant’s purchases, only the state’s share of the product he acquired in this way represented his true investment, since the balance of it he would “resell” to the Fiscal Office, apparently for the same price he had paid to the producer. To describe it more correctly, he would be reimbursed for those purchases by the Fiscal Office.62 Since the goods acquired in this fashion by the merchants would be withdrawn by various Umma offices in due course, the merchants simply represented an instrument by which Umma’s central administration purchased the surplus of these particular products from its own dependants, and then distributed it throughout the local economy. The fact remains, however, that a transfer of money (be it silver or commodities) to private individuals did take place, leaving in the hands of the latter substantial liquid capital. It is also possible that Umma’s institutional economy consistently used up less of the goods in question than the totals acquired by the merchants. If so, the merchants would have enough of such products left to them to sell them on a local market — the purchasers being, of course, mainly the members of Umma’s socioeconomic organization. Assuming that they sold for more than they had paid for

61 This depends on the medium in which the merchant paid the producer. If silver was involved (which is doubtful, though not impossible), the payer could have been the producer himself. Note, however, that in at least one instance the payer of such dues definitely was the merchant: 5 gín kug zú-lum ki Ur-dUtu dam-gàr-ta (VO 8 [1989] pl. XII no. 66:1-2). 62 This may be illustrated by the following hypothetical example, involving a salter whose total capacity production is 300 minas of salt. Assuming that the state’s cut was 33% (which is highly probable, though not supportable with the data in hand), then what the salter owes to the state is 100 minas of salt. The merchant buys the entire product for 30 shekels of silver — at the standard ratio of 1 shekel of silver per 10 minas of salt (Snell, Ledgers and Prices, 15758). Either he or the salter himself then pays 10 shekels of silver to the Fiscal Office in lieu of the 33% cut. This leaves the salter with an income of 20 shekels of silver (or its equivalent in barley or other commodities, depending on how the price was paid). The merchant subsequently distributes 200 minas of salt among the various Umma offices, for which he is reimbursed with 20 shekels of silver by the Fiscal Office. The remaining 100 minas of salt represent his own investment; he may sell them either to the Fiscal Office (apparently at no profit) or on a local market (presumably at profit). The last point depends on how much salt Umma’s institutional economy requires and on how much salt the salter is able to produce. If the latter exceeds the former, then the merchant is left with a surplus that he may sell to “private” individuals.

Toward a Definition

109

— and this is the scenario I favor63 — this activity would provide them with yet another source of sizable income. Market Economy in Ur III Times? With all of the capital that was readily available to a large section of Umma’s society — coming from their salaries paid in barley (še-ba) and/or the income they derived from the sale of their surplus products — the retail trade of the sort I have described could have been quite substantial. All in all, this would mean that a significant volume of trading took place outside of the auspices of the central government, in particular if, as I argued earlier, a lot of barter activity was carried out independently of the merchants. If we now compare the Ur III situation with that obtaining for the following, i.e., Old Babylonian period, the most dramatic difference is that, unlike in Ur III times and earlier, in the Old Babylonian period the crown was no longer directly involved in agricultural production. Whereas in the Ur III state and earlier the whole agriculture cycle, from seeding down to the collection of harvest, was carried out by state institutions, in Old Babylonian times that task had been farmed out to private entrepreneurs. From now on, these professionals, who were clearly linear — and possibly even genetic — descendents of the Ur III merchants, take care of the whole operation. In this way, the proportions between the public and the private components of the economy had changed quite significantly; in comparison with the preceding period, in Old Babylonian times the area of private activity was significantly larger. But the nature of the relationship between the two components remained the same. The Old Babylonian kingdom (or kingdoms, to be more exact) too was a patrimonial state. The merchants that took care of the agricultural production on behalf of the state were, 63 One may speculate that the merchant was entitled by law to a margin roughly equivalent to the interest he charged on silver and grain, i.e., 20% and 33% respectively. It is significant that the Ur III sources sometimes talk of the máš dam-gàr, “merchant’s interest” without naming any specific rate. See, e.g., YOS 4 7:6; MVN 11 162:2, 8. There also existed the “king’s interest” (possibly 10%, identical with the tithe) which was apparently lower than the “merchant’s interest,” as is suggested by the following loan document: 1 1/2 gín kug-babbar / ki Šeš-kal-la-ta / 1 1/2 gín kug-babbar / ki Inim-dŠára-ta / Lugal-níg-lagar-e šu ba-ti / itinesag-"šè# maš lugal / ì-gá-gá ù-da (syllabic for ud-da?) di-da dib maš dam-gàr gá-gá-dam / iti-še-gur10-kud / mu En-mah-gal-an-na en dNanna ba-hun / seal of Lugal-níg-lagar-e dumu Al-NI-"…#, “Lugal-niglagare received 1 1/2 shekels of silver from Šeš-kala (and) 1 1/2 shekels of silver from Inim-šara. Until the month Nesag (he will repay it and) he will add the ‘king’s interest.’ (He swore) to add the ‘merchant’s interest’ if he enters a legal dispute (regarding this loan)”; date; seal (an unpublished tablet in the collection of the Museum of Primitive Art and Culture, Peace Dale, Rhode Island, cited courtesy of Steven W. Cole). Thus, the rate of the merchant’s interest not only was standard but also recognized and regulated by the state. The margin that the merchant could charge was likely set by the state as well. By analogy with loans that margin too may have been known as “merchant’s interest,” though I cannot substantiate this supposition with any certain examples.

110

Piotr Steinkeller

like their Ur III counterparts, state dependents, whose households, as in the Ur III period, were subordinated to that of the king. This made them an integral part of the patrimonial structure. Apart from being involved in private business activities, these individuals provided a variety of services to the crown, not only as commercial agents, but also as high officials of the state.64 But let us return to the Ur III economy. As we have seen, the presence in it of various forms of private economic activity is crystal clear. The question must be asked therefore: are these features sufficient grounds for characterizing the economy of Ur III times as a market economy? I do not think so. In a minimal form, markets existed in all ancient societies, as well as in the so-called primitive cultures of more recent times. This is an undisputed fact. Even Karl Polanyi eventually acknowledged the presence of some market-style economy in the Ancient Near East.65 I believe that Fernand Braudel was right on the target when he said that “Historically, one can speak of a market economy, in my view, when prices in the markets of a given area fluctuate in unison, a phenomenon the more characteristic since it may occur over a number of different jurisdictions or sovereignties. In this sense, there was a market economy well before the nineteenth and twentieth centuries — the first in all history …, to experience the self-regulating economy. Prices have fluctuated since ancient times; by the twelfth century they were fluctuating in unison throughout Europe … That said, I would not claim that this market economy, reasonably approximating to fair competition, covered the entire economy, far from it. Nor does it do so today any more than yesterday, although the scale is now different, and quite other reasons are responsible … What is certain is that alongside the ‘non-markets’ beloved of Polanyi, there always have been exchanges exclusively for money, however little. In rather minimal form perhaps, markets nevertheless existed in very ancient times within a single village or group of villages — the market being a sort of itinerant village, as the fair was a sort of traveling town. But the decisive step in this long history was taken when the town appropriated these hitherto modest little markets. It absorbed them and inflated them to its own dimensions, in return having to accept the demands they made on it. The important development was surely the launching on to economic circuits of the towns as heavy units. The urban market may have been invented by the Phoenicians. Certainly the Greek city-states of about the same period all had a market on the agora, the central square; they also invented or at any rate propagated money, which clearly furthered the career of the market, if it was the sine qua non of its existence.”66

64 This point has been demonstrated very convincingly by Ch. Dyckhoff, Das Haushaltsbuch des Balmunam¦e (unpublished PhD dissertation, Universität München, 1999), on the example of the famous businessman and royal official Balmunam¦e. 65 The Livelihood of Man (New York, 1977). 66 Civilization and Capitalism: 15th - 18th Century, Vol. 2: The Wheels of Commerce (New York, 1982), 227-28. First published in France under the title Les jeux de l’échange (Paris, 1979).

Toward a Definition

111

When we look at the Ur III economy, and the ancient Mesopotamian economy more broadly, there is some evidence of the fluctuation of prices, but no indication that they ever fluctuated in unison over a larger geographical area. There was some retail activity, but this activity was miniscule in comparison with the state-run exchanges. Also very significantly, there was a complete absence of what could be described as a labor market. These facts make it most unlikely that the label “market economy,” at least in its ortodox sense of self-regulating economy, could in any way be applicable to what existed in the Ur III period. At the same time, one must acknowledge the presence in the Ur III economy of various market-like reflexes or behaviors. Because of this, I submit — again following Braudel — that we should think of the market economy “as being built up step by step.”67 And I would argue that the task facing the historian of ancient economies is to try to trace the precise course of that development: from the proto-manifestations of market forces, through the various intermediate stages (such as the urban market), down to the selfregulating or free market. In this undertaking one needs to concentrate on those features that are characteristic and unique to each historical situation, in order to capture its specificity. In my view, this is the only heuristically valid approach, if one is authentically interested in learning about history past. Of course, one might alternatively ignore the peculiar and unique and focus instead on the similarities and commonalties. The latter approach could possibly lead to a superficial conclusion that all of the societies of the Ancient Near East had free market economies. Such a conclusion, however, would not only be a gross simplification but would also make no contribution to furthering our understanding of the history of economic behavior. As I strongly believe, that is the goal we should be after.

67 Ibid., 228.

III. MESOPOTAMIEN UND DIE LEVANTE IN DER 1. HÄLFTE DES 1. JAHRTAUSEND V.CHR./ MESOPOTAMIA AND THE LEVANT IN THE FIRST HALF OF THE FIRST MILLENNIUM B.C.

GRUNDZÜGE DER WIRTSCHAFTSFORMEN BABYLONIENS IM ERSTEN JAHRTAUSEND V.CHR. Michael Jursa Einleitung Der folgende Überblick über die Wirtschaftsformen im Südmesopotamien des ersten Jahrtausends v. Chr. und die Diskussion des Fernhandels als mögliches Medium des Kulturaustauschs zwischen diesem Raum und dem östlichen Mittelmeergebiet (in Hinblick auf das Generalthema des Symposions) sind angesichts der Materialfülle und der Breite des Themas zum Teil thesenhaft mit nur exemplarischer, nicht erschöpfender Dokumentation.1 Wir beschränken uns auf die wesentlichen Grundzüge und werden nur auf einige wenige der zahlreichen offenen Fragen zu sprechen kommen.2 1. Die Wirtschaft Babyloniens im ersten Jahrtausend v. Chr. 1.1. Quellen Sowohl die archäologische als auch die epigraphische Dokumentation sind für die gegenständliche Periode zwar insgesamt reich, aber diachron und geographisch ungleich verteilt; die Koordination archäologischen Materials mit philologischen Befunden bleibt ein nur zum Teil gelöstes Problem. Nach wie vor bietet Adams’ Survey von großen Teilen des südmesopotamischen Alluviums den entscheidenden archäologischen Ansatzpunkt, von dem aus die ökonomische Gesamtentwicklung verstanden werden muß (Adams 1981). Man konstatiert eine signifikante Zunahme der Besiedlungsdichte im Vergleich zu früheren Perioden, insbesondere ein überproportionales (neunfaches!) Anwachsen größerer (‘urbaner’) Agglomerationen von mehr als 10 ha Siedlungsfläche (Adams 1981, 177ff.). Dieses Wachstum erfolgt nach dem Surveybefund kontinuierlich von der neubabylonischen Periode bis zur seleukidisch-parthischen Zeit (grob 700 v. Chr. bis 200 n. Chr.) und kulminiert in einer nach Adams’ Modell zu postulierenden flächendeckenden agrari1

2

Eine detaillierte Ausarbeitung wesentlicher Fragestellungen in diesem Zusammenhang erfolgt im Rahmen unseres vom Fonds für die Förderung der Wissenschaftlichen Forschung (Wien) finanzierten START-Projekts The Economic History of Babylonia in the First Millennium B.C. Zitate aus unpublizierten Texten aus den Sammlungen des British Museum erfolgen mit Genehmigung von dessen Trustees. Unpubliziertes Material aus der Yale Babylonian Collection wird mit der freundlichen Erlaubnis von B. Foster und U. Kasten verwertet. Ich danke E. Frahm und G. Müller, die mir ermöglicht haben, noch unpublizierte Arbeiten zu zitieren, und M. Weszeli, die das Manuskript gelesen hat. Die gelegentliche Wiederholung von Bekanntem bzw. andernorts Gesagtem scheint angesichts des oft unterschätzten Potentials der altorientalischen Quellen, zur allgemeinen Diskussion um die ‘Ancient Economy’ beizutragen, nicht unnötig zu sein. Vgl. z.B. die diesbezügliche Stellungnahme von Cohen 2002, 3, wo im übrigen die Aussage von Kuhrt 1998, 16(sic), die sehr wohl meint, daß sinnvoll über „commercial practices in the ancient Near East“ gesprochen werden kann, durch verkürztes Zitieren in ihr Gegenteil verkehrt wird.

116

Michael Jursa

schen Nutzung großer Teile des südmesopotamischen Alluviums in sassanidischer Zeit (Adams 1981, 181): insgesamt ein beeindruckendes Bild stetiger landwirtschaftlicher Expansion und kontinuierlichen demographischen Wachstums, das freilich nicht frei von Problemen ist. Nicht alle relevanten Regionen wurden mit gleicher Intensität bzw. überhaupt untersucht, die Datierungen aufgrund des (weitgehend unpublizierten) Keramikbefundes sind notwendigerweise unscharf. Das Modell bedarf also philologischer Absicherung, Präzisierung und Korrektur. Auch die chronologische Verteilung der schriftlichen Quellen ist bekanntlich uneinheitlich: Die Informationen bis zum Anfang des siebenten Jahrhunderts sind spärlich. Aus dem sechsten und fünften Jahrhundert ist viel Material erhalten, in den folgenden Jahrhunderten verringert sich die Dokumentation wieder kontinuierlich.3 Ab dem vierten Jahrhundert nimmt nicht nur die Zahl der Texte stetig ab, es ist auch eine thematische Einengung der in den Urkunden behandelten Themen zu konstatieren.4 Nur im sechsten und fünften Jahrhundert könnte man hoffen, einen annähernd vollständigen Überblick über die babylonische Wirtschaft zu erhalten - und selbst zu dieser Zeit wird man, wie gleich zu zeigen sein wird, enttäuscht. Im folgenden wird vor allem über die Zeit zwischen dem sechsten und vierten Jahrhundert gehandelt, wobei zu betonen ist, daß in vieler Hinsicht die Eroberung Babyloniens durch die Perser keine Zäsur in wirtschaftlicher Hinsicht bedeutet. Babylonien im ersten Jahrtausend v. Chr. ist trotz dieser Einschränkungen eines der durch schriftliche Quellen bestdokumentierten Gebiete des Altertums – die Zahl der einschlägigen Texte in westlichen Museen ist annähernd sechsstellig. Freilich gilt hier, wie für alle anderen Perioden der mesopotamischen Geschichte, die grundsätzliche Regel, daß die schriftlichen Quellen nur einen Teil der sozialen bzw. ökonomischen Realität beleuchten. Nicht alle Strata der Gesellschaft haben im gleichen Ausmaß Zugang zu und Veranlaßung für Schriftgebrauch: Urbane Eliten sind ein dominanter, wenn auch nicht der einzige Focus der Quellen. Zudem werden nur jene Transaktionen schriftlich festgehalten, auf die in Zukunft einmal rekurriert werden könnte.5 Dies bedeutet im gegebenen Zusammenhang, daß z.B. Zug-um-Zug-Transaktionen wie unanfechtbare Barkäufe von Naturalien normalerweise unsichtbar bleiben6- die entscheidende Frage nach dem Umfang des Marktaustauschs im Vergleich zu anderen Transaktionsformen kann daher nur auf indirektem Weg beantwortet werden.

3 4 5 6

Dandamaev 1984, 7ff. gibt einen bequemen Überblick für das siebente bis vierte Jahrhundert, der durch seither bekannt gewordenes Material in seiner Gewichtung nicht wesentlich beeinträchtigt wird. S. Oelsner 2003 mit weiterer Literatur. S. hierzu van de Mieroop 1997. In Privatarchiven sind Käufe dieser Art nur nachweisbar, wenn entweder Zahlung oder Lieferung kreditiert werden. Die Dokumentation in den administrativen Tempelarchiven ist diesbezüglich ausführlicher.

Wirtschaftsformen Babyloniens

117

1.2. Grundzüge der Wirtschaft im alluvialen Schwemmland Südmesopotamiens7 Die Wirtschaft Südmesopotamiens im Altertum beruht in allen Perioden überwiegend auf dem Bewässerungslandbau. Die arbeitssparende Verwendung des Saatpflugs in einem extensiven Ackerbauregime ermöglicht hohe Erträge in Relation zum eingesetzten Saatgut. Der wesentliche limitierende Faktor ist dabei in der Regel nicht die Verfügbarkeit von Land, sondern die von Wasser. Der Ackerbau steht in einem symbiotischen Verbund mit der Kleinviehzucht, die unter Nutzung der Grassteppe vor allem von (halb)nomadischen Bevölkerungsteilen betrieben wird und deren bei weitem wichtigstes Produkt Wolle ist. Textilherstellung gilt als wesentlicher ‘Industriezweig’ Südmesopotamiens; ihr ist im für das rohstoffarme Mesopotamien essentiellen Fernhandel eine entscheidende Rolle zuschreiben. Regelmäßige landwirtschaftliche Überschüsse und geringe Transportkosten (durch das Netzwerk an Kanälen) ermöglichen wirtschaftliche Konzentration, die zur Herausbildung von lokal dominierenden großen ökonomischen Entitäten (Haushalten, oikoi) in üblicherweise religiöser Einkleidung („Tempel“) führt. Die Wirtschaftsform dieser institutionellen Haushalte ist als (weitgehend) geschlossene Hauswirtschaft beschrieben worden: Idealtypisch sind sie ökonomisch autark. Die Produktion wird zentral verwaltet, die Erträge werden in Speichern gesammelt und an das Personal redistribuiert. Das ökonomische Potential dieser Haushalte zur Erwirtschaftung von Überschüssen ist von eminenter politischer Bedeutung für die Herrschenden (und deren stärker tributär wirtschaftende ‘Palasthaushalte’). Ihre Aktivitäten und Ressourcen bedürfen steter (schriftbasierter) Supervision und stehen in der schriftlichen Dokumentation immer stark im Vordergrund. Das darf aber nicht zu dem Fehlschluß verleiten, die institutionelle Wirtschaft mit der Gesamtwirtschaft gleichzusetzen. Privater Grundbesitz wohlhabender Städter ist fast immer gut bezeugt, und es gibt triftige Gründe, die Existenz von ländlichen Siedlungen von (weitgehend) unabhängigen Subsistenzbauern zu postulieren, die saisonal, etwa zur Erntezeit, eine wichtige Rolle als Arbeitskräftereservoir für die institutionellen Haushalte gespielt haben. 1.3. Besonderheiten des ersten Jahrtausends? Will man das erste Jahrtausend v. Chr. in die beschriebene wirtschaftliche longue durée Mesopotamiens einordnen, sind zunächst dieselben ökonomischen Akteure wie in vorhergehenden Jahrtausenden zu konstatieren. Die institutionellen Haushalte, Palast und Tempel, spielen immer noch eine große Rolle in der Dokumentation. Die Tempel sind dabei freilich durch drei große und mehrere kleine Archive wesentlich besser bezeugt als der Palastsektor der Wirtschaft.8 Dieser kann fast nur durch indirekte Information erschlossen werden. Ein wichtiges drittes Ele7 8

Für dieses (vereinfachte) Modell vgl. z.B. Liverani 1998, van Driel 1998, 1999a, 2000, 2002, Jursa 2002a. Die wichtigsten Tempelarchive sind die des Ebabbar von Sippar und des Eanna von Uruk vor allem aus dem sechsten und frühen fünften Jahrhundert (Pedersén 1999, 193f. 205ff.) mit über 30000 bzw. über 10000 Tafeln und das wesentlich kleinere Archiv des Esangila von Babylon mit einigen hundert Texten vor allem aus dem vierten und dritten Jahrhundert (vorläufig Boiy 2000, 25ff. u.ö.).

118

Michael Jursa

ment innerhalb der institutionellen Wirtschaft neben Palast und Tempel sind die ländlichen Siedlungen von Dienstverpflichteten des Staates. Diese Landnutzungsform ist am besten für die Achämenidenzeit bezeugt, sie läßt sich aber mittlerweile auch in der neubabylonischen Zeit nachweisen und hat klare Vorläufer im zweiten Jahrtausend. Das System sichert dem Staat Arbeiter und Soldaten. Zusätzlich dient es einerseits der Erschließung von brachliegendem institutionellen Land, und andererseits der Integration geschlossener Gruppen von Nicht-Babyloniern, besonders Nicht-Seßhaften, in die Gesellschaft und die staatlichen Strukturen.9 Privatarchive hat auch im ersten Jahrtausend in Babylonien überwiegend die urbane Oberschicht mit Grundbesitz in und bei den Städten und häufig mit Verbindungen zu den Institutionen, vor allem zu den Heiligtümern, hinterlassen.10 Auch hinsichtlich der Wirtschaftsformen möchte man zunächst im Grundsätzlichen Kontinuität feststellen. Die Tempel sind nach wie vor das beste Beispiel für eine Redistributionswirtschaft, der königliche Haushalt bzw. der Palast weist ebenfalls wie früher sowohl redistributive als auch tributäre Züge auf. Die Institutionen sind mit dem privaten Sektor durch die Aktivitäten von Unternehmern verwoben, die bestimmte Teilbereiche der institutionellen Wirtschaft auf eigene Rechnung und auf eigenes Risiko betreuen und den Institutionen dafür eine pauschale Vergütung zahlen. Solche Geschäftsverhältnisse können z.B. bereits in der altbabylonischen Zeit in im Prinzip völlig identischer Form nachgewiesen werden.11 Überhaupt beobachtet man auch bei der städtischen Oberschicht dieselben ökonomischen Aktivitäten wie in früheren Perioden: Die wesentlichen Einkommensquellen sind Grundbesitz,12 Tempelpfründen,13 verzinsliche Darlehen14 und zu guter Letzt diverse Geschäftsunternehmungen, die man allein oder in Partnerschaft mit anderen betreibt.15 Muß man aus all dem schließen: Nichts Neues im 1. Jahrtausend? Nein. Der wesentliche Unterschied zu früheren Perioden der Mesopotamischen Geschichte liegt in der Gewichtung der einzelnen Wirtschaftsformen. Hinsichtlich einer einigermaßen seriösen Quantifizierung stehen wir zwar erst am Anfang, aber es zeichnen sich bereits einige Muster ab. 1.4. Die institutionellen Haushalte Das übliche Modell einer redistributiven Wirtschaftsform zeichnet das Bild eines annähernd geschlossenen Kreises: Der institutionelle Haushalt produziert, was er benötigt; die Güter werden zentral verwaltet und umverteilt. Etwaige Überschüsse werden verwendet, um Prestigegüter und nicht im Lande verfügbare Materialien wie z.B. Metalle einzuhandeln. Dieses Modell hält einer Überprüfung anhand der neubabylonischen Tempelarchive in wesentlichen Punkten nicht stand. Zwar las9 Ausführlich behandelt von van Driel 2002, 226ff. 10 Pedersén 1999, 181ff. nennt einige der bekannteren Archive. Repräsentative Studien zu einzelnen Archiven: Wunsch 1993 und 2000a, Joannès 1989, Kessler 1991, Jursa 1999. 11 Zu alledem s. u.a. van Driel 1999b, Renger 2000, Jursa 2002a. 12 Z.B. Wunsch 2000a. 13 S. jetzt ausführlich van Driel 2002, 33ff. 14 Z.B. Wunsch 2002. 15 Z.B. Lanz 1976, Wunsch 1993, 21ff.

Wirtschaftsformen Babyloniens

119

sen sich alle Transaktionsformen, die das Modell fordert, nachweisen, ihre Gewichtung ist aber unerwartet. Die landwirtschaftliche Produktion der institutionellen Haushalte wird in signifikantem Ausmaß kommerziell verwendet, auch zum Kauf anderer landwirtschaftlicher Güter. Von Autarkie kann daher selbst hinsichtlich der Deckung der Grundbedürfnisse keine Rede sein. Trotz der Quantifizierungsversuchen inhärenten Schwierigkeiten und zahlreicher noch offener Fragen läßt sich dies schon heute anhand des nordbabylonischen Ebabbar und des südbabylonischen Eanna illustrieren. Das Ebabbar-Archiv ist das größte neubabylonische Archiv. Im 6. Jahrhundert ist hier die Dichte der Quellen und daher auch die Wahrscheinlichkeit am größten, daß quantifizierende Untersuchungen zu brauchbaren Ergebnissen führen.16 An drei Besonderheiten sieht man, daß sich die Wirtschaft des Ebabbar in wesentlichen Punkten vom geschilderten Modell der geschlossenen Hauswirtschaft unterscheidet. Der erste Punkt betrifft die Schwerpunktsetzung in der Tempellandwirtschaft, dem wesentlichen Produktionszweig. Es wird offenbar bewußt in die intensive Dattelgartenwirtschaft investiert, und zwar auf Kosten des extensiven Ackerbaus. Damit folgt das Ebabbar zwar im Prinzip einem auch etwas weiter südlich, in der Region von Babylon und Borsippa, beobachtbaren Trend,17 aber die Intensität, in der das geschieht, ist bemerkenswert.18 Der Grund dafür - damit kommen wir zum zweiten Punkt - ist, daß ein großer Teil der Dattelernte nicht intern verbraucht, sondern verkauft worden ist. Nur selten handelt es sich nachweislich nur um die Verwertung von zufällig angefallenen Rückständen in den Speichern,19 die große Menge der Quittungen über einzelne Dattelverkäufe vor allem gegen Silber läßt vielmehr keinen Zweifel daran, daß es sich um Routinetransaktionen handelt.20 Oft kommen die Datteln gar nicht erst in die Tempelspeicher, da die Unternehmer, die mit der Eintreibung der Ernte beauftragt sind, einen Teil derselben gleich selbst verkaufen und dem Tempel nur das Silber auszahlen.21 Im Augenblick ist noch nicht sicher abzuschätzen, wie hoch der Anteil der verkauften Datteln an der Gesamternte genau war und ob es diachron Schwankungen gegeben hat. Daß aber jedenfalls ein signifikanter Teil der Ernte betroffen war, belegen allein schon Texte wie CT 57, 22, der immerhin in einer einzigen Transaktion den Verkauf von etwas unter 5 % der geschätzten Gesamternte der Dattelgärten des Tempels bezeugt.22 Dattelverkäufe sind im Archiv insgesamt deutlich besser bezeugt als

16 Die wesentlichen Monographien zum Thema: MacGinnis 1995, Jursa 1995, Bongenaar 1997, Da Riva 2002. 17 Z.B. Wunsch 1999, 351; 2000a I 53. 18 S. die Zusammenfassung in Jursa 1995, 194b. 19 BM 75787: Verkauf alter Datteln. 20 Z.B. Nbn. 612. 753. 904. 905; BM 63885 u.v.a.m. 21 Passim etwa bei landwirtschaftlichen Zehntpächtern: Jursa 1998, 39f., 51f. u.ö. Ähnliches läßt sich auch bei den Pfründengärtnern, den rab-banê, belegen: VS 4, 14, BM 63906. 22 Silber für 426 Kor (ca. 60 t) Datteln, gezahlt vom Generalpächter Ana-am!t-B"l-atkal, der ausweislich von BM 61774 10000 Kor (ca. 1400 t) Datteln für die gesamten Dattelgärten des Ebabbar abzuliefern hatte (Jursa 1995, 88).

120

Michael Jursa

Gersteverkäufe23 - ein Beweis für die im Vergleich zum Gersteanbau stärkere Marktorientiertheit des Dattelgartenbaus. Die Silbereinnahmen aus den Dattelverkäufen dienten primär für den Ankauf von Vieh und Naturalien wie Gerste oder Sesam.24 Die eigenen Herden des Ebabbar scheinen bei weitem nicht ausgereicht zu haben, den Bedarf zu decken. Die Spezialisierung auf den Dattelanbau hilft also, Schwächen in anderen Bereichen der Tempelwirtschaft zu kompensieren. Eine ähnliche ökonomische Spezialisierung läßt sich im Eanna-Archiv beobachten. Hier ist es der Verkauf von Wolle, der die wesentliche Silbereinnahmequelle darstellt und zum Teil auch für die Finanzierung von Naturalienankäufen en gros dient. Unter den Abnehmern finden sich nicht nur Individuen, zum Teil als Kaufleute identifizierbar, sondern auch Institutionen wie der Palast in Babylon oder der Gouverneur des Meerlandes.25 Der Wollhandel des Eanna ist auch unter dem Gesichtspunkt des mesopotamischen Fernhandels von Interesse; dazu siehe unten. Das durch die ökonomische Spezialisierung erwirtschaftete Silbereinkommen der beiden Tempel dient neben dem Ankauf von landwirtschaftlichen Gütern und Vieh vor allem auch der Beschaffung von Arbeitskraft - hier ist der dritte Punkt, in dem man signifikante Abweichungen vom traditionellen oikos-Modell beobachten kann. Das Ebabbar war für größere Bauprojekte zu zwei Drittel bis drei Viertel von angemieteten Arbeitskräften abhängig. Anders als das bei einer Institution des dritten Jahrtausends der Fall gewesen wäre, waren das eigene Personal des Tempels und die über Abhängigkeitsverhältnisse mobilisierbaren Personen nicht zahlreich genug, auch nur annähernd die anstehenden Aufgaben zu bewältigen.26 Auch dem Eanna erging es nicht anders.27 Eine weitere administrative und ökonomische Innovation folgt aus dem eben Dargestellten. Schon im 6. Jahrhundert läßt sich ansatzweise auch im Kernbereich der redistributiven Tempelwirtschaft, im Zusammenhang mit der Distribution von Pfründeneinkommen und Opfermaterialien, eine gewisse Monetarisierung feststellen: Anstelle von Naturalien wird des öfteren Silber ausgezahlt, das entweder als Substitut für das Einkommen gilt oder mit dem Opfermaterialien einzukaufen 23 Typisch ist CT 57, 206: 5-10, wonach Datteln gegen Silber und Gerste verkauft werden. 24 Vgl. die Übersicht bei Bongenaar 1999. 25 Eine genaue Untersuchung wird im Rahmen des oben Anm. 1 genannten Projekts gegeben werden. Hier nur einige Referenzen zur Illustration: JCS 24, 105 UNC 14; ZA 66, 286ff. YBC 4141 und YBC 4012; ZA 67, 43ff. YBC 4038 und YBC 3740; NCBT 191; NBC 4859. 26 Dies läßt sich anhand eines Dammbauprojekts nördlich von Sippar nachweisen, das im Ebabbar-Archiv gut dokumentiert ist: Jursa 1995, 184ff. 27 Einige Briefe zeigen dies sehr deutlich. In NCBT 38 z.B. heißt es, daß nur ein Viertel der bei einem bestimmten Projekt zu bewältigenden Erdarbeiten mit tempeleigenem Personal durchgeführt werde, für den Rest sei man auf teure Mietarbeiter angewiesen. YOS 3, 69 dokumentiert exorbitante Lohnforderungen (sechs Schekel pro Monat) von Mietarbeitern, die sich offensichtlich der Tatsache bewußt waren, daß die Tempelverwaltung keine Alternativen zu ihren Diensten hatte. Der Arbeitskräftemangel der Tempel steht im übrigen nicht in einem Gegensatz zum generellen Bevölkerungswachstum, das sich aus dem archäologischen Befund ergibt (vgl. van Driel 2002, 219), sondern beruht auf der generell geschwächten Position der Tempelhaushalte im ersten Jahrtausend.

Wirtschaftsformen Babyloniens

121

sind.28 Das ist der Beginn einer Entwicklung, die letztendlich dazu führt, daß ausweislich des Rahimesu-Archivs im Babylon des frühen ersten Jahrhunderts v. Chr. auch im Kontext der Tempelwirtschaft Löhne und Rationen generell in Silber gezahlt oder mindestens berechnet wurden.29 Die Abhängigkeit der Institutionen von freien Mietarbeitern, die weitgehende Integration wichtiger Produktionszweige in den marktwirtschaftlichen, geldbasierten Austausch und die damit einhergehende ökonomische Spezialisierung bedeuten insgesamt, daß das Modell eines redistributiven autarken Haushalts, also das klassische oikos-Modell, nicht geeignet ist, die Wirtschaftsformen der neubabylonischen Tempel hinreichend zu beschreiben. Von Autarkie kann keine Rede sein, die Kontinuität im Vergleich zu früheren Perioden ist nur scheinbar. 1.5. Der private Sektor Hinsichtlich der Verteilung der Wirtschaftsformen, die man im nichtinstitutionellen Bereich, d.h. vor allem bei der urbanen Oberschicht, antrifft, lassen sich modellhaft zwei Typen, ein Rentiertyp und ein Entrepreneurtyp, differenzieren.30 Der Rentier nutzt vorhandenes, normalerweise ererbtes Kapital, vor allem Land und Tempelpfründen. Soweit über den unmittelbaren Eigenbedarf hinaus Überschüsse erzielt werden, werden diese in weiteres Land oder weitere Pfründen, gegebenenfalls auch in kleinere verzinsliche Darlehen investiert. Größere Eigentumsbewegungen erfolgen im Regelfall nur im Zusammenhang mit Erbschaft oder Heirat. Über Land und die notwendigen Produktionsmittel zu verfügen, bedeutet Sicherheit, wohl auch Prestige. Man trennt sich daher normalerweise nicht von ererbtem Grund- oder Pfründenbesitz. Die zahlreichen erhaltenen Kaufverträge für Gärten, Felder oder Pfründen sind kein Gegenargument. In jenen Fällen, in denen über größere Dossiers die Hintergründe der Transaktionen erschlossen werden können, zeigt sich meist, daß es sich um Zwangsverkäufe aus Notlage handelt.31 Dies gilt, obwohl rein rechnerisch eine Investition in Handelsunternehmen oder in Kreditgeschäfte größere Gewinne abwerfen hätte können als die Investition in Land.32 Im übrigen gibt es Anzeichen, daß für das wirtschaftli-

28 Sippar: z.B. Cyr. 33, 206; CT 57, 97, 177; einige weitere Belege bei MacGinnis 1995, 141f., 146, 148f. Besonders Sesam wird gekauft: Bongenaar 1997, 262+232. Uruk: z.B. GCCI 1, 198. 362. 379; GCCI 2, 211; ZA 67, 48f. YBC 3740; Sack, Cuneiform Documents 55, u.v.a.m. 29 Van der Spek 1998, 247. 30 Dies sind Termini, die letztendlich auf Pareto zurückgehen. Weber 1980, 178 differenziert Rentner als typische Vertreter „positiv privilegierter Besitzklassen“ von Unternehmern, Angehörigen „positiv privilegierter Erwerbsklassen“. 31 Vgl. für Landkäufe z.B. Wunsch 2000a, I 43ff. (Egibi-Archiv), 2002, 241ff.; mehrere jüngere Beispiele im noch weitestgehend unpublizierten Šangû-Ištar-Babili-Archiv aus Kutha (spätes fünftes Jahrhundert v. Chr.). Analoges wird für Pfründenkäufe gelten, nur ist hier der Nachweis mangels größerer Dossiers zu einzelnen Transaktionen nicht so einfach zu führen. 32 Der Maßstab hier ist die übliche Verzinsung von Darlehen, 20 % p.a. Geschäftsgesellschaften mit der üblichen Gewinnteilungsklausel sollten dementsprechend in der Regel mindestens 40 % erwirtschaften können, um sie für Anleger attraktiv erscheinen zu lassen. Die wenigen eindeutigen Belege stützen diese theoretische Grundannahme (Lanz 1976, 138f.; vgl. auch Joannès 1999, 188 zu YOS 6, 52 zur Lukrativität von Fernhandelsunternehmen). Bei Investitionen in

122

Michael Jursa

che Handeln dieser Leute auch gruppeninterne Reziprozität33 eine Rolle gespielt hat: Dafür sprechen vor allem Heiratsmuster34, aber auch gewisse Besonderheiten bei der Vergabe von Darlehen an Angehörige derselben sozialen Schicht.35 Die ökonomischen Strategien und die Mentalität des Rentier-Typs sind offensichtlich von den Erfordernissen einer ursprünglich vor allem auf Selbstversorgung abzielenden Subsistenzwirtschaft geprägt. Gänzlich anders die Investitionsmuster bei dem Entrepreneur-Typus: Hier findet man Gesellschaftsverträge für verschiedenste Zwecke, vom (Binnen-) Handelsunternehmen bis zum Führen eines Gasthauses,36 hier findet man in relativ hohem Ausmaß verzinsliche Darlehen,37 hier findet man gezielten marktorientierten Anbau von bestimmten landwirtschaftlichen Nischenprodukten sowohl auf eigenem als auch auf fremdem Land.38 Handwerk bzw. die handwerkliche Verwendung von Sklaven, normalerweise in kleinem Rahmen, als Heimarbeit, fällt ebenfalls in diese Kategorie.39 Der Besitz von einigen Haussklaven und -sklavinnen zu diesem Zweck und für allgemeine Hilfsdienste ist in dieser sozialen Schicht ebenso wie bei Rentiers weit verbreitet, Familien mit Dutzenden von Sklaven wie der Babylon-Zweig der Familie Egibi40 sind jedoch Ausnahmen. Die charakteristischste Aktivität babylonischer Unternehmer ist das unternehmerische Verwalten von und Wirtschaften mit fremdem Kapital. Hier ergänzen einander im privaten Bereich die Bedürfnisse des Rentiers und des Entrepre-

33

34

35

36 37 38 39

40

Dattelgärten, die ertragreichste Form des Landbesitzes, kann man nach Joannès 1989, 97ff. nur rund 14 % Ertrag p.a. erwarten (diese Zahlen bedürfen weiterer Absicherung). Wir behalten für die Transaktionstypen die traditionelle, auf Polányi zurückgehende Terminologie bei, obwohl Sahlins’ graduelle Reziprozitätsskala, auf der alle Formen wirtschaftlichen Austauschs vom Geschenk bis zum Beutegut Platz haben, ein der Realität besser angepaßtes Modell ist (von Reden 2003, 3). Am deutlichsten ist dies bei Familien von Tempelpfründnern zu sehen, die konsequent untereinander Heiratsverbindungen knüpfen. S. z. B. Bongenaar 2000, 84f., Jursa 1999, 36f. Spezialfälle sind (manchmal leviratsähnliche) endogame Ehen, die aus erbrechtlichen Erwägungen geschlossen werden: Joannès 1987, Waerzeggers 2002. Mindestens im B"l-r"manni-Archiv sind Silberdarlehen, vor allem verzinste Darlehen, in der Regel bei Außenstehenden aufgenommen worden. Das läßt die Vermutung zu, Zinsen von Angehörigen derselben Gruppe zu nehmen, sei möglichst vermieden worden (ein Verbot gibt es natürlich nicht). Kleinere zinslose Konsumptionsdarlehen innerhalb der Gruppe, die es sicherlich gegeben hat, müßten mindestens bei B"l-r"manni schriftlos erfolgt sein. Jursa 1999, 124f. Andere Archive müssen noch auf diese Fragen hin untersucht werden. Lanz 1976. Überblick über die vertretenen Gewerbezweige 139ff. S. z.B. Wunsch 2002. Dergleichen ist im N#r-Sîn/Egibi-Archiv bezeugt: Wunsch 1993, Jursa 1995/96. Eine noch genauer zu untersuchende Frage ist, ob und in welchem Ausmaß Handwerker und allgemein Unternehmer bezeugt sind, die keinen oder auch nur keinen nennenswerten landwirtschaftlichen Grundbesitz ihr eigen nennen - eine Eigentumsverteilung, die einer grundsätzlichen Abkehr von den traditionellen Substistenzmustern der urbanen Oberschicht gleichkäme. S. unten Anm. 59. Ungefähr 100 namentlich genannte Sklaven werden in der Erbteilungsurkunde Dar. 379 aus diesem Archiv (dazu Wunsch 1999 u.ö.) zwischen den Parteien aufgeteilt.

Wirtschaftsformen Babyloniens

123

neurs.41 Vor allem aber ergeben sich Berührungspunkte mit der institutionellen Wirtschaft, die in wesentlichen Bereichen auf solche Unternehmer angewiesen ist.42 Das Spektrum reicht von staatlicher Steuerpacht über die landwirtschaftliche Generalpacht von Tempel- und Königsland bis zu der Verwaltung von Tempelgeldern durch babylonische und nicht-babylonische Bankiers ab dem dritten Jahrhundert.43 Die ökonomische Mentalität der Entrepreneure unterscheidet sich offensichtlich von der der Rentiers. Dies ist auch nicht anders zu erwarten, da ja ganz unterschiedliche ökonomische Nischen besetzt werden. Wir haben leider keine so offensichtlichen Belege wie im Altassyrischen, wo einem Händler gesagt wird: Du liebst das Geld44. Es kann jedoch wenig Zweifel geben, daß diese Aussage genausogut auch auf einen neubabylonischen Geschäftsmann zugetroffen hätte. Diese Leute agieren in einem kompetitiven Umfeld offensichtlich profitorientiert.45 Exzessives Gewinnstreben auf Kosten anderer galt freilich ausweislich einiger literarischer Belege als moralisch verwerflich; vereinzelte Belege in Urkunden bezeugen explizit den Verzicht auf Profit aufgrund von „Mitleid“ mit Schuldnern. Dergleichen wird selten gewesen sein, die wenigen Belege helfen aber immerhin, unser Bild von der herrschenden ökonomischen Mentalität zu nuanzieren.46 Diese zwei Idealtypen findet man realiter natürlich nie ganz rein vertreten. In fast allen Archiven gibt es Elemente von beiden Typen, aber nie im gleichen Ausmaß, immer überwiegt entweder der eine oder der andere. Daher hat die Unterscheidung durchaus heuristischen Wert. Nützliche diagnostische Kriterien sind einerseits Tempelpfründenbesitz und damit verbundene Geschäftstätigkeiten und andererseits Gesellschafts- oder harr!nu-Unternehmungen. Archive, bei denen das inhaltliche Schwergewicht auf einer dieser beiden Kategorien liegt, enthalten normalerweise keine oder kaum Evidenz für die jeweils andere Kategorie. Tempelpfründen sind überwiegend in den Händen der alteingesessenen Familien mit engen Bindungen an die lokalen Tempel, die die traditionelle Oberschicht der babylonischen Städte bilden. Unternehmerische Aktivitäten beschränken sich in die41 So etwa bei Gesellschaftsverträgen mit einseitiger Kapitalbeteiligung (Lanz 1976, 73ff.) oder bei Pfründendienstverträgen (Kessler 1991, 92ff., Jursa 1999, 44ff.). 42 S. Bongenaar 2000, eine Aufsatzsammlung, die dieser für Mesopotamien typischen Verschränkung ‘privater’ und ‘institutioneller’ Wirtschaft gewidmet ist. Jursa 2002a ist der Versuch einer diesbezüglichen Synthese. 43 Beaulieu 2000, van Driel 1999b und Wunsch 2000b geben Beispiele für die meisten Typen neubabylonischen Unternehmertums; für das Bankwesen in hellenistischer Zeit s. Jursa (in Vorbereitung). 44 Larsen 1982, 214. 45 Ihr gutes Verständnis für die ökonomischen und außer-ökonomischen Bedingungen, unter denen sie ihre Geschäfte führen müssen, läßt sich in der Regel nur indirekt aus den Urkunden deduzieren. Die deutlichste Ausnahme ist TCL 13, 182 aus Uruk, worin unterschiedliche Bedingungen, unter denen ein Generalpachtvertrag geschlossen werden soll, gegeneinander abgewogen werden (van Driel 1999, 216f.). - ‘Profit’ muß natürlich definiert werden (vgl. Morris 2002). Das Verständnis des Worts, das uns hier vorschwebt, ist durchaus (und bewußt) ‘modern’; dies freilich nicht aufgrund einer a priori-Annahme, sondern auf der Basis unseres Verständnisses der Quellen. Vgl. unten bei Anm. 73. 46 S. dazu Jursa 2002b, 203ff.

124

Michael Jursa

sen Kreisen in der Regel auf diesen Pfründenbereich, allenfalls findet man noch Geldverleih im kleinen Rahmen und landwirtschaftliche Geschäfte moderaten Umfangs über die Bearbeitung eigenen Grundbesitzes hinaus: Die meisten Tempelpfründner sind typische Rentiers.47 Unternehmer sind im Vergleich zu dieser Gruppe wesentlich weniger leicht sozial einzuordnen.48 Im sechsten und frühen fünften Jahrhundert entstammt zwar die Mehrzahl der urbanen Oberschicht, also jener Gruppe, in der die Angabe von (fiktiven?) Ahnherren- oder ‘Familiennamen’,49 die zum Teil in das zweite Jahrtausend zurückreichen, üblich ist,50 nicht wenige andere sind aber offensichtlich Außenseiter, homines novi, zum Teil nicht babylonischer Herkunft.51 Vereinzelt können auch unfreie Personen als Unternehmer tätig werden.52 Archive des Rentiertyps sind insgesamt wesentlich zahlreicher. In Zukunft wäre diachron zu untersuchen, unter welchen Bedingungen Unternehmer der beschriebenen Art bevorzugt auftauchen, und welche Bedingungen für sie nicht förderlich sind. Ein nützliches Modell könnte Le Roy Laduries bekannte Arbeit zum Languedoc des 15.-18. Jahrhunderts53 bieten, in der er eine ähnliche Unterscheidung wie die hier vorgeschlagene trifft und die Verteilung der beiden Typen mit den sekulären Schwankungen der landwirtschaftlichen Produktivität (und der Bevölkerung) korreliert - das sind Zyklen, wie es sie möglicherweise durchaus ähnlich im Babylonien des ersten Jahrtausends v. Chr. gegeben hat; das legt zumindest die noch unpublizierte Arbeit von Gerfrid Müller zu den Preisangaben in neubabylonischen Texten nahe.54 1.6. Der Staat, der Markt und das ökonomische Wachstum Die Rolle des Staats, oder der königlichen Verwaltung, kann sowohl während der Chaldäerzeit als auch später in der Achämenidenzeit mangels einschlägiger 47 Einige Beispiele: die von Kessler 1991 untersuchten Privatarchive aus Uruk, das B"l- r"manniArchiv (Jursa 1999), die Archive um die Familie Ea-il#ta-bani (Joannès 1989) und mehrere andere (größtenteils noch unpublizierte) Archive aus Borsippa (für das Anm. 1 genannte Projekt von C. Waerzeggers aufgenommen). Ausnahmen sind einige Generalpächter von Tempelland, die zugleich in das Pfründensystem integriert sind (Joannès 2000, 40+29, 31, Jursa 1999, 37+122). 48 Vgl. die Überlegungen und Belege in Joannès 2000, 36-40. 49 Lambert 1957, Ungnad 1935. 50 Beispiele sind etwa die berühmten Egibis (Wunsch 2000a etc.) oder Iddin-Marduk aus der Familie N#r-Sîn (Wunsch 1993). Die Unternehmer stammen allerdings im Gegensatz zu den allermeisten Pfründnern nicht immer aus lokal alteingesessenen Familien. Die ersten Generalpächter in Uruk etwa kamen mit großer Sicherheit aus Babylon (vgl. Joannès 2000, 38). 51 Ein Beispiel ist Ana-am!t-B"l-atkal, der erste Generalpächter der Dattelgärten des Ebabbar in Sippar, dessen Vater Nabû-dal! einen aramäischen Namen trägt (Jursa 1995, 88). 52 Vgl. etwa die drei Generalpächter von Land des Eanna, die zugleich širkus, also Oblaten oder Tempelsklaven, sind (Joannès 2000, 40). Ein anderes Beispiel ist B"l-ana-m"rehti, Sklave eines B"l-iddin, der während der Regierungszeit von Xerxes in Kiš/Hursagkalama aktiv war (OECT 10, 174, 177, 179 u.ö.). (Weitgehend) unabhängig agierende Sklaven bezeugt auch das N#r-Sîn/Egibi-Archiv (s. vorläufig Dandamaev 1984, 345ff. u.ö.). 53 Le Roy Ladurie 1983 [1969]. 54 Müller 2001.

Wirtschaftsformen Babyloniens

125

Staatsarchive nur indirekt erschlossen werden. Dieser Mangel an direkten Quellen verschleiert die entscheidende Bedeutung des Staats für die ökonomische Entwicklung Babyloniens als Ganzes.55 Staatlicher Einfluß ist im Bereich der institutionellen Tempelwirtschaft maßgeblich für die Bemühungen um erhöhte Effizienz und Ertragsteigerung der landwirtschaftlichen Produktion verantwortlich, die hinter der Institution der Generalpacht, also der Verpachtung der Tempelländereien en gros an private Unternehmer, stehen.56 Auch sonst wird deutlich, daß die Tempel letztendlich der königlichen Autorität unterstehen und ihre Ressourcen – sowohl personeller als auch materieller Art – zur Deckung staatlicher Bedürfnisse herangezogen werden können. Auch der Privatsektor hat beträchtliche Lasten zu tragen. Die hauptsächlichen Einnahmequellen des Staats sind einerseits direkte Besteuerung der Erträge von Ländereien mit einem bestimmten Status, die an Dienstverpflichtete im Hinterland der Städte vergeben worden sind, und andererseits indirekte Steuern, die in Zusammenhang mit verschiedenen ‘Dienstleistungen’ – Hafenabgaben, Brückenzoll, Gebühren für Verwaltungsbeamte, ‘Notare’ und dergleichen mehr – eingehoben werden. Zusätzlich gibt es offenbar periodische Dienstverpflichtungen, denen auch die Stadtbevölkerung qua ihres Status und ihrer Zugehörigkeit zu einer bestimmten sozialen Gruppe unterworfen war.57 Van Driel schätzt – durch Extrapolation auf der Basis von jeweils nur punktuell bezeugten Abgabeformen, deren Relevanz für Gesamt-Babylonien zwar plausibel ist, aber nicht bewiesen werden kann – , daß in der Achämenidenzeit bis zu einem Drittel der landwirtschaftlichen Produktion vom Staat einbehalten wurde.58 Die achämenidischen Eroberer haben im wesentlichen bestehende Steuer- und Abgabestrukturen übernommen, systematisiert und sicherlich erweitert. Die Integration Babyloniens in ein wesentlich größeres Staatsgebilde muß dabei die bereits bestehende Tendenz zu einer Monetarisierung von Verpflichtungen gegenüber dem Staat, etwa die Ablösung von Dienstverpflichtungen durch Silberzahlungen, noch verstärkt haben. Das impliziert notwendigerweise die Existenz eines Markts, über den mehr als nur ein marginaler Teil der gesamten landwirtschaftlichen Produktion veräußert werden kann. Die oben erwähnte Marktorientiertheit der institutionellen Landwirtschaft läßt sich damit natürlich gut in Einklang bringen. Die Abnehmer werden zu einem großen Teil wiederum Institutionen bzw. der Staat gewesen sein, angesichts der umgeschlagenen Mengen sicherlich aber auch Teile der Stadtbevölkerung.59 Die Bedeutung des Markts erklärt (mindestens zum Teil), daß Kurse der wesentlichen landwirtschaftlichen Güter als astrologisch relevante Phänomene systematisch über Jahrhunderte in den sogenannten astronomischen Tagebüchern 55 56 57 58 59

Zum Folgenden s. allgemein vor allem van Driel 2002, 155ff. Z.B. van Driel 1999, 216+8. Die Zusammenfassung bei van Driel 2002, 314-322, ermöglicht einen bequemen Überblick. Van Driel 2002, 319. Womit die oben Anm. 39 gestellte Frage durch diese indirekte Evidenz wahrscheinlich mit Ja zu beantworten ist. Die im vorstehenden Absatz formulierten Konklusionen werden nicht von allen Spezialisten geteilt: Joannès 1999, 182 etwa vertritt die traditionelle Ansicht, die im Marktaustausch nur ein Komplement zu Selbstversorgung und Redistribution sieht.

126

Michael Jursa

gesammelt wurden.60 Eine statistische Auswertung dieses Materials erlaubt, sekuläre Preistrends ebenso zu erkennen wie regelmäßige saisonale Schwankungen jeweils vor und nach den Erntezeiten. Insgesamt sind die Kurse (bzw. Preise) recht volatil. Das ist ein Hinweis auf geringe Marktintegration: Lokale Engpässe können nicht schnell ausgeglichen werden und führen zu kurzfristigem rasanten Preisanstieg.61 Aus dem Vorhergehenden ergibt sich, daß die Rolle von Silber (bzw. Geld62) im Babylonien des ersten Jahrtausends kaum unterschätzt werden kann: Mit Ausnahme einer in den Quellen so gut wie unsichtbaren, aber dennoch zu postulierenden Subsistenzwirtschaft besonders auf dem Land hat - sicherlich in unterschiedlichem Maß - in allen Bereichen des wirtschaftlichen Lebens eine Monetarisierung Platz gegriffen. Die Menge des umlaufenden Silbers muß sich dementsprechend im Vergleich zu früheren Epochen deutlich erhöht haben.63 Wie dieses Silber nach Babylonien gekommen ist, kann nur indirekt erschlossen werden. In Frage kommen Beute bzw. Tribut und Erlöse des Fernhandels. In der Chaldäerzeit sind sicher beträchtliche Werte als Beute oder auch Geschenke aus dem Westen nach Babylonien geflossen. Für die Achämenidenzeit kann man dies aber nicht mehr annehmen, die Achämeniden haben vielmehr Silber aus Babylonien abgezogen (und gehortet). Somit kann in dieser späteren Periode Silber kaum anders als über den Fernhandel nach Babylonien gekommen sein. Über Details, insbesondere über die babylonischen Exporte, mit denen dieses Silber verdient worden sein muß, schweigen die Texte weitgehend (s. unten). Man erwartet vor allem Textilhandel; der im großen Stil betriebene Wollhandel des Eanna, den wir oben erwähnt haben, mag nur der erste Schritt in einer über Mesopotamien hinausgreifenden Kette von Transaktionen gewesen sein. Der altassyrische Textilhandel, bei dem u.a. babylonische Textilien en gros nach Anatolien vertrieben wurden, könnte dafür ein taugliches Modell bieten.64 Van Driel vermutet, daß der vom Staat ausgeübte (steigende) Druck durch generelles ökonomisches Wachstum aufgefangen worden sei, das (wie oben ausge-

60 Leider stammt die überwiegende Menge der Preisangaben aus der Spätzeit, aus der vergleichsweise wenig Urkunden überliefert sind, die es ermöglichen würden, das Zahlenmaterial der Tagebücher in einen Kontext zu setzen. 61 Zu alledem s. zuletzt ausführlich und mit weiterer Literatur van der Spek und Mandemakers (in Druck) und Vargyas 2001. 62 Gemünztes Geld wird erst in der Achämenidenzeit verwendet; die Münzen werden aber auch noch in hellenistischer Zeit gewogen. Vargyas 2001, 24ff. Zur Begründung der fakultativen Übersetzung von akkadisch kaspu „Silber“ durch „Geld“ s. z. B. Bongenaar 1999. 63 S. van Driel 2002, 164f., 318f. Obwohl stärker nachgefragt, hat Silber im ersten Jahrtausend sogar noch an Kaufkraft verloren. Man vergleiche den Normpreis von einem Schekel Silber (8,3 g) für 300 Liter Gerste in der ersten Hälfte des zweiten Jahrtausends v. Chr. mit der häufig zitierten Standardrelation von einem Schekel für 180 Liter im ersten Jahrtausend (wobei realiter die Kaufkraft von Silber sogar noch geringer war: Preise von zwei Schekel für 180 Liter sind keine Seltenheit und werden von Vargyas 2001, 130 noch als „durchschnittlich“ bezeichnet). 64 Zum altassyrischen Handel vgl. z.B. Dercksen 1999 und 2000 mit wesentlicher weiterer Literatur.

Wirtschaftsformen Babyloniens

127

führt) auch im archäologischen Befund deutlich werde.65 Freilich sind nicht nur die Umstände dieses Wachstums noch nicht ausreichend verstanden, der Terminus selbst bedarf genauerer Definition. Bloßes kumulatives Anwachsen der Produktion proportional zum Bevölkerungswachstum allein wäre als Kompensation für wachsenden Steuerdruck nicht überzeugend. Es wäre per-capita-Wachstum zu postulieren, also erhöhte Produktivität.66 Im entscheidenden landwirtschaftlichen Bereich läßt sich dies tatsächlich nachweisen; die schon erwähnte Konzentration auf den Dattelgartenbau im Norden und die Intensivierung des Ackerbaus im institutionellen Bereich durch höhere Saatmengen pro Fläche67 lassen sich dahingehend deuten. Analoge Erscheinungen in anderen Bereichen der babylonischen Wirtschaft müssen noch gefunden werden. Es ist allerdings fraglich, ob die steigende Steuerlast tatsächlich vollständig vom Wachstum aufgefangen wurde – die Aufstände gegen Xerxes können eine ihrer Ursachen durchaus in dieser gestiegenen Belastung der Bevölkerung haben, die, folgt man Müllers Analyse der Preisangaben aus dem späten sechsten und frühen fünften Jahrhundert, mit einer verschlechterten landwirtschaftlichen Ertragslage einherging.68 1.7. Zusammenfassung Trotz aller offenen Fragen läßt sich vor allem eine Lehre aus dem vorstehenden summarischen Überblick ziehen. Strukturell besteht in der untersuchten Periode eine Kontinuität zu früheren Phasen der mesopotamischen Geschichte, insofern die aus diesen Zeiten bekannten ökonomischen Akteure alle auch im ersten Jahrtausend weiterbestehen. Es ist jedoch deutlich, daß Marktaustausch und damit einhergehend Monetarisierung eine wichtige Rolle spielen und zunehmend auch in Bereiche vordringen, wo dies in früheren Perioden nicht oder nicht im gleichen Ausmaß der Fall war. Das gilt auch für Kernbereiche der Wirtschaft der institutionellen Haushalte. Das heißt aber nicht, daß andere Wirtschaftsformen, Redistribution und auch auf Reziprozität basierter Austausch nicht existiert hätten: Es gibt klare Beweise des Gegenteils, obwohl die schriftliche Dokumentation von ihrer Struktur her grundsätzlich marktwirtschaftliche Transaktionen bevorzugt. Man könnte hier also sowohl Argumente finden, die eine (sogenannte) modernistische Sichtweise der babylonischen Wirtschaft im ersten Jahrtausend stützen, als auch solche, die mit den sogenannten Primitivisten das Gegenteil annehmen. Es ist – wie Marc Van De Mieroop jüngst geschrieben hat –, anzuerkennen, 65 66 67 68

Van Driel 2002, 157. Vgl. zu alledem unter methodologischen Gesichtspunkten Saller 2002. Jursa 1995, 6b. Müller 2001, 406f. Das Problem der Dokumentation aus den letzten Jahren von Darius und den ersten Jahren von Xerxes, das eng mit der vermuteten Wirtschaftskrise in dieser Zeit verbunden ist, wird jetzt von C. Waerzeggers neu aufgerollt. Sie weist darauf hin, daß im zweiten Jahr von Xerxes, der vielbesprochenen Zäsur innerhalb der schriftlichen Überlieferung Babyloniens, vor allem mittel- und nordbabylonische Archive mit Tempelbezug abbrechen – typischerweise also Rentierarchive –, während andere Archive mit Bezügen zur königlichen Verwaltung (überwiegend Unternehmerarchive) weiterlaufen (Waerzeggers in Vorbereitung). Die unmittelbare Ursache für das Abbrechen der Überlieferung ist sicherlich politisch, nicht ökonomisch.

128

Michael Jursa

daß grundsätzlich verschiedene ökonomische Strukturen nebeneinander bestehen können.69 Die relative Bedeutung dieser Strukturen und der Akteure, die die jeweiligen ökonomischen Nischen besetzen, unterliegt diachronen Schwankungen. Es ist entscheidend, Quantifikationen zu versuchen, wenn man eine diesbezügliche Aussage treffen will.70 Letztendlich ist der von der Alten Geschichte übernommene PrimitivistenModernisten-Streit innerhalb der Assyriologie zwar noch relativ jung, verspricht aber dennoch wenig Erkenntnisgewinn. Man wird besser beraten sein, in die verwandte, aber distinkte71 Debatte zwischen Formalisten und Substantivisten einzutreten, wie es etwa auch P. Cartledge für die Alte Geschichte vorgeschlagen hat,72 und über die Form der sozialen Einbettung babylonischer Wirtschaftsformen, seien es nun Marktaustausch oder Redistribution oder reziproker Austausch, zu handeln. Es ist wenig hilfreich, gleichsam positivistisch den Befund der Texte zu beschreiben und das Ergebnis mittels apriorischer (und dazu nicht hinterfragter modern-westlicher) Rationalitätsvorstellungen zu deuten.73 Rationalität ist im Kontext der ökonomischen Soziologie eine Variable, keine Grundannahme.74 Die neubabylonische Periode bietet aufgrund des Quellenreichtums die Möglichkeit, mit einer Methodologie, die viele Berührungspunkte mit der italienischen microstoria hat, zumindest ansatzweise anhand von Urkunden und Briefen aus der ökonomischen Praxis induktiv auf die Motivationen der ökonomischen Agenten zu schließen, Modelle zu formulieren und Typen zu abstrahieren.75 Die oben vorgetragene Differenzierung in Rentiers und Entrepreneure ist nur ein erster, noch zu verfeinernder Ansatz. 69 Van De Mieroop 1999, 122. Auf den Seiten 108-123 bietet er Erwägungen aus assyriologischer Sicht zu theoretischen Grundpositionen bei der Erforschung der ‘Antiken Ökonomie’ einschließlich der Debatte zwischen den ‘Primitivisten’ und den ‘Modernisten’. 70 Das involviert natürlich Extrapolation aus prinzipiell unvollständigem Material und ist dementsprechend problematisch. 71 Gegen Cohen 2002, 5+20. 72 Cartledge 2002 [1998], 15: „For the formalists, the ancient economy was a functionally segregated and independently instituted sphere of activity with its own profit-maximizing, wantsatisfying logic and rationality, less ‘developed’ ... than any modern economy but ... recognizably similar in kind. Substantivists ... hold that the ancient economy was ... socially embedded and politically overdetermined and so – by the standards of neoclassical economics – conspicuously conventional, irrational and status-ridden.“ 73 Vargyas 2001, 285: „[I]f the market exists and everyone is aware of the profit that can be realised there, everyone’s economic motivation will be altered ... Anyone who gets a chance will act as dictated by the market conditions, that is, he will produce for the market. The institution of „potla$“ is thus irrelevant in the case of Mesopotamia ..., and that is what the adherents of the Polányi school ignore.“ Eine Reduktion der Arbeit der Polányi-Schule auf das Bestreben, Potlatch (-ähnliche Transaktionen) in antiken Gesellschaften wiederfinden zu wollen, wird ihr nicht gerecht. 74 Smelser und Swedberg 1994, 4 Tfl. 1. Aus anthropologischer Sicht vgl. etwa Sahlins 1995, 148ff. und passim. S. auch oben Anm. 45. 75 Insbesondere die größeren Entrepreneurarchive – Egibi, N#r-Sîn, Arad-Šamaš und sein Vater aus Larsa, Sîn-il% – bedürfen dringend eines derartigen synthetischen Zugangs. Beim EgibiArchiv haben neuere Arbeiten erste Schritte zu einer Gesamtschau unternommen: Wunsch 1999 und Abraham 2002.

Wirtschaftsformen Babyloniens

129

2. Der Fernhandel Wir haben schon darauf hingewiesen, daß dem Fernhandel gesamtwirtschaftlich große Bedeutung als Silberlieferant zugekommen sein muß.76 Um so bedauerlicher ist es, daß die babylonischen Quellen spärlich sind, vergleicht man z.B. die Fülle der Informationen, über die man aus der altassyrischen Zeit verfügt. Händlerarchive aus unserer Periode gibt es keine. Das aussagekräftigste Dossier ist jenes zu vom südbabylonischen Eanna-Tempel kommissionierten Händlern, die vor allem mit dem Import von Gütern aus der Levante und aus Syrien befaßt sind.77 Aber selbst im Fall der Eanna-Texte handelt es sich häufig nur um den Erwerb von Importgütern in Babylon, das offensichtlich ein wesentlicher Umschlagplatz war. Dementsprechend problematisch ist es – im Kontext des Generalthemas des Symposions –, zu versuchen, den Quellen direkte Information zur möglichen Rolle des Fernhandels als Kulturvermittler zu entnehmen.78 Die Güter, die nachweislich im Wege des Fernhandels nach Babylonien gebracht wurden, sind Metalle wie Kupfer aus Zypern und Eisen aus Kilikien, Alaun aus Ägypten, Farbstoffe, Beizen und schon gefärbte Gewänder aus der Levante, Wein und aromatische Substanzen aus Syrien, Bauholz aus dem Libanon, und verschiedene andere Aromata aus Arabien und aus dem Osten.79 Diese Liste ist nicht vollständig, sie nennt nur die bestbezeugten Handelsgüter. Aus dem archäologischen Befund ergeben sich Hinweise auf Siegel, Skarabäen, Glas u.ä.m.80 Die Texte berichten nichts Explizites über die exportierten Güter.81 Die Händler, die vom Eanna beauftragt wurden, Waren im Westen einzuhandeln, erhalten dafür Silber, keine babylonischen Handelsgüter.82 Falls sie auch Exportgeschäfte betrieben haben, hat ihnen der Tempel die Wahl der Ware freigestellt. Manche der neubabylonischen professionellen Händler, tamk!ru, waren auf bestimmte Wartentypen spezialisiert.83 Explizit genannt werden Dattel- und Schaf-tamk!rus; ausdrücklich nur auf ein Fernhandelsgut festgelegte Kaufleute kommen nicht vor. Eine wichtige Frage ist die nach dem Status dieser Kaufleute: Waren sie an Institutionen oder Kaufmannskorporationen gebunden, oder waren sie frei von jeglicher Affiliation? Häufig hört man vor allem in der vorachämenidischen Zeit von königlichen Händlern, tamk!ru ša šarri; einmal er76 S. oben bei Anm. 63. 77 Jonnès 1999, 186ff. Einige neue einschlägige Texte aus der Yale Babylonian Collection werden wir im Rahmen des Anm. 1 genannten Projekts vorlegen. 78 Wesentliche Arbeiten zum Fernhandel im ersten Jahrtausend sind Oppenheim 1967 und Joannès 1999. Allgemein zu den Beziehungen Mesopotamiens zum Westen s. z.B. Joannès 1997 und Dalley 1998, 29ff. 79 Die Fernhandelsgüter werden ausführlich von Oppenheim 1967 diskutiert. 80 Wooley 1962, 60 („bottle of Phoenician variegated glass“), 58 und passim („scarab, scaraboid“); Salje 1995, 43; vgl. auch Collon 1987, 93. Es gibt keine zusammenfassende Studie zu westlichen Materialien aus mesopotamischen Kontexten des ersten Jahrtausends. Ich danke H. Baker für einschlägige Hinweise. 81 Der archäologische Befund ist nicht aufgearbeitet. Vgl. etwa Stern 1984, 196f. (babylonische Siegel aus Palästina). 82 Joannès 1999, 186ff. 83 Hierzu Dandamaev 1995, Joannès 1999, 177ff.

130

Michael Jursa

scheint ein Kaufmann eines Gouverneurs (šaknu). Kaufleute eines Tempels oder Gottes werden aber u.W. nirgendwo explizit erwähnt. Eine prosopographische Analyse zeigt, daß speziell die Tempelarchive Königskaufleute oft einfach nur tamk!ru nennen, oder gar keine Bezeichnung, sondern nur den Namen angeben. Es ist also denkbar, wenn auch nicht bewiesen, daß mindestens unter den Chaldäerherrschern tamk!rus grundsätzlich spezialisierte staatliche Kaufleute waren, genau wie das im neuassyrischen Reich der Fall war.84 Gelegentliche Erwähnung von Oberkaufleuten (rab tamk!ris) beweist, daß es eine hierarchische Gliederung unter ihnen gab, ohne daß man freilich Genaueres sagen könnte. Es ist jedenfalls sicher, daß wie in früheren Perioden speziell für den Import von ‚Massengütern‘ wie Holz oder Metall angesichts der beträchtlichen Distanzen und der Transportkosten entweder Kapitalkonzentrationen durch Kaufmannskorporationen – in welcher Form auch immer - notwendig waren,85 oder aber staatlicher bzw. mindestens institutioneller Rückhalt. Es ist somit auch nicht verwunderlich, daß mit Ausnahme des unentbehrlichen Eisens die meistgenannten Fernhandelsgüter die verschiedenen pflanzlichen Aromata sind: einfach zu transportierende Prestigegüter, die hohe Gewinnspannen erwarten lassen.86 Man liest in der Literatur, die Bedeutung der professionellen Händler sei in der neubabylonischen Epoche vergleichsweise gering gewesen, weil ihnen private Familienfirmen wie z.B. das Handelshaus Egibi Konkurrenz gemacht hätten.87 In der Tat enthalten zahlreiche Privatarchive auch Gesellschaftsverträge, sogenannte harr!nu-Urkunden, wörtlich also „Geschäftsreise“-Urkunden. Der Terminologie nach könnte man annehmen, daß diese Geschäftsgesellschaften primär für den Fernhandel gedacht waren. Tatsächlich aber können, wie schon oben gesagt, harr!nuUnternehmen für so gut wie jeden Geschäftszweck gebildet werden, wobei der Fernhandel in den erhaltenen Verträgen dieser Art kaum eine Rolle spielt.88 Unternehmer wie Iddin-Marduk aus der Familie N#r-Sîn89 oder Arad-Šamaš und sein Vater Itti-Šamaš bal!ð aus Larsa90 waren (unter anderem) Großhändler von Naturalien, sie haben sich aber auf den Binnenhandel beschränkt. Die Egibis schließlich, die immer wieder genannt werden, trieben gleichfalls vor allem Binnenhandel; der größte Teil ihres Vermögens dürfte aber in Land investiert worden sein. Die Reisen von Angehörigen der Familie in den Iran, die im Kontext des Fernhandels gesehen wurden, erscheinen aufgrund neuer Evidenz, die C. Wunsch und F. Joannès vorlegen werden, als politisch-motivierte Goodwilltouren zu den achämenidischen Machthabern; der direkte kommerzielle Nutzen, den die Egibis aus diesen Reisen gezogen haben, war demgegenüber ein Nebeneffekt. Die Egibis 84 Radner 1999, 101. 85 CT 55, 173 und 118 z.B. sprechen explizit von Partnerschaftsunternehmen (harr!nu) eines königlichen Kaufmanns. Der letztgenannte Text ist dem von Dandamaev 1995, 524f. zusammengestellten Dossier, das weiterer prosopographischer Erörterung bedarf, hinzuzufügen. 86 Vgl. die klaren Bemerkungen hinsichtlich der relativen Bedeutung von Massen- und Prestigegüterfernhandel im 16. Jahrhundert (n. Chr.) bei Braudel 1995 [1966], I 441-3. 87 Dandamaev 1995, 528. 88 S. oben Anm. 36. 89 Wunsch 1993, Jursa 1995/96. 90 Beaulieu 2000.

Wirtschaftsformen Babyloniens

131

waren also nicht primär Fernhändler (und im übrigen auch keine Bankiers, wie man gelegentlich liest).91 Die Individuen schließlich, die in Tempeltexten als Lieferanten von Fernhandelsgütern genannt werden, sind in den wenigsten Fällen genauer identifizierbar. Sie stammen normalerweise nicht aus dem Kreis der lokalen Oberschicht. Da die Tempelarchive bei Kaufleuten nachweislich häufig keine Berufsbezeichnung nennen, spricht nichts gegen die Annahme, daß es sich um professionelle tamk!rus handelt. In Summe muß man also konstatieren, daß die städtische Oberschicht, die uns überwiegend die Privatarchive hinterlassen hat, nur in sehr geringem Maß in den Fernhandel involviert war. Ein weiterer Aspekt muß hier berücksichtigt werden: Unter den Namen und Patronymika der Kaufleute, insbesondere jener, die offensichtlich mit dem Westhandel zu tun haben, erscheinen überdurchschnittlich viele nicht-babylonische, vor allem westsemitische Namen. Wir nennen nur zwei Beispiele: der in Nebukadnezars sogenanntem Hof- und Staatskalender genannte königliche Oberkaufmann trägt den westsemitischen, möglicherweise phönizischen Namen Hanon,92 und eine Heiratsurkunde aus Sippar bezeugt eine ganze Reihe von Königskaufleuten mit hebräischen Namen, die als geschlossene Gruppe einen Vertrag bezeugen, in denen ein Landsmann Protagonist ist.93 Offenbar war der Fernhandel zu einem beträchtlichen Teil in der Hand von Nicht-Babyloniern oder zumindest von Nachkommen von Nicht-Babyloniern.94 Das stimmt gut mit der Beobachtung von Joannès überein, der auf das spärliche geographische Vokabular und die mit wenigen Ausnahmen recht undifferenzierte Sicht von Transpotamien in babylonischen ökonomischen Texten hingewiesen hat.95 Zusammenfassend: Die schriftliche Evidenz des siebenten bis dritten Jahrhunderts ist ausreichend, um regelmäßigen Handelskontakt Babyloniens mit dem Westen, d.h. dem Mittelmeerraum, nachzuweisen, sie erlaubt aber nicht, den babylonischen Handel im Detail zu rekonstruieren. Ebensowenig läßt sich abschätzen, welche Rolle im neubabylonischen Reich Tribut und Beute in Relation zum Handel gespielt haben. Eine Aufarbeitung des Befundes von archäologischer Seite wäre ein dringendes Desiderat.96 Wie sehr man die Handelskontakte als Medium des Kulturaustausches sehen kann, läßt sich mit den vorhandenen Quellen nicht verläßlich beurteilen. Die direkte Involvierung von Babyloniern in den Fernhandel, besonders als private Unternehmer, scheint jedenfalls eher gering gewesen zu 91 92 93

94 95 96

Zu den Egibis s. allgemein Wunsch 1999, Abraham 2002; hinsichtlich der Iranreisen vgl. vorläufig Joannès 1999, 185 und Wunsch 2000b, 104+24. Dandamaev 1995, 527+13; Zadok 2003, 48716. Jursa 2001 A (zu AOAT 222, No. 26). Die Datierung des Textes in das fünfte Jahr von Kyros und die Zuweisung nach Sippar kann nunmehr aufgrund von BM 75434 (Sippar, zehntes Jahr von Nabonid) als endgültig gesichert gelten. In diesem Text wird ein Bruder des königlichen Kaufmanns Ahi-Jaw, Sohn des Arih (BM 68921 Rs. 5), namens Basia genannt. Auch er ist ein königlicher Kaufmann. Oppenheim 1967, 253. Joannès 1997, 148. Allerdings würde dies wahrscheinlich wenig bei der Beantwortung der entscheidenden Frage helfen, in welchen Händen der Handel vor allem lag. Vgl. jedenfalls den von Holladay 2001 gebotenen ambitionierten Entwurf für das zweite Jahrtausend v.Chr.

132

Michael Jursa

sein. Hinsichtlich des Kulturaustauschs würden wir davon ausgehen, daß der wesentlich besser dokumentierte Austausch von Bevölkerungsgruppen, also aus mesopotamischer Sicht die Ansiedlung von Nichtbabyloniern in Babylonien,97 und die Mobilität von ‚Kulturträgern‘, etwa Gelehrten,98 eine größere Rolle als Fernhandelskontakte gespielt haben wird. Abstract The paper presents a survey of the main economic structures in Babylonia in the first millennium BC. Archaeological evidence points to an unprecedented continuous agricultural, urban and generally demographic expansion from about 700 BC onwards. The conditions leading to and sustaining this expansion have to be explored by sifting the textual sources (which are one of the largest corpora of written evidence from the ancient world). There is evident structural continuity compared to earlier phases of Mesopotamian history regarding the economic agents: institutional households (palaces and temples) still play an important role, while the documentation for the private sector is dominated by urban land-owing elites. However, the traditional oikos model is no longer applicable to the institutional households due to a shift from an ideally autarchic regime based on redistribution to market-oriented exchange, leading to economic specialisation even in the core area of the institutional economy, agriculture. In the private sector, an attempt at describing the prevalent economic mentalities is made by differentiating two types of economic behaviour: an entrepreneur type engaged in various commercial activities and a more traditional rentier type primarily exploiting inherited patrimonies, mostly agricultural land and temple prebends. A higher demand for taxes paid in silver in the Achaemenid period adds to the effects of economic specialisation by increasing the importance of market exchange and the speed of the monetarisation of economic life. The implications for the general issue of the nature of the ‘Ancient Economy’ are briefly discussed. An appendix treats long distance trade as a possible means of cultural exchange. This issue cannot be resolved definitely due to a lack of explicit pertinent sources.

97 S. zuletzt Zadok 2003 und die Arbeit von M. Dandamaev in diesem Band. 98 Frahm (in Druck).

Wirtschaftsformen Babyloniens

133

Bibliographie Abraham, K. 2002 „Rekuš u-ba‘alut be-mišpa¥at Egibi mi-Babel“, ErIsr 27, 1-9. Adams, R. McC. 1981 Heartland of Cities, Surveys of Ancient Settlement and Land Use on the Central Floodplain on the Euphrates. Chicago und London. Beaulieu, P.-A. 2000 „A Finger in Every Pie: the Institutional Connections of a Family of Entrepreneurs in Neo-Babylonian Larsa“, in Bongenaar 2000, 4372. Boiy, T. 2000 Laatachaemenidisch en hellenistisch Babylon. Portret van een Mesopotamische stad in een cultureel spanningsveld. Dissertation Katholieke Universiteit Leuven. Bongenaar, A.C.V.M. 1997 The Neo-Babylonian Ebabbar Temple at Sippar: its Administration and its Prosopography. Istanbul. Bongenaar, A.C.V.M. 1999 „Money in the Neo-Babylonian Institutions“, in Dercksen 1999, 159-174. Bongenaar, A.C.V.M. 2000 Interdependency of Institutions and Private Entrepreneurs (MOS Studies 2). Proceedings of the Second MOS Symposion (Leiden 1998). Istanbul. Braudel F. 1995 [1966] The Mediterranean and the Mediterranean World in the Age of Philip II. Berkeley und Los Angeles [englische Übersetzung der zweiten, überarbeiteten französischen Auflage Paris 1966] Cartledge, P. 2002 [1998] „The Economy (Economies) of Ancient Greece“, in W. Scheidel und S. von Reden (Hrsg.), The Ancient Economy (Edinburgh), 11-32. [erstveröffentlicht in Dialogos 5 (1998), 4-24] Cohen, E.E. 2002 „Introduction“, in P. Cartledge, E.E. Cohen und L. Foxhall (Hrsg.), Money, Labour and Land. Approaches to the economies of ancient Greece (London und New York), 1-7. Collon, D. 1987 First Impressions. Cylinder Seals in the Ancient Near East. London. Dalley, St. 1998 „Occasions and Opportunities 1. To the Persian Conquest”, in St. Dalley (Hrsg.), The Legacy of Mesopotamia (Oxford), 9-33. Dandamaev, M. A. 1984 Slavery in Babylonia from Nabopolassar to Alexander the Great (626-331 B C). DeKalb. Dandamaev, M. A. 1995 „The Neo-Babylonian tamk!r"“, in Z. Zevit et al. (Hrsg.), Solving Riddles and Untying Knots. Biblical, Epigraphic, and Semitic Studies in Honor of Jonas C. Greenfield (Winona Lake), 523-530. Da Riva, R. 2002 Der Ebabbar-Tempel von Sippar in frühneubabylonischer Zeit (640-580 v. Chr.). Münster. Dercksen, J.G. 1999 Trade and Finance in Ancient Mesopotamia (MOS Studies 1). Proceedings of the First MOS Symposion (Leiden 1997). Istanbul. Dercksen, J.G. 2000 „Institutional and Private in the Old Assyrian Period“, in Bongenaar 2000, 135-152. Van Driel, G. 1998 „Land in Ancient Mesopotamia: „That what remains undocumented does not exist“ “, in B. Haring und R. de Maaijer (Hrsg.), Landless and Hungry? Access to Land in Early and Traditional Societies. Proceedings of a Seminar held in Leiden, 20 and 21 June, 1996 (Leiden), 19-49.

134

Michael Jursa

Van Driel, G. 1999a „Capital Formation and Investment in an Institutional Context in Ancient Mesopotamia“, in Dercksen 1999, 25-42. Van Driel, G. 1999b „Agricultural Entrepreneurs in Mesopotamia“, in H. Klengel und J. Renger (Hrsg.), Landwirtschaft im Alten Orient (Berlin), 213-223. Van Driel, G. 2000 „Institutional and Non-Institutional Economy in Ancient Mesopotamia“, in Bongenaar 2000, 5-23. Van Driel, G. 2002 Elusive Silver. In Search of a Role for a Market in an Agrarian Environment. Aspects of Mesopotamia’s Society. Istanbul. Frahm, E. (in Druck) „Headhunter, Bücherdiebe und wandernde Gelehrte: Anmerkungen zum altorientalischen Wissenstransfer im ersten Jahrtausend v. Chr.“, in H. Neumann und R. Dittmann (Hrsg.), Colloquien der Deutschen Orientgesellschaft Band 4 (Münster). Holladay, John S., Jr 2001 „Toward a New Paradigmatic Understanding of LongDistance Trade in the Ancient Near East: From the Middle Bronze II to Early Iron II – A Sketch“, in P. M. M. Daviau, J. W. Wevers and M. Weigl, The World of the Aramaeans II. Studies in History and Archaeology in Honour of Paul-Eugène Dion (Sheffield), 136-198. Hudson, M. und M. Van De Mieroop 2002 Debt and Economic Renewal in the Ancient Near East. Bethesda. Joannès, F. 1987 „Un cas de remariage d’époque néo-babylonienne“, in J.-M. Durand (Hrsg.), La femme dans le Proche-Orient antique. Compte rendu de la XXXIIIe Rencontre Assyriologique Internationale, Paris 1986 (Paris), 91-96. Joannès, F. 1989 Archives de Borsippa. La famille Ea-ilûta-bâni. Genf. Joannès, F. 1997 „Le monde occidental vu de Mésopotamie, de l’époque néobabylonienne à l’époque hellénistique“, Transeuphratène 13, 141-53. Joannès, F. 1999 „Structures et opérations commerciales en Babylonie à l’époque néo-babylonienne“, in Dercksen 1999, 175-194. Joannès, F. 2000 „Relations entre intérêts privés et biens des sanctuaires à l’époque néo-babylonienne“, in Bongenaar 2000, 25-41. Jursa, M. 1995 Die Landwirtschaft in Sippar in neubabylonischer Zeit. Wien. Jursa, M. 1995/96 Rezension von Wunsch 1993, AfO 42/43, 255-262. Jursa, M. 1999 Das Archiv des Bel-remanni. Istanbul. Jursa, M. 2001 „Kollationen“, Nouvelles Assyriologiques Brèves et Utilitaires 2001, 98-100, No. 102. Jursa, M. 2002a Prywatyzacja i zysk? Przedsi#biorcy a gospodarka instytucjonalna w Mezopotamii od 3 do 1 tysi$clecia przed Chr. [poln.; Privatisation and Profit? Entrepreneurs and Institutional Households in Mesopotamia from the Third to the First Millennium BC]. Pozna&. Jursa, M. 2002b „Debts and Indebtedness in the Neo-Babylonian Period: Evidence from the Institutional Archives“, in Hudson und Van De Mieroop 2002, 197-220. Jursa, M. (in Vorbereitung) „Banken im Hellenistischen Babylonien“. Kessler, K. 1991 Uruk. Urkunden aus Privathäusern. Die Wohnhäuser westlich des Eanna-Tempelbereichs. Teil 1. Die Archive der Söhne des Bel-ušallim, des Nabû-ušallim und des Bel-supê-mu‹ur. Mainz.

Wirtschaftsformen Babyloniens

135

Kuhrt, A. 1998 „The Old Assyrian Merchants“, in H. Parkins und Ch. Smith (Hrsg.), Trade, Traders and the Ancient City (London und New York), 16-30. Lambert, W.G. 1957 „Ancestors, Authors, and Canonicity“, JCS 11, 1-14 und 112. Lanz, H. 1976 Die neubabylonischen ¦arrânu-Geschäftsunternehmen. Berlin. Larsen, M.T. 1982 „Your Money or Your Life! A Portrait of an Assyrian Businessman“, in Societies and Languages of the Ancient Near East: Studies in Honour of I.M. Diakonoff (Warminster), 214-245. Le Roy Ladurie, E. 1983 [1969] Die Bauern des Languedoc. Stuttgart (franz. Original Les paysans de Languedoc, Paris 1969). Liverani, M. 1998 Uruk la prima città. Rom und Bari. MacGinnis, J. 1995 Letter Orders from Sippar and the Administration of the Ebabbara in the Late-Babylonian Period. Pozna&. Meikle, S. 2002 [1995] „Modernism, Economics and the Ancient Economy“, in W. Scheidel und S. von Reden (Hrsg.), The Ancient Economy (Edinburgh), 233-250. [erstveröffentlicht in PCPS 41 (1995), 174-191] Van De Mieroop, M. 1997 „Why Did they Write on Clay”, Klio 79, 1-18. Van De Mieroop, M. 1999 Approaching the Ancient World. Cuneiform Texts and the Writing of History. London und New York. Morris, I. 2002 „Hard Surfaces“, in P. Cartledge, E.E. Cohen und L. Foxhall (Hrsg.), Money, Labour and Land. Approaches to the economies of ancient Greece (London und New York), 8-43. Müller, G. 2001 Inflation in Babylon. Untersuchungen zur Wirtschafts- und Sozialgeschichte Babyloniens vom ausgehenden 7. bis zum Beginn des 5. Jahrhunderts v. Chr. Habilitationsschrift, Universität Münster. Oelsner, J. 2003 „Cuneiform Archives in Hellenistic Babylonia: Aspects of Content and Form“, in M. Brosius (Hrsg.), Ancient Archives and Archival Traditions. Concepts of Record-Keeping in the Ancient World (Oxford), 284-301. Oppenheim, A.L. 1967 „Essay on Overland Trade in the First Millennium B.C.“, JCS 21, 236-254. Pedersén, O. 1999 Archives and Libraries in the Ancient Near East 1500-300 B.C. Bethesda. Radner, K. 1999 „Traders in the Neo-Assyrian Empire“, in Dercksen 1999, 101126. von Reden, S. 2003 Exchange in Ancient Greece. London (Erstauflage 1995). Renger, J. 2000 „Das Palastgeschäft in der altbabylonischen Zeit“, in Bongenaar 2000, 153-183. Sahlins, M. 1995 How „Natives“ Think About Captain Cook, for Example. Chicago und London. Salje, B. 1995 „Neu-/Spätbabylonische Zeit“, in R.M. Boehmer, F. Pedde, B. Salje, Uruk. Die Gräber (Mainz), 34-139. Saller, R. 2002 „Framing the Debate over Growth in the Ancient Economy“, in W. Scheidel und S. von Reden (Hrsg.), The Ancient Economy (Edinburgh), 251-269.

136

Michael Jursa

Smelser, N.J. und R. Swedberg 1994 „The Sociological Perspective on the Economy“, in N.J. Smelser und R. Swedberg (Hrsg.), The Handbook of Economic Sociology (Princeton und New York), 3-26. Van der Spek, R.J. 1998 „Cuneiform Documents on Parthian History: the Ra‹imesu Archive. Materials for the Study of the Standard of Living“, in J. Wiesehöfer (Hrsg.), Das Partherreich und seine Zeugnisse (Stuttgart), 205258. Van der Spek, R.J. und C.A. Mandemakers (in Druck) „Sense and Nonsense in the Statistical Approach of Babylonian Prices“, (BibO in Druck). Stern, E. 1984 Material Culture of the Land of the Bible in the Persian Period 538-332 B.C. Warminster. Ungnad, A. 1935 „Babylonische Familiennamen“, AnalOr 12, 319-326. Vargyas, P. 2001 A History of Babylonian Prices in the First Millennium BC. 1. Prices of the Basic Commodities. Heidelberg. Waerzeggers, C. 2002 „Endogamy in Mesopotamia in the Neo-Babylonian Period“, in C. Wunsch (Hrsg.), Mining the Archives. Festschrift for Christopher Walker on the Occasion of His 60th Birthday (Dresden), 319-342. Waerzeggers, C. in Vorbereitung (AfO 50) „Xerxes and the End of Archives” Weber, M. 1980 Wirtschaft und Gesellschaft. 5., revidierte Auflage. Tübingen. Wooley, L. 1992 Ur Excavations. Volume IX. The Neo-Babylonian and Persian Periods. London. Wunsch, C. 1993 Die Urkunden des babylonischen Geschäftsmannes IddinMarduk. Zum Handel mit Naturalien im 6. Jahrhundert v. Chr. Groningen. Wunsch, C. 1999 „Neubabylonische Urkunden: Die Geschäftsurkunden der Familie Egibi“, in J. Renger (Hrsg.), Babylon: Focus mesopotamischer Geschichte, Wiege früher Gelehrsamkeit, Mythos in der Moderne (Saarbrücken), 343-364. Wunsch, C. 2000a Das Egibi-Archiv. I. Die Felder und Gärten. Groningen. Wunsch, C. 2000b „Neubabylonische Geschäftsleute und ihre Beziehungen zu Palast- und Tempelverwaltungen: das Beispiel der Familie Egibi“, in Bongenaar 2000, 95-118. Wunsch, C. 2002 „Debt, Interest, Pledge and Forfeiture in the Neo-Babylonian and Early Achaemenid Period: The Evidence from Private Archives“, in Hudson und van de Mieroop 2002, 221-255. Zadok, R. 2003 „The Representation of Foreigners in Neo- and Late-Babylonian Documents (Eighth through Second Centuries B.C.E.)“, in O. Lipschits und J. Blenkinsopp (Hrsg.), Judah and the Judeans in the Neo-Babylonian Period (Winona Lake), 471-589.

TWIN TOWNS AND ETHNIC MINORITIES IN FIRST-MILLENNIUM BABYLONIA Muhammad Dandamayev In the first millennium B.C.1 Babylonia was to a considerable degree a country of mixed population, and multilingual. Beginning with the early ninth century, southern Babylonia was invaded by the Chaldaeans, who probably spoke a dialect of Aramaic [Lipi ski 2000, 416–422, with previous literature]. Advancing to the north of the country, they gradually adopted ancient Babylonian culture and the way of life of the native population. Thus they started to play an important role in the economic and political life of the country and finally were assimilated with its native people. In the eighth and seventh centuries Aramaean tribes began to settle along the Lower Tigris and in the region of Sippar, as well as on the Middle Euphrates. Soon all Babylonia was inundated with Aramaean tribes who lived side by side with the local population. Thus the process of the Aramaizing of Babylonia started which, however, never became complete in Antiquity [Lipi ski 2000, 513–514], while Assyria proper gradually became thoroughly Aramaized. There exists some evidence for immigration from Assyria to Babylonia after the fall of the Neo-Assyrian empire. However, the ethnic name Aššur!ja is attested only in a few Babylonian economic and administrative texts drafted during the reign of Nabonidus. These Assyrians occupied a low social standing, and there were among them slaves of the Ebabbar temple in Sippar, including some carpenters [Zadok 1984a, 2]. In the eighth and seventh centuries, Neo-Assyrian kings conducted a policy of forced resettlement of entire peoples from their native lands to Mesopotamia and other regions of the realm. The same policy was continued to a certain degree by Neo-Babylonian rulers (seventh and sixth centuries). Besides, some individuals were deported to Babylonia as hostages, and others arrived there from neighbouring countries as political refugees (for instance, a fugitive from Media is mentioned among persons at the court of Nebuchadnezzar II). Later, in the sixth – fourth centuries, the Persian administration created in Babylonia military colonies consisting of representatives of various peoples and not infrequently appointed to the administrative apparatus Persians, Medians, Egyptians, etc. Finally, since Babylonia was a fertile country, many ethnic groups of neighbouring lands tried to settle there. According to Stolper, of circa 2,200 personal names in the Murašû documents drafted in the fifth century, about two-thirds are Babylonian and about onequarter are Aramaic, while the remaining names are Iranian, Jewish, Egyptian, etc. [Stolper 1992, 927]. Along with the autochthonous population of Babylonian cities, as well as Chaldaeans, Assyrians and Aramaeans, about thirty ethnic groups, beginning with Egyptians and Phoenicians and ending with Areians (individuals from ancient Haraiva on the territory of present-day Afghanistan) and 1

All dates in this paper are B.C. Abbreviations are those of the Assyrian Dictionary of the Oriental Institute of University of Chicago and of the Reallexikon der Assyriologie und Vorderasiatischen Archäologie.

138

Muhammad Dandamyev

Bactrians, are attested in Mesopotamia during the period under consideration. Prisoners of war, including numerous artisans, presented a considerable group of aliens in Mesopotamia. However, a large proportion of them was not reduced to slavery but settled on state land in order to till it and pay taxes. Finally, we do not know the reasons of stay of a number of strangers in Mesopotamia. Let us consider documentary evidence on the main foreign ethnic groups of Babylonia, and the contacts among themselves and with the native population. From ca. 755 on Arabians or Arabs (Arabi, Arbaja, etc.) started to penetrate Babylonian cities and mingle there with the native people. The ethnic name designating Arabians in cuneiform sources has been examined by Eph‘al and Zadok [Eph‘al 1984; Zadok 1981]. As Eph‘al has noted, the term “Arab” primarily denoted a desert dweller, a Bedouin. According to Zadok, it is still impossible to determine what language or languages the individuals called “Arabians” spoke, and frequently their personal names cannot be distinguished from the West Semitic (mostly Aramaic) names. In Babylonian economic documents of the sixth and fifth centuries Arabians are referred to as residents of Babylon, Nippur, Sippar and some other cities. The “Town of Arabians”2 is mentioned in a few documents from the neighbourhood of Nippur where it was located. Apparently this settlement was named after some Arabians who lived there. According to one text, in 563 a certain Uhabanna was obliged to deliver a quantity of barley to another man from the Town of Arabians [BE 8, no. 26]. As Zadok observes, Uhabanna is “an explicitly Arabian name” [Zadok 1981, 71]. A field in the same settlement which belonged to some Arabians was rented out to the Murašû business firm [TMH 2/III, no. 147]. It seems that these Arabians were royal soldiers settled on state land in the Nippur region. Several Arabians are attested as workmen of the Ebabbar temple in Sippar. For instance, six pieces of linen clothes from the paraphernalia of the goddess B"let of Sippar were put at the disposal of an Arabian for repair [Nbn. 1090]. In 530 another Arabian delivered several ducks to the storehouse of the Ebabbar [CT 55, no.713]. In 527 an individual paid 58 shekels of silver to the Ebabbar for eight “adult” sheep which were in the care of Duhhabat, son of Igbarat, who was an Arabian [Camb. 211]. Arabians are also mentioned in several documents from the archives of the Eanna temple in Uruk. One of these texts contains an injunction against an Arabian by the name Zabdija, forbidding him to have contacts with a temple slave woman under the threat of punishment [YOS 7, no.92]. There are also known some Arabians who were petty state officials. Descendants of Arabians were integrated into Babylonian society and, as a rule, bore Akkadian names. In some cases the surname Arbaja became a family name of such individuals. It seems that Egyptians were scattered throughout all of Mesopotamia. They are designated by their ethnic name Misi#raja. In some cases, evidence of their

2

In this paper the Akkadian determinatives lu, m tu and b!tu are rendered correspondingly ‘town’ (e.g. “Town of the Cilicians”), “country” (e.g. “Country of the Elamites”) and settlement or village (e.g. “Settlement of the Egyptians”).

Ethnic Minorities in Babylonia

139

ethnic origin is found in the personal names with theophoric components. There are attested the following groups of the Egyptians. Among the foreigners who lived at the court of Nebuchadnezzar II are mentioned Egyptian “guards of the mares and monkeys” [Weidner, Mél. Dussaud, p.926]. Some slaves of Egyptian extraction belonged to the Eanna and Ebabbar temples in Uruk and Sippar respectively [see, e.g., YOS 6, nos.2, 148, etc.]. In 524 a Babylonian soldier sold “his slave woman Nana-ittija and her daughter of three months, an Egyptian from his booty of the bow, for two minas of silver” [Camb. 334]. Apparently, they were captured at the time of Cambyses’ campaign in Egypt in 525. The Babylonian name of this slave woman had obviously been given in captivity. It seems, however, that in the majority of cases the Egyptians belonged to the free population of the country and some of them were royal and temple officials. Thus, still during the reign of Nebuchadnezzar II an Egyptian, Harmas$u by name, was a judge in Babylon [ROMCT II, no.37:26]3. Pamunu, another Egyptian, was a supervisor over the workmen of the treasury in 420 in the Nippur region [BE 10, no.88]. Egyptians often appear as contracting parties. For instance, in 476 the Egyptian Pisusasmakaš, son of Patnašu, granted a loan in dates to another man [CT 4, no.34d]. An Egyptian who lived in the city of Sippar sold a piece of Egyptian linen in exchange for flour and dates to a Babylonian who worked in the Ebabbar [CT 2, no.2]. It can be added here that an important article in foreign trade with Egypt, along with linen, was alum which is frequently mentioned in Babylonian texts [e.g., Nbn. 214; YOS 6, no.168, etc.]. Such toponyms as the “Settlement of the Egyptians”, the “Canal of the Egyptians”, and the “Town of the Egyptians” [see Zadok 1985, 229–230, 392] might attest that considerable communities of Egyptians were located in such places. Elamites constituted one of the most substantial groups of the aliens. Still during the rule of Nebuchadnezzar II there were already many Elamites in Babylon. For instance, a document from the royal archives there mentions a group of 713 Elamites who were issued food rations [Weidner, Mél. Dussaud, p.929]. Some Elamites appear as workmen and petty officials in the Ebabbar and Eanna temples4. They usually bear typical Babylonian but sometimes also Elamite names (e.g., Ummanšibir). Many documents from various archives mention Šušan which was an important town located not far from Borsippa [Joannès 1989, 55]. Apparently, it bore this name after the capital of Elam (Šušan), and its inhabitants were partly or mainly Elamites. Some scholars assume that this locality may have been named for the social group of šuš nu [see, for instance, Joannès 1989, 55]. It seems to me, however, that the distinction should be made between this Šušan and the toponym %lu-ša-šuš!n"5 which was named for the šuš nu social group of dependents who were settled not far from Sippar.

3 4 5

Mis"iraja daj nu (“An Egyptian judge”). See, for instance, CT 56, no.776 (line 13: elamû); CT 57, no.212; AUWE 5, no.159. See, e.g., Cyr. 158. Cf. Zadok, 1985, 20; cf. also #lu-ša-ikkar$ (the “Town of the plow-men”) in YOS 19, no.34:13, etc.

140

Muhammad Dandamyev

It can also be noted here that Babylonian merchants (e.g., businessmen of the Egibi family) were engaged in trade with Elam and Media [see, e.g., Cyr. 60, 277; Dar.575, 577]. Cilicians, “Ionians”, Lydians and other ethnic groups from Asia Minor are referred to among foreigners who were issued rations at the court of Nebuchadnezzar II [Weidner, Mél. Dussaud, 923 – 924]. At least, some of them were carpenters. Nabonidus led off 2,850 prisoners of war from Cilicia and presented them to Babylonian temples as slaves [VAB 4, p.284]. Some Cilicians (Hum!ja) are listed among foreigners settled in the neighbourhood of Sippar who paid temple tithes [AOAT 254, p.26]. The “Town of the Cilicians” is also attested in the same region [AOAT 254, p.42]. One document from the Eanna archive in Uruk mentions fifteen minas of iron brought from Cilicia [YOS 19, no.209]. Another document from the same archive refers to a certain “Cilician garment” (tupemu) [YOS 19, no.273:3–4]. The term “Ionians” (Jamanu) denoted not only Greeks but also native inhabitants of Asia Minor, including Ionia itself [on this term see Rollinger 1997]. For instance, one document of 601 mentions ten minas of purple wool from Ionia6 which was issued at the disposal of two weavers of the Eanma temple in Uruk in order to produce a garment. As to Greeks, our information about their presence in Mesopotamia before the Hellenistic period is very scant. For instance, some of them served in the army of Nebuchadnezzar II as mercenaries, including Antimenidas, brother of the Aeolian poet Alcaeus7. But the influence of Greeks on Babylonian culture during the period under consideration was very insignificant [Röllig 1968–1971, 644–647]. During Achaemenid times, Carians, Lydians, Lycians, Urartians, Meliteneans, Phrygians and inhabitants of some other districts of Asia Minor were settled in many villages around Nippur and gave their names to some settlements there. Before the conquest of Mesopotamia by the Persians in 539 only a few Iranians (Medes and Persians) are mentioned in Babylonian texts. They probably were hostages and political refuges [see, e.g., Weidner, Mél. Dussaud, 924 – 926]. During the Achaemenid period, there are attested many Areians, Choresmians, Medes, Persians, Sakais, and other Iranians as contracting parties, witnesses of various routine transactions, officials of the royal administration, soldiers and military commanders, as well as private persons. In some cases the reasons of their living in Babylonia are unknown to us. They appear among all the social groups of the population, beginning with the nobility and ending with slaves. According to Zadok, the Murašû documents drafted in Nippur and its environs in the fifth century mention about 200 individuals “who either bore Iranian names, or had relatives bearing such names, or belonged to Iranian population groups” [Zadok 1977, 107]. Gradually many Persians became large landowners. They usually lived in big cities. For instance, the Persian (Pars ja) Uhejagam, son of Parnaka, who lived in Babylon, owned a field located near Nippur. In 423 he was issued one mina of silver by the Murašû firm as part of his rent [PBS 2/I, 6 7

YOS 17, no.253:2 (KUR ia-a-ma-nu). E. Diehl, Anthologia Lyrica Graeca I (Lipsiae 1925), 412.

Ethnic Minorities in Babylonia

141

no.5]. Another Persian, Bag!miri, the son of Mitrad!ta, in 429 rented out his grain field near Nippur for a period of sixty years [BE 9, no.48 = TMH 2/III, no.144]. The prince Manuštanu received 4,000 kur (i.e., 720,000 l) of barley from a member of the Murašû firm as rent [PIHANS 54, no.59]. A “Town of the Persians” was located in the Nippur region which was named after some Persians [BE 10, no.101]. The Persian Arbatama’ was the owner of a storehouse in Borsippa [VAS 4, no.191]. Sometimes Persians could be found in the very midst of the masses. Thus, in a record drafted in Dilbat during the reign of Darius I, the Persian Ahšeti, son of Kamakka, acts as a witness of a transaction along with four Babylonian judges and some temple officials [VAS 6, no.171]. A Mede (M d ja) Kakia by name owned a field near Babylon and rented it to the Egibi business house. He and his wife Ahija lived in Babylon in a rented house, whose furniture and household utensils were taken from the same Egibi firm [Dar., nos. 51 and 57]. Many soldiers of Iranian extraction (Areians, Sakas, etc.) served in Nippur, Babylon, Dilbat and other cities. One Saka8 is even listed among witnesses of a promissory note drafted in Sippar in 511. It is well known that Sakas mainly served in the army as equestrian archers. But one document from Uruk indicates that some Sakas served also as sailors [VAS 20, no.49]. Judaeans (Iaudaia) constituted one of the most important foreign ethnic groups in Babylonia. First of all, about ten thousand Judaeans were deported there by Nebuchadnezzar II. Some of them were settled in the environs of Nippur. Thus, eight per cent of the personal names in the Murašû archive are Jewish. Judging by these names, there were nearly one hundred Jewish families in twentyeight villages in the Nippur region in the fifth century [Bickerman 1984, 346–348, with previous literature]. Some of them were engaged in farming, others served as business agents or were in the royal service. There is known also the toponym %lJahûdu, i.e. the “Town of Judah”, named after Jerusalem. A document about the sale of a bull drafted there contains twelve Hebrew names. Except the scribe who was a Babylonian, almost all other persons mentioned in it were Jews. Thus, they were settled compactly in a village which was probably located in the neighbourhood of Sippar [Joannès, Lemaire 1999]. Some Judaeans are also listed among foreign prisoners of war who were issued food rations in Babylon [Weidner, Mél. Dussaud, 925]. A colony of Gezerites (Gazar!ja, people from the city Gezer in Palestine) was set up in the neighbourhood of Sippar [Heltzer 2002]. They are listed among foreign groups paying tithes due to the Ebabbar temple. Their annual payment constituted 200 kur (36,000 l) of barley [AOAT 254, 25–27]. During excavations at Neirab in North Syria (about eight km from Aleppo), an archive of 27 economic documents was discovered. They belonged to a single family and were drafted in the Babylonian dialect of the Akkadian language at the “Town of the Neirabaeans”. These documents cover the period between 560 – 8

CT 55, no.93:9 (LÚ sak-ka-a-a). Usually the Babylonian texts call the Sakas “Cimmerians” (Gimir ja) after the tribes who invaded Western Asia in the seventh century. As known, the ethnic name Saka of the Old Persian and Elamite versions of the Achaemenid inscriptions is rendered as Gimirri in Babylonian versions.

142

Muhammad Dandamyev

521. Eph‘al has convincingly shown that these documents had originated not in Syria but in a Babylonian village Neirab named after the hometown of the settlers from Syria and were later brought to their native land [Eph‘al 1978, 84–87]. Thus, it is obvious that the Syrian Neirab had its twin town in Babylonia. It is not excluded that Aleppo (Halab) had also its namesake in Babylonia. Thus, according to a document, some planks were brought from “the town Hallab/ Halbu” and the “Village of the Egyptians” to Sippar for work on a drainage system [CT 55, no.427]. Referring to the opinion of Jursa and Zadok, Bongenaar notes that this Halbu might have been located in the vicinity of Sippar [Bongenaar 1997, 395 n.335]. But on suggestion of M. Stol he considers that it could also be Aleppo (Halab). As seen from a number of documents, farmers of the Ebabbar temple lived in Hallab and delivered this sanctuary rental payment in barley [for references see Jursa 1995, 224]. Other texts record delivery of bitumen from Hallab [Nbn. 1004] and payment of money for some work done on a dam there [Nbn. 1002]. According to Camb. 48, some fruit trees located there belonged to the Ebabbar. Thus, it seems certain that this Hallab was situated not far from Sippar. However, it was probably a namesake of Syrian Hallab. Six cuneiform documents from the reign of Nabonidus were drawn up in the city Elammu. Four of them are promissory notes, two record business enterprises and one is a slave sale contract [for references see Dandamayev 1999; now add YOS 19, no.25]. All the principals and witnesses in them bear Babylonian names. It is difficult to establish for certain whether this toponym denoted a colony of ethnic Babylonians in the city Elammu which was located to the west of the Euphrates, or if it was a village in Babylonia named after its Syrian counterpart. In any case, a few prosopographical links can be found in the documents from Elammu and in texts from the archives of the Eanna temple [Dandamayev 1999, 544]. Therefore this Elammu could have been a village near Uruk. Numerous Phoenicians are referred to in Babylonian documents. Already under Nebuchadnezzar II a Phoenician, Hanunu by name, is mentioned as the “chief merchant of the king” among some highly-placed state officials [Unger, Babylon, p.285, line 19]. As is well known, when Nebuchadnezzar II conquered the countries to the west of Babylon, he deported from them thousands of inhabitants and settled them in various parts of Mesopotamia. Among such peoples are mentioned “126 residents from Tyre”, “30 sailors from Tyre”, “8 carpenters from Byblos”, etc. [Weidner, Mél. Dussaud, 930 – 932]. These artisans were settled in Babylon. Some toponyms named after Phoenician geographical names are attested in Murašû documents in the vicinity of Nippur. They are Išqall&nu (Ashkelon), the “Village of Tyrians”, etc. which were populated by Phoenicians, Philistines and other West Semites [Eph‘al 1978, 80–83; Zadok 1978]. They were mostly royal soldiers. These twin towns were known till a hundred years ago. Two more such towns have recently become known. One of them is Qadeš named after the Phoenician city of the same name. It was probably located in the Nippur region (cf. below). A slave sale contract drafted in this Qadeš stipulates that the seller should deliver a female slave to the father of the buyer who lived in Nippur [ROMCT II, no.2]. All the principals and witnesses of the transaction, as well as the scribe were

Ethnic Minorities in Babylonia

143

Babylonians. A namesake of Sidon, another Phoenician city, is attested in a document from Nabonidus’ reign. As seen from prosopographical evidence, it was located in the Nippur region9. But in a number of cases it is difficult to establish whether some toponyms were located in Phoenicia itself or in Babylonia. As was previously said, several Murašû documents mention the “Village of Tyrians”10 located near Nippur. It is, however, difficult to determine the location of S$&ru where twelve documents were drawn up between 574 – 564. They come from temple archives of Uruk, Nippur and Sippar. These texts have been studied by Joannès and Czechowitz11. They had been unanimously attributed to Tyre in Phoenicia, whereas Joannès expressed an opinion that it was a settlement located between Nippur and Uruk. Taking into consideration that the accepted date of the siege of Tyre by the Babylonians is 587 – 572 and that the earliest of the documents under discussion was drawn up already in 574, he has come to the conclusion that it was a village which existed before the conquest of Tyre by the Babylonians, and therefore it did not consist of deported people. But perhaps Czechowicz is right when she assumes that this document allows us to define more precisely the date of Tyre’s fall. The text mentions five officials of the Enlil temple in Nippur as witnesses of the document, and, according to Joannès, this fact demonstrates that it was written in Babylonia, since, as he assumes, it is impossible to explain the presence of these functionaries in Phoenicia. The localization of this S$&ru in Babylonia was questioned by Dalley and denied by Czechowicz [Dalley 1984, 20; Czechowicz 2002, 339–341] who placed it in Phoenicia. Let us consider some of these documents. Two of them have a determinative for a land. One of them records that in 563 four leather coats and garments were given for the disposal of four soldiers who were going to the “country” Tyre [GCCI II, no.135]. According to the second text, two individuals who were going to the “country” Tyre received food rations [GCCI I, no.151]. A third text records rations in dates issued to three foremen who were on their way to Tyre [GCCI I, no.169]. Here the determinative before Tyre has not been preserved. In all other texts Tyre has the determinative for a city. Some of them record the allowances of food portions to shepherds and other groups of workmen [GCCI I, no.94, etc.] and the remaining are promissory notes. Of especial interest is the text according to which Milki-it"ri, ”governor (p!h tu) of the city Qadeš”, was to deliver at a specified time three cows with their calves to a certain individual in Tyre [Pinches, JTVI 49, p.129 – 130]. Joannès localizes both of these cities in Babylonia [Joannès 1987, 148 n.11]. However, the above-mentioned title usually refers to governors of large cities, and not of small settlements, and this might not be in favour of Joannès opinion.

9

YOS 19, no.32:8,14 (URU s"i-da-nu). For prosopographical criteria see Dandamayev 2001, 700. 10 B't-S$&r!ja, for references see Zadok 1985, 104. 11 Joannès, 1982; Joannès 1987; Czechowicz, 2002.

144

Muhammad Dandamyev

One document mentions “blue purple wool from the city Tyre” which belonged to the Eanna temple. The opinion of Joannès and Zadok that a village in Babylonia is meant here [Joannès 1987, 147; Zadok 1985, 280] has been already rejected by Czechowicz, since purple wool was an imported article in Babylonia [Czechowicz 2002, 329]. Finally, in CT 55, no.228 “iron, flour and sweets from the city S$&r!” are referred to. Thus, to sum up: it seems to me that, at least, when S$&ru has the determinative for a land it was the Phoenician Tyre, but in some other cases it could have been a village in Babylonia. In any case, a number of documents from this place mention soldiers who might have been engaged in military operations in Phoenicia. In a text drafted during Nabonidus’ reign a man from the Phoenician city Byblos (LÚ gubul ja) is mentioned among temple slaves of the Ebabbar in Sippar who were issued rations [CT 56, no. 638:8]. Another document from the reign of Darius I records that a governor of Byblos presented to the Ebabbar 12 shekels of silver, 1 mina 50 shekels of purple dye, 1 mina 24 shekels of purple wool, 2 vessels of wine and a trunk of cedar tree as his temple tithe [CT 55, no.435]. All these items are goods typical of Phoenicia but the document itself comes from the Sippar region. “Carpenters of the Lebanon” (Labn!nu) were active in the Ebabbar of Sippar during the reigns of Nabonidus and Cambyses12. They received money, salt, barley and dates for their travel food rations, as well as leather shoes. Usually in the same texts archers are referred to as recipients of food portions. Bongenaar assumes that these bowmen protected the carpenters during their expeditions in order to hew cedar trees in the Lebanon Mountains and bring them to Sippar [Bongenaar 1997, 395]. There are known three carpenters of the Lebanon but their names are Babylonian, and probably they were Babylonians themselves. As it is well known, Lebanon cedar trees were used in Mesopotamia in the erecting of royal and temple buildings [for references see VAB 4, p.304]. In passing, it can be noted that sometimes iron was also imported to Mesopotamia from the Lebanon13. The technique of acquisition of various imported articles from the countries to the west of the Euphrates (Eber-n!ri, i.e., Transpotamia) can be seen from the documents of the Eanna temple. For instance, in 542 thirty shekels of silver and eight kur (1,440 l) of barley were issued from the property of this temple at the disposal of an individual for consignment of merchandise from Transpotamia [YOS 19, no.52]. As seen from the same document, this money and grain constituted only some part of the temple property which was destined for trade with the West. During Neo-Babylonian and especially Achaemenid times, economic and cultural contacts, as well as international trade between Mesopotamia and other countries of the Near East developed on a previously unknown scale. As we have seen above, Babylonian documents provide particularly rich information on foreigners who lived in Mesopotamia. They entered into various transactions with one another and with native people and acted as witnesses of various business deeds. The 12 Camb. 359; CT 56, no.235, etc. See Bongenaar 1997, 392. 13 TCL 12, no.84; YOS 6, no.168. See Oppenheim 1967, 236–238.

Ethnic Minorities in Babylonia

145

question arises what was the attitude of the native population towards the foreigners? As known, the Old Testament required justice, hospitality, and charity to the aliens who lived among Israelites and even granting them the rights and privileges of native-born citizens and allowing them to participate in the Passover if they were circumcised14. In Mesopotamia perhaps there was no need to appeal to justice and hospitality towards the aliens, since from earlier periods of history numerous groups from the neighboring countries started to penetrate Babylonia which in their eyes was a rich and highly civilized country. They all gradually adopted its cultural standards and after all were assimilated with the local population. Summarizing the opinion of Bottéro on the Mesopotamian attitude to aliens, Singer writes that “even in the most pejorative descriptions of strangers, denouncing their hostile actions against Mesopotamian centers, the criticism is directed towards their uncivilized ways, not their inherent qualities or race” [Singer 1994, 19; Bottero 1994]. This can be easily explained by the fact that in the ancient Orient there existed no national enmity, intolerance, no sense of superiority, no racial hatred. Besides, in contrast to monotheistic religions, in polytheistic faiths there were no notions of false faith or heresy. Therefore nobody was interested in imposing his religion on others. Persons, who chanced to go to a foreign land, while keeping to their faith, also paid respects to the local gods and tried to win the favour of these gods who were considered patrons of the regions where they happened to live. Eph‘al has already noted that there exists no evidence for the cult of foreign minorities in Mesopotamia during the Neo-Babylonian and Achaemenid periods [Eph‘al 1978, 88]. But some conclusions can be made from indirect evidence. For instance, one document recording a loan of barley was drafted near Nippur at the “Temple of S'n in the Town of Arabians”15. It is well known that the cult of the moon-god S'n was popular among the Arabians. Sometimes foreigners, as well as native inhabitants of the country, gave their children names with no connection to their ethnic background. Thus, some Egyptians, Jews, Iranians and individuals of various other nations, bore theophoric names components of which were alien to their traditional religions. Thus, a certain Padi-Esi’, whose name contains the theophoric component of the Egyptian god Esi’, has also a second name Bag!d!ta which is a theophoric Iranian name16. Another Egyptian (Mi½"iraja), son of Marharpu, who was a royal official in Babylon, and rented out in 496 a grain field located near the Village of Arabians (Arbaja), bore the Old Persian theophoric name Bagazuštu [Joannès, Lemaire 1996, 48-49]. A Babylonian, B"l-ibni by name, gave his son the Iranian theophoric name Artambara [PIHANS 79, no. 54]. Iddin-Nabû, another Babylonian, gave his son the theophoric Iranian name Hadabag! [PIHANS 79, no.38]. In a number of cases, Iranians also gave their sons theophoric Babylonian names, e.g., B"l-'puš, son of Šatabarz!na [PIHANS 79, no.18]. Some Jews who lived in the Nippur region in the fifth century also gave their sons theophoric Babylonian names [Bickerman 1978, 8–10]. Such individuals appar14 See, e.g., Exod. 12: 48-49. On the legal status of the foreigners in biblical Israel see van Houten 1991; Matthews 1955. 15 BE 8, no. 50:15: É DINGIR XXX URU šá LÚ ár-ba-a-a; cf. Eph‘al 1984, 189–190. 16 PIHANS 79, no.43. The document was drafted in 425 in Nippur.

146

Muhammad Dandamyev

ently worshipped Babylonian, Iranian, and other gods but also retained faith in their own traditional deities. This mixing of personal names was partly due to intermarriages. For instance, in Babylon a certain Gambija, daughter of Parnakku, who apparently was an Iranian, married a man who bore the typical Babylonian name Z"r&tu [VAS 5, no.101]. In another case, the Persian Mitrad!ta married in Nippur the Babylonian girl Esagilb"let, daughter of B"l-ittannu, and their son bore the Iranian name Bag!miri. The name of his uncle on the paternal line was Rušund!ti (an Iranian name) [BE 9, no.48 = TMH 2/III, no.144]. In many cases, such intermarriages were inevitable for the following reason. Royal soldiers from Haraiva, Sakas from Central Asia, warriors from West India or Asia Minor, etc. who arrived in Mesopotamia and were settled there on state land remained there permanently, and in some cases we can trace their second or even third generations. But they came to Mesopotamia without any women and therefore had to marry local girls. The same probably can be said in a number of cases about royal officials sent there to serve in the state administration. Thus, the aliens were not discriminated against in economic and religious life. But the question arises: what was their social status? As seen from our sources, the treatment of slaves did not depend upon their ethnic extraction irrespective of whether they were in private, royal or temple households. It can be noted that in some cases the owners changed the unusual foreign names of their slaves to Babylonian ones (thus, as we have seen above, a Babylonian who captured an Egyptian woman gave her an Akkadian name and sold her with her daughter in Babylon). Foreigners who were free-born subjects of the king consisted of various groups: officials of state administration, soldiers, Iranian landlords, merchants, etc. In some cases, their reasons for living in Babylonia are not known to us. All these groups in their transactions between themselves and with the native people followed Babylonian laws and practice. Nevertheless, there existed a considerable difference in social status of native free-born men and aliens, including their upper strata (even the Persian nobility). Since early periods of Mesopotamian history, the structure of self-government was typical of Babylonian cities. The functions of this self-government were carried out by popular assemblies of temple communities which had jurisdiction in cases relating to temple matters, as well as in instances involving property and family law. The members of such assemblies were permanent residents of particular cities and possessed some property within their areas. Their status was hereditary, and they had a number of social and economic privileges. In particular, they could become prebendaries and receive regular income from temple property. The foreigners who did not own property within the city’s communal land district had no access to the Babylonian temple organization. Therefore they had no part in city (or temple) self-government and could not become members of the popular assemblies (at least, in their first generation). However, in some cases aliens were settled in considerable numbers in separate and distinct places. As we have seen above, there are attested some instances, when Elamites, Egyptians, Judaeans, Arabians, Phoenicians, etc. lived in Mesopotamia in compact groups. Besides, in the Nippur region each ethnic group of royal

Ethnic Minorities in Babylonia

147

soldiers had its own area under the jurisdiction of their own prefects. Such aliens could establish their own self-government, i.e. a popular assembly. Thus, according to a document from Babylon drafted in 529 (i.e. still before Cambyses’ conquest of Egypt in 525) the “assembly of the Egyptian elders” existed there. It made a decision regarding lands which belonged to some soldiers of Egyptian extraction who performed royal service. Some of them had typically Egyptian names and patronymics [Camb. 85; cf. Eph‘al 1978, 79]. Thus, these Egyptians had their own assembly that could settle matters of civil law within their colony. At the beginning of the sixth century Ezekiel [8:1, etc.] mentions the “elders of Judah”, i.e. elders of the Jewish settlements in Babylonia. They apparently decided problems relating to the internal administration of these settlements and judged litigations within Jewish colonies in Babylonia [cf. Bickerman 1984, 349]. Thus, although the aliens who lived in Mesopotamia had no part in the selfgovernment of Babylonian cities, in some cases they were settled in considerable numbers in separate places and could establish their own self-government. As Eph‘al observes, “self-organization and national identity were features common to various ethnic minorities in Babylonia during the 6th – 5th centuries” [Eph‘al 1978, 87]. Our information about cultural contacts between groups of various nations in Mesopotamia is extremely scanty. Only a few Akkadian loan-words appear in the Old Persian versions of the Achaemenid inscriptions (for instance, aguru – “baked brick”). In a Babylonian document the Old Iranian loan-word dargiš (“couch”) is attested in an inventory of furnishings [BE 8, no.43; see Zadok 1984b, 33–34]. A number of Babylonian documents show that the Ebabbar temple in Sippar and the Eanna in Uruk were ordered by the administration of Cyrus II to send their workmen in order to set out royal “paradises” (pard$su) near Sippar and Uruk. This is the Old Iranian word *paridaida- (i.e., paradise; for references see Dandamayev 1984). Many Old Iranian administrative and legal terms are attested in Babylonian documents, since during the Achaemenid period many public institutions of the country gradually fell under Iranian influence. The same influence can be traced in the production of metal vases and in the iconography of Babylonian seals, especially in their subjects and style. There have also been preserved ruins of some royal palaces of Persian origin [Haerinck 1997, 28–31]. But local Babylonian culture and religion were not significantly influenced by Persian rule. Some scholars have discussed the question of the influence of the Zoroastrian philosophical system on Judaism during the Achaemenid period. It is quite possible that a mutual influence of ideas between Zoroastrianism and Judaism could take place in Babylonia through the connections of Iranian magi with Jewish priests who were descendants of the deportees from the kingdom of Judah [Boyce 1982, 188–195]. These magi apparently came to Babylonia to perform religious rituals for the Persians and Medes who resided there as royal officials, military commanders, soldiers, etc. For instance, a certain Zattumešu, who is attested as a magus, owned a field near the city Kiš during the reign of Darius I [OECT 10, no.163]. Several

148

Muhammad Dandamyev

documents from the Murašû archive mention the “town/settlement of the magi” in the region of Nippur [BE 9, no.88, etc.]. Still before the conquest of Mesopotamia by the Persians, Babylonians to a certain degree adopted equestrian archery tactics from the Cimmerians and Scythians [Dandamayev 1979, 106–108]. The Scythian bows were more powerful than the Assyrian and Babylonian ones and therefore were used by the Babylonian archers. It is also known that Scythian archers served in the Assyrian army. Economic documents from various Babylonian cities mention “Cimmerian” (i.e., Scythian) leather straps, bows and arrows with bronze and iron heads. For instance, one text from 541 refers to “200 Cimmerian reed arrows of which 180 are with copper heads, one Cimmerian bow” [YOS 6, no.237]. Besides, it also seems that the Babylonians borrowed from the Scythians a special cap with a high pointed end called karballatu in Akkadian texts. At the beginning of their life in Mesopotamia the various groups of foreign minorities were mostly settled in enclaves, had rather a strong sense of ethnic identity, and maintained their traditional languages and faiths. In their communication with other groups of aliens and with the native people they used the services of interpreters who are referred to, for instance, in Murašû documents as sep!ru (“scribe-interpreter”). In a number of cases the aliens managed to return back to their native lands which was the case, at least, of the inhabitants of Neirab in Syria and of the Jews of the Babylonian captivity. However, foreign ethnic groups had to adapt themselves to local traditions and culture. In their turn, the aliens exerted a certain cultural influence on the Babylonians. Unfortunately, we know far too little about these processes. It is of some interest to note that the scribes of Babylonian legal, economic and administrative documents knew that Iranian, Egyptian, and Jewish personal names and patronymics compounded with the divine names Baga, Mithra, Amon, Isis, Yahweh, etc., were theophoric and usually put the determinative for gods before them. It is natural that these scribes were Babylonians except for a few cases when we can trace their Egyptian and perhaps Elamite extraction [see, e.g., Nbn.65, 67, etc.]. Besides, many descendants of Assyrians were apparently among scribes who wrote Babylonian cuneiform texts but only two such individuas are so far attested [for references see Zadok 1984 a, 11]. Within several centuries, due to the processes of ethnic mixing and syncretism of cultures and faiths, almost all the groups of ethnic minorities (except the Jews, or rather a substantial part of them) were assimilated with the native population [Eph‘al 1978, 88–89]. The questions arise: what language (or languages) did the aliens use in communication with the native population of the country? What were the languages of conversation between husbands and wives of intermarried couples (for instance, between Iranian men and Babylonian women)? What was the native language of their children? Cases were mentioned above where an Egyptian who lived in Sippar sold a piece of Egyptian linen to a local individual who worked in the Ebabbar temple, or about an Iranian magus who rented out a field near the city Kiš. Again the question arises: in what languages did they and other such individuals talk with their contracting parties? As previously was noted, a document refers to a certain Harmas$u

Ethnic Minorities in Babylonia

149

who was an Egyptian judge in Babylon during the reign of Nebuchadnezzar. From Murašû texts we know about several judges of Iranian extraction who were active in Nippur. Again the question arises: did they use the services of the interpreters when they discussed judicial verdicts together with their colleagues of Babylonian descent? It is difficult to answer all these questions for certain, since there exists no direct documentary evidence on these cases. But we can assume that in the instances with intermarried couples and their children, they talked in a mixture of languages. The lingua franca, however, was Aramaic which had already been replacing Akkadian and becoming the customary language of conversation and daily use in Late Babylonian times even for the native population of Mesopotamia.

150

Muhammad Dandamyev

Bibliography Bickerman, E. J. 1978, “The Generation of Ezra and Nehemiah”, Proceedings of the American Academy for Jewish Research 45, pp.1–28. Bickerman, E. J. 1984, “The Babylonian Captivity”, 342–358 in W.D. Davies and L. Finkelstein (eds.), The Cambridge History of Judaism I. (Cambridge). Bongenaar, A.C.V.M. 1997, The Neo-Babylonian Ebabbar Temple at Sippar: Its Administration and Its Prosopography (PIHANS 80), Leiden. Bottero, J., 1994, “Les etrangers et leurs dieux, vus de Mesopotamia”, IOS 14, 23–38. Boyce M. 1982, A History of Zoroastrianism, vol. 2 (Leiden). Czechowicz, N., 2002, “Babylonische Tempelangehörige: in Babylonian oder in Phoenikien?” (in Russian with German summary) - Istorija i jazyki Drevnego Vostoka: pamjati I. M. Diakonova (History and Languages of Ancient Orient: I. M. Diakonoff Memorial Volume), St. Petersburg, 327–343. Dalley, S.,1984, “The Cuneiform Tablet from Tell Tawilan”, Levant 16, 19-22. Dandamayev, M., 1979, “Data of the Babylonian Documents from the 6th to the 5th Century B.C. on the Sakas”, in J. Harmatta (ed.), Prolegomena to the Sources on the History of Pre-Islamic Central Asia (Budapest), 95–109. Dandamayev, M., 1984, “Royal Paradeisoi in Babylonia”, Acta Iranica 9, Leiden, 113–117. Dandamayev, M., 1999, “A Neo-Babylonian Colony in Transpotamia (?)”, ArOr 67, 541–545. Dandamayev, M., 2001, review of YOS 19 in JAOS 121,700–702. Eph‘al, I., 1978, “The Western Minorities in Babylonia in the 6th - 5th Centuries B.C.: Maintenance and Cohesion”, Or 47, 74–90. Eph‘al, I., 1984, The Ancient Arabs. Nomads on the Borders of the Fertile Crescent. 9th-5th Centuries B.C. (Jerusalem). Haerinck, E., 1997, “Babylonia under Achaemenid Rule”, in J. Curtis (ed.), Mesopotamia and Iran in the Persian Period: Conquest and Imperialism 539-351 B.C. (London), 26–34. Heltzer, M., 2002, “People from Gezer in Babylonia in the VI Century B.C.E. and Their Tithe” in Y. Avishur and Z. Yehuda (eds.), Studies in the History and Culture of the Jews in Babylonia” (Jerusalem), 85–93. van Houten, Ch., 1991, The Alien in Israelite Law (Sheffield). Joannès, F., 1982, “La localisation de S$urru à l’époque néo-babylonienne”, Semitica 32, 35–43. Joannès, F., 1987, “Trois textes de S$urru á l’époque néo-babylonienne”, RA 81, 147–158. Joannès, F., 1989, “Un quartier fantôme de Babylone”, NABU, p.55. Joannès, F.–Lemaire A., 1996, “Contrats babyloniens d’époque Achéménide du Bît-Abî-râm avec une épigraphe araméenne”, RA 90, 41–60. Joannès, F.–Lemaire A. 1999, “Trois tablettes cunéiformes à onomastique ouestsémitique”, Transeuphratène 17, 17–27.

Ethnic Minorities in Babylonia

151

Jursa, M., 1995, Die Landwirtschaft in Sippar in neubabylonischer Zeit (AfO, Beiheft 25). Lipi ski, E., 2000, The Aramaeans. Their Ancient History, Culture, Religion” (OLA 100, Leuven). Matthews, V.H., 1995, Review of van Houten, 1991 in JAOS 115, 722–724. Oppenheim, A. L., 1967, “Essay on Overland Trade in the First Millennium B.C.”, JCS 21, 236–254. Röllig, W., 1968-1971, “Griechen”, RlA 5, 644–647. Rollinger, R., 1997, “Zur Bezeichnung von ‘Griechen’ in Keilschrifttexten”, RA 91, 167–172. Singer, I., 1994, “The Ancient Near East”, IOS 14, 19–22. Stolper, M.W., 1992, “Murašû, Archive of”, in D. N. Freedman (ed.), The Anchor Bible Dictionary (New York, etc.), 4, 927–928. Zadok, R., 1977, “Iranians and Individuals Bearing Iranian Names in Achaemenian Babylonia”, IOS 7, 88–138. Zadok, R., 1978, “Phoenicians, Philistines, and Moabites in Mesopotamia”, BASOR 230, 58–65. Zadok, R., 1981, “Arabians in Mesopotamia during Late-Assyrian, Chaldean, Achaemenian and Hellenistic Periods Chiefly According to the Cuneiform Sources”, ZDMG 131, 42–84. Zadok, R., 1984a, “Assyrians in Chaldean and Achaemenian Babylonia”, Assur 4/3. Zadok, R., 1984b, “Assyro-Babylonian Lexical and Onomastic Notes”, BiOr 41, 33–46. Zadok, R.,1985, Geographical Names According to New-and Late-Babylonian Texts (RTGN 8).

ASSYRISCHE HANDELSPOLITIK: DIE SYMBIOSE MIT UNABHÄNGIGEN HANDELSZENTREN UND IHRE KONTROLLE DURCH ASSYRIEN Karen Radner Assyrien verfügte über keine von der Natur vorgegebenen Begrenzungen, und seine Ausdehnung änderte sich während seiner langen Geschichte häufig. Die Eigenbezeichnung mªt A$$¥r “Land von Assur” meinte das von der Stadt Assur und dem gleichnamigen Stadtgott kontrollierte Gebiet und wurde von allen assyrischen Herrschern bis zum Untergang des Reiches im Jahre 612 v. C. verwendet, egal ob sie nur die unmittelbare Umgebung der Stadt beherrschten oder das Gebiet zwischen Mittelmeer und Zagrosgebirge. Das Reichszentrum, die Stadt Assur, liegt am Westufer des Tigris auf einem Felssporn mit weitem Blick über den Fluss und die Umgebung. Assur ist der südlichste Ort am Tigris, an dem noch Regenfeldbau betrieben werden konnte (Oates 1968, 15), doch war sein Hinterland nicht in der Lage, eine größere Siedlung zu ernähren (Oates 1968, 19-20, 31; Larsen 1987, 53-54). Die reichen Ölfelder zwischen Mossul und Kerkuk, die heute mit dem hochwertigen, schwefelarmen “Kerkuk Light” das angeblich beste Öl der Welt liefern, waren im Altertum ohne Nutzwert, und ansonsten verfügt die Region über keinerlei nennenswerte Rohstoffvorkommen. Andererseits erlaubte die günstige geographische Lage über dem Tigris die leichte Kontrolle des Flussverkehrs, der Anatolien und Südmesopotamien miteinander verband; daneben war Assur bis in jüngste Zeit ein Knotenpunkt für Überlandrouten (Oates 1968, 20-21). Diese strategisch wichtige Situation erlaubte Assur den Aufstieg zum wichtigsten Zwischenhandelszentrum der Region und damit zu einer der bedeutendsten mesopotamischen Städte. Vom altassyrischen Handelsnetzwerk zum assyrischen Reich (ca. 1350-612 v. C.) Beim Stichwort “assyrischer Handel”1 denkt man zunächst an die reichen Textfunde aus dem 18. und 17. Jh. v. C. (nach der Chronologie von Gasche et al. 1998; 1998a) vom Kültepe bei Kayseri in der Zentraltürkei.2 Assur war damals, nach dem Untergang des Reichs der Dritten Dynastie von Ur, ein kleiner unabhängiger Stadtstaat. Seine Bewohner betrieben im großen Stil Handel3 mit Anatolien, Babylonien und Innerasien. Obwohl die Stadt keineswegs eine Monopolstel-

1

2 3

In der Altorientalistik kann aufgrund der differenzierten Terminologie der Textquellen gemeinhin der Begriff Handel in der Regel klar von anderen Wegen des Güteraustausches getrennt werden, anders als in der Vorderasiatischen Archäologie, s. kritisch dazu Meijer 2000, 223224. Dercksen 2001 für eine Übersicht über die altassyrischen Textfunde aus anderen Fundorten (Alishar, Bo azköy). Für die wesentlichen Grundzüge des altassyrischen Handels s. zuletzt Veenhof 1999, 56-57.

Karen Radner

153

lung für den Handel in Nordmesopotamien besaß,4 beherrschte Assur den Zinnhandel mit Kleinasien, vertraglich abgesichert durch Abkommen mit den einzelnen anatolischen Stadtstaaten (Dercksen 1996, 162). Die assyrischen Kaufleute waren im Zwischenhandel überaus erfolgreich, begünstigt durch die politische Organisation der Stadt, in der der Stadtfürst5 nicht über uneingeschränkte Autorität verfügte, sondern sich diese in einem delikaten Gleichgewicht (“delicate equilibrium”, s. Larsen 1976, 220) mit der Stadtversammlung und dem jährlich ernannten Eponymen (limmu) teilte.6 Finanzstarke Familienhandelshäuser existierten, die mit gutem Grund mit den Fuggern oder den Medici verglichen werden (Galter 1986, 14). Die Eroberung der Stadt Assur durch §am$i-Adad I. (1710-1679 v .C.) und die Eingliederung in dessen kurzlebigen nordmesopotamischen Territorialstaat veränderten die politische und wirtschaftliche Grundlage der Stadt von Grund auf (Charpin/ Durand 1997, 372-382). Die zentralisierte Verwaltung §am$i-Adads usurpierte die Kontrolle über die familieneigenen Handelshäuser, und ein königlicher Beamter mit dem Titel wakil–tamkªr‰ “Aufseher der Kaufleute” überwachte nunmehr den Handel (Charpin/Durand 1997, 373-374). Die Aktionsfreiheit der Familien-unternehmen war nachhaltig beschnitten, und auch nach dem Fall der Dynastie §am$i-Adads wurde diese Entwicklung nicht mehr reversiert – die unabhängigen Handelshäuser hatten aufgehört zu bestehen, ersetzt durch eine staatliche Handelspolitik. Für die nächsten drei Jahrhunderte verlor Assur seine Unabhängigkeit, und die südmesopotamische und später hurritische Oberherrschaft veränderte und prägte die Stadt (vgl. Larsen 1976, 219). A$$ur-uballið I. (1353-1318 v. C.) gab Assur eine grundlegend neue Stellung in der politischen Geographie des Vorderen Orients, indem er die Stadt unter Ausnutzung der politischen Entwicklungen in Babylonien, im Hethiterreich und in Mittani (vgl. Artzi 1997a, 5 mit Anm. 16) zum Zentrum eines Territorialstaates mit einem allmächtigen König an seiner Spitze machte (vgl. Postgate 1983/84, 232; Liverani 1990, 71-72). In diesem System erfüllten die Angehörigen der assyrischen Oberschicht militärische und administrative Aufgaben und lebten als Großgrundbesitzer. Der Güteraustausch mit dem Ausland unterstand dagegen, wie zu §am$i-Adads Zeiten, der königlichen Autorität, und dies sollte bis zum Untergang Assyriens eines der Hauptmerkmale des Fernhandels bleiben. Im gegenwärtigen Kontext sind deshalb die Handelsabsprachen, die A$$ur-uballið als Teil seiner internationalen Etablierung mit dem Pharao von Ägypten traf (Artzi 1997b, 329-336; Faist 2001a, 11-17), von großer Bedeutung.

4 5 6

Charpin/Durand 1997, 377 weisen auf die Bedeutung der Händler von Emar, Mari, Karkemi$ und Elu¦¦ut hin. Für syrische Händler, insbesondere aus Ebla, die in Anatolien aktiv waren, s. Dercksen 1996, 163-164. Im kultischen Kontext und in seinen Inschriften führt er den Titel i$$iakkum (von sumerisch ensi2 “Stadtfürst”), ansonsten wird er waklum genannt, s. Larsen 1976, 147. Zu Stadtfürst, Stadtversammlung und Eponym im Detail s. Larsen 1976, 109-217; für einen kurzen Überblick s. Larsen 2000, 83-85.

154

Assyrische Handelspolitik

So untrennbar ist Fernhandel im Falle von Assyrien mit Politik verbunden, dass besser von Handelspolitik zu sprechen ist. Der Fernhandel diente der Deckung des Bedarfs einerseits an Rohstoffen, die für das Bestehen der Militärmacht Assyrien notwendig waren, andererseits an Luxusgütern für die Elite. Außenhandel ist damit Staatssache oder, um bei der assyrischen Terminologie zu bleiben, Palastsache. Dies bedeutet aber nicht, daß Privatpersonen vom Fernhandel ausgeschlossen waren. Überlandgeschäfte sind vor allem für die Bewohner der Stadt Assur im 7. Jh. v. C. gut belegt.7 Die hohe Besteuerung machte den Handel mit Regionen außerhalb Assyriens erst bei großen Investitionen attraktiv oder wenn der König Steuerfreiheit gewährt hatte.8 Dies beschränkte die potentiellen Interessenten weitgehend auf das unmittelbare Umfeld des Königs, und da die antike Mentalität eine Trennung der privaten Aktivitäten der Königsfamilie und der hohen Beamten von ihren Dienstpflichten kaum zuläßt, können wir diese Operationen den Aktivitäten des Palastes zurechnen. Doch auch ohne staatliches Involvement und damit unter Umgehung der Steuern ist Handel über die Grenzen des Reiches hinaus belegt – als Schmuggel, der von den Autoritäten nach Möglichkeit unterbunden wurde.9 Das assyrische Reich: “Network empire” und “territorial empire” Von der Regierungszeit A$$ur-uballiðs I. an wuchs das assyrische Reich trotz gelegentlicher Stagnationen beständig an. Der Zusammenbruch am Ende des 7. Jh. ereilte das Reich am Zenith seiner Macht, und das plötzliche Ende Assyriens lässt gerne vergessen, dass das über sieben Jahrhunderte bestehende Reich in der an plötzlich entstehenden und genauso schnell auseinanderfallenden Großreichen nicht armen altorientalischen Geschichte eine einmalige Erfolgsgeschichte darstellt. Dies spricht für die Organisationsstruktur des Reiches, die wir kurz in Hinblick auf den Güteraustausch analysieren wollen. Bereits 1975 beschrieb Hayim Tadmor das stetig wachsende Netzwerk aus Straßen und Stützpunkten zu militärischen, politischen und kommerziellen Zwecken als Rückgrat der Expansion und Verwaltung des assyrischen Reiches (Tadmor 1975, 37-40).10 Dass neben dem Netz aus assyrischen Verwaltungszentren, die durch Kommunikationsverbindungen zu Wasser und zu Lande zusammengehalten wurden, in den eroberten Gebieten zunächst die weitgehend unberührten lokalen Strukturen weiterbestanden, zeigte Mario Liverani 1988 für das ›abur-Gebiet (Liverani 1988a, 90-92). Grundlegend ist seine Beobachtung, dass sich Assyrien 7

Für die privat organisierten Weintransporte von den nördlichen Weinbauregionen nach Assur s. Radner 1997, 7-9 und Radner 2000a. 8 Vgl. die Befreiung von Wegzöllen und Handelssteuern in einigen Edikten A$$ur-etel-ilanis zugunsten seiner Beamten (SAA 12 35-36, 39-40), s. dazu R. M. Whiting in Kataja/Whiting 1995, xxix. 9 Für Belege aus der mittelassyrischen Zeit s. Faist 2001a, 194. Bestes neuassyrisches Beispiel ist ein Brief an Sargon II. betreffend das Ausheben einer Schmugglerbande, die zwischen Assyrien und dem verfeindeten Urar#u aktiv war (SAA 5 100; neue Kopie in Radner 1997, 29 Abb. 7). 10 Für die Bezeichnung des Modells als k ru-girru-System vgl. Artzi 1991, 257.

Karen Radner

155

erst dann von einem “network empire” zu einem “territorial empire” wandelte, sowie das assyrische Netzwerk im eroberten Gebiet an Dichte dem Reichszentrum entsprach. Ganz wesentlich ist es nun festzuhalten, dass sich diese Entwicklung in den verschiedenen Teilen des assyrischen Reiches zu unterschiedlichen Zeitpunkten, unterschiedlich schnell und unterschiedlich tiefgreifend vollzog; in weiten Teilen des Reiches wurde dieser Schritt nie vollzogen. Dazu gehören besonders die Gebiete, die erst von Sargon II. und seinen Nachfolgern annektiert wurden. Mit der fortschreitenden Expansion des Reiches veränderte sich die Art und Weise, wie Assyrien in den Besitz jener Güter gelangte, die rar, aber für das Bestehen des Reiches unumgänglich waren. Der friedliche und wechselseitige Güteraustausch durch freien Handel wurde, sowie eine Region in die militärische und politische Einflusssphäre Assyriens gelangte, vordergründig von der erzwungenen Übergabe von Tributleistungen (maddattu) verdrängt (vgl. Faist 2001a, 240). Allerdings wäre es falsch, diesen Austausch als einseitig zu sehen: Durch das Nahverhältnis zum assyrischen Reich kam die Region in den Genuß des militärischen und politischen Schutzes der Großmacht, nicht nur aus assyrischer Perspektive ein Privileg, für das die Einforderung einer Gegenleistung gerechtfertigt war. Es ist wichtig festzustellen, dass Tributleistung und Handel keinen Gegensatz darstellen, sondern miteinander einhergehen. Dass das assyrische Tributsystem den internationalen Fernhandel stützte und sogar förderte, ist eine grundlegende Feststellung, die Oppenheim schon 1965 traf (Oppenheim 1969, 36-37). Aufgrund der Selbstdarstellung der assyrischen Könige in ihren Inschriften,11 in denen Handel kaum eine Rolle spielt,12 fand dieser wichtige Punkt jedoch kaum Widerhall in der Forschung.13 Es ist jedoch zu bedenken, dass die assyrische Königsideologie den Herrscher als Auserwählten der Götter, als siegreichen Krieger, als kühnen Jäger, als gerechten Herrscher und als überlegten Gärtner und Bauern (dazu Radner 2000b) darzustellen abzielte; der “König als Krämer” war als Topos dagegen unbekannt. Es entspricht den Grundsätzen assyrischer Herrscherideologie, daß der König Handelsgüter aus aller Welt freiwillig als Abgaben fremder Herrscher erhält. Der Zugriff auf Güter aus der ganzen Welt versinnbildlicht die grenzenlose Macht des Königs; so benannte etwa Tiglath-pileser III. (744-727 v. C.) das Tor zu seinem Palast in Kal¦u: “Tor der Gerechtigkeit, das den Rechtsfall der Herrscher der vier Weltgegenden in Ordnung bringt, das die Abgabe (biltu) aus Bergland und Meer empfangen läßt, das den Ertrag (‹i%bu) des Menschengeschlechts vor den König, ihren Herrn, eintreten läßt” (Tadmor 1994: 174-175: Summ. 7: 35'36'). Und dennoch ist selbst in den Königsinschriften gelegentlich von Handel die Rede. Besonders wichtig ist ein mittelassyrischer Beleg, in dem uns Handel neben dem Krieg (hier: die Jagd) und dem königlichen Geschenkeaustausch als eine einem 11 Zur Problematik von Geschichtsrekonstruktionen auf der Basis von Königsinschriften s. Liverani 1995, 2353. 12 Vgl. Fales 1999-2001, 132 Chart 8 für eine schematische Übersicht über den Inhalt assyrischer Königsinschriften. 13 Eine Ausnahme stellt Frankenstein 1979, 270-271 dar; vgl. auch die von Oppenheim unabhängige, aber ähnliche Argumentation von Aubet 1993, 73-74.

156

Assyrische Handelspolitik

assyrischen König angemessene Erwerbsform begegnet. Wie sein Vorgänger Tiglath-pileser I. (1114-1076 v. C.) und viele seiner Nachfolger sammelte auch A$$ur-bel-kala (1073-1056 v. C.) exotische Tiere aus aller Welt, um sie öffentlich zur Schau zu stellen; sie waren sichtbarer Beleg für seine Kontrolle über die gesamte bekannte Welt. Bemerkenswert ist nun, daß er beschreibt, wie er diese Tiere als Jagdbeute, als Gaben des ägyptischen Pharaos und über seine Handelsagenten (tamkªr®) besorgt hätte.14 Prinzipiell wird aber gerade in den neuassyrischen Inschriften Handel nur dann erwähnt, wenn der König die diesbezüglichen Errungenschaften der königlichen Ahnen deutlich übertreffen konnten, ein beliebter Topos in den Inschriften. Eine solche Leistung konnte Sargon II. (721-705 v. C.) für sich in Anspruch nehmen, während dessen Regierungszeit es erstmals zu einem direkten Güteraustausch zwischen Assyrien und Ägypten kam. In den Annalen für sein Antrittsjahr wird davon berichtet, dass Sargon den “versiegelten Handelskontor” (kªru kangu) Ägyptens geöffnet und Assyrer und Ägypter Handel treiben lassen hätte (Fuchs 1994: 88, 314: Ann. 17). Dass dieser unbestreitbare Erfolg auf die diesbezüglichen Bemühungen Tiglath-pilesers III. aufbauen konnte (vgl. EphÕal 1982, 93), mußte im Rahmen einer die Taten Sargons feiernden Inschrift selbstverständlich nicht erwähnt werden. Ein insgesamt ausgewogeneres Bild ergibt sich, wenn auch die alltäglichen Texte, eine ideologisch weit weniger belastete Quelle als die Königsinschriften, herangezogen werden. Besonders für die Zeit des 8. und 7. Jh., als Assyrien seine größte Ausdehnung erreichte,15 belegen Briefe und Verwaltungstexte deutlich, daß dieselben Güter, die als Tribut abzuliefern waren, auch gegen Bezahlung nach Assyrien importiert wurden. Handelsware in großem Umfang nennt der Brief, mit dem ein gewisser Marduk$arru-u½ur dem König Asarhaddon (680-669 v.C.)mitteilt, dass er für eine Lieferung von 158 Talenten Leinenzwirn, roter und schwarzer Wolle, Alum und Natron an den Palast noch nicht bezahlt worden wäre; all diese Güter sind Westimporte (SAA 16 82, s. die Diskussion bei Oppenheim 1967, 248). Dieselben Materialien finden sich in einer langen Aufstellung des Bedarfs an Leinen (insgesamt 304 Talente 21 Minen), Textilfarbstoffen (109 Talente 10 Minen) und roter Wolle (22 Talente, hergestellt unter Verwendung von 53 Talenten Purpurfarbe) aus Ninive, die mit der Bemerkung schließt: “Wir erhalten (die genannten Güter) nicht von den Magnaten (d. h. als Tribut); wir kaufen (sie).” (nilaqqe niddan; SAA 7 115 Rs. ii 21-23). Das Nebeneinander von Erwerb durch Tributabgaben und Handel im Falle von Pferden belegen einige Verwaltungstexte und ein Brief aus Kal¦u, die in die Regierungszeit Sargons II. datieren (CTN 3 107-110, Nimrud Letter 77 [s. jetzt Saggs 2001, 141]). Hier werden Pferde entweder als $a KUR oder als $a KASKAL bezeichnet, was ich als Herkunftsangaben $a mªti “des Landes” (d. h. aus Abgaben) und $a ‹arrªni “der Handelsreise” verstehen möchte. Ein ähnlicher Gegensatz findet sich in Textilienlisten aus Ninive (SAA 7 96; 10514 RIMA 2 0.89.7 iv 26-27, vgl. Faist 2001 a, 47, 85-87. Bei den gekauften Tieren handelt es sich um zwei Arten Wildrinder (bur‹i$ und te$®nu) und um Kamele. 15 Eine gute Übersicht über die Phasen der assyrischen Expansion ab dem 9. Jh. gibt die Karte in Liverani 1988b, 793 Fig. 145.

Karen Radner

157

109), wo für Gewänder und Stoffe die Herkunftsbezeichnungen KUR “des Landes” und KAR = kªri “des Handelshafens” (zu dieser Lesung vgl. Fales/Postgate 1992, xxviii) miteinander kontrastiert werden. Die Tributabgabe einer Region im Einflußbereich Assyriens als Zeichen der Akzeptanz assyrischer Souveränität stellte sozusagen die Eintrittsgebühr in den assyrischen Markt dar. Der Güteraustausch auf der Basis von Geschenksaustausch (s. besonders SAA 1 34) und Handel wurde vom Tributsystem nicht eliminiert; diese Formen des Warenaustausches bestanden weiter. Assyrien und die Handelsmetropolen: Symbiose durch Kontrolle Gerade die wichtigsten Handelsstädte Vorderasiens stellten nicht ein primäres Ziel assyrischer Expansion dar. Die größten Warenumschlagsplätze wie Karkemi$, die phönizischen Hafenstädte an der Mittelmeerküste und die babylonischen Zentren16 blieben von der assyrischen Annektierung lange verschont, trotz kontinuierlicher militärischer und politischer Aktivitäten Assyriens in den entsprechenden Regionen. Dahinter möchte ich eine bewusste Strategie erkennen, die sowohl für die Handelsstädte wie auch für Assyrien in wirtschaftlicher Hinsicht äußerst sinnvoll und einträglich war. Assyrien förderte als Schutzmacht gezielt einzelne Warenumschlagplätze außerhalb des eigentlichen Reiches und verschaffte ihnen so eine gewinnbringende Vormachtstellung über die Konkurrenz. Die solchermaßen bevorzugten Handelsstädte hatten im assyrischen Reich einen finanzstarken Abnehmermarkt.17 Assyrien profitierte an den erzielten Gewinnen durch Besteuerung (miksu)18 und sparte sich den Aufbau eines eigenen Außenhandelsnetzes mit den großen Risiken, die Handelsexpeditionen stets anhaften.19 Dennoch unterhielt der assyrische König eigene Handelsagenten in seinen Diensten, die tamkªr®, die eng mit dem Heer zusammenarbeiteten (Radner 1999a, 101-105). Sie waren vorrangig mit der Beschaffung von Rohstoffen für die Waffen jener Zeit beschäftigt, nämlich Pferden (Radner 2003, 37-64) und Metall (Brinkman 1997, 7-8; Faist 2001b). Diese waren für die Militärmacht Assyrien Güter von staatstragender Bedeutung, und ihre Besorgung konnte deshalb bestenfalls zum Teil delegiert werden. 16 Für die Rolle von Nippur als Handelspartner Assyriens im 8. Jh. s. Cole 1996, 56-68. Für die Situation der babylonischen Städte im 7. Jh. nach der Eroberung durch Assyrien s. Elat 1998, 40-42. 17 Frankenstein 1979, 263 beschrieb die phönikischen Handelsstädte treffend als “parasitical to the demands of the major empires”. 18 Zu miksu s. zuletzt Elat 1991, 26 mit Anm. 24 (mit früherer Literatur), Faist 2001a, 192-193 und Faist 2001b, 57-58 mit Anm. 26 (Belege). Wie hoch die Abgabe im Verhältnis zum Gewinn ist, wissen wir nicht; die wertvollen Beobachtungen von Aubet 1993, 73-74 zur Besteuerung von Tyros können eventuell auf die übrigen von Assyrien protegierten Handelsmetropolen übertragen werden. 19 EphÕal 1976-80, 422 bespricht einige neuassyrische Quellen betreffend die Gefahren, die Karawanen drohten. Beim Seehandel war Schiffsbruch ein großes Risiko, s. die entsprechenden Vertragsklauseln in SAA 2 5 Rs. iii 15'-17'.

158

Assyrische Handelspolitik

Anders verhielt es sich jedoch bei Luxusgütern aller Art, mit denen unabhängige Handelsstädte Assyrien und ihre anderen Abnehmer versorgten. Das Gleichgewicht zwischen den Interessen Assyriens und den protegierten Handelsstädten bestand, solange die Handelszentren mit Assyrien nicht politisch in Konflikt gerieten. Wegen des zunehmend universellen assyrischen Machtanspruchs musste dieses Kriterium allerdings häufig zum Stolperstein für die ansonsten florierenden Beziehungen werden, und deshalb sicherten sich die Assyrer nach Möglichkeit die militärische Oberhand durch einen starken Stützpunkt in unmittelbarer Nähe der Handelsstadt. Dies zeigt der Fall Karkemi$, seit dem 3. Jt. der bedeutendste Warenumschlagplatz und Verkehrsknotenpunkt am mittleren Euphrat (Hawkins 1976-80, 444). Seit der mittelassyrischen Zeit (Faist 2001b, 54-55) war Karkemi$ für Assyrien der wichtigste Zwischenhändler nach Anatolien und an die Mittelmeerküste. Als der assyrische König Salmanassar III. (858-824 v. C.) die Stadt Til-Barsip im Jahr 856 v. C. eroberte (RIMA 3 A.0.102.2 ii 30-35), änderte er ihren Namen in Kar-Salmanu-a$ared “Salmanassars Hafen” um.20 Die Namenwahl bekundet die Absicht, die Stadt als Handelszentrum zu benutzen. Dies geschah in Symbiose mit dem nur 20 km entfernt euphrataufwärts gelegenen Karkemi$. Diese Stadt befand sich fortan unter beständiger assyrischer Überwachung21 und war zu einem Drahtseilakt zwischen Loyalität zu Assyrien und der Vertretung eigener Interessen gezwungen. Dieses Vorgehen war immerhin über 150 Jahre erfolgreich, und Karkemi$’ Stellung als Handelsumschlagplatz blieb weltweit herausragend (vgl. Winter 1983: 186-193), wie insbesondere die Inschriften des Iariri, Regent von Karkemi$ um 800 v.C., zeigen. Zwei Hieroglyphen-luwischen Texten nennen die zahlreichen und unterschiedlichen Kulturkreise, mit denen Karkemi$ in Verbindung stand. Nach der einen Inschrift (Hawkins 2000, 123-128: KARKAMI§ A6 § 2-6) war Iariris Name überall in der Fremde zu hören: in Ägypten, Ura#u, Lydien, Phrygien und Tyros.22 Nach der zweiten Inschrift (Hawkins 2000, 130-133: KARKAMI§ A15b § 19-21) sprach Iariri zwölf Sprachen und beherrschte vier Schriftsysteme, nämlich die luwische Bilderschrift, die assyrische Keilschrift sowie die phönikische und aramäische Buchstabenschrift,23 wobei diese Fremdsprachenkenntnisse in den direkten Zusammenhang mit Reise-/Handelsunternehmungen 20 Zum ideologischen Gehalt der assyrischen Umbenennungen eroberter Städte s. PongratzLeisten 1997. 21 Aufschlußreich dafür ist die Beschreibung der Stadt in einer Inschrift von Salmanassars Nachfolger §am$i-Adad V.: “Kar-Salmanu-a$ared, das gegenüber von Karkemi$ liegt” (RIMA 3 A.0.103.1 ii 9). Genauso wird in den Briefen aus der Korrespondenz Sargons II. das Verhältnis zwischen einem assyrischen Stützpunkt (bzw. seinem Kommandanten) und der von ihm überwachten urar#äischen Festung (bzw. deren Befehlshaber) beschrieben, vgl. etwa SAA 5 2: 6-9; 3: 9-12; 21: 11-16; 34 Rs. 16-17; 87: 4-12; 88: 12-Rs. 4; 90: 5-15. 22 Nach der Übersetzung von Starke 1997, 382; für Sura/i = Tyros s. auch Greenfield 1991, 179180; anders Hawkins 2000, 126, der die Länder Ägypten, Babylonien, Lydien, Phrygien und Urar#u annimmt; für Sura/i = Urar#u s. Wilhelm 1993. 23 Bezeichnet als die Schrift der Stadt (d. h. Karkemi$), die assyrische Schrift, die Schrift von Sura/i und die Schrift von Taimani; zur Identifizierung dieser Schriften s. Starke 1997, 388392.

Karen Radner

159

gestellt wurden (Starke 1997, 387). Erst als sich die Affinität der reichen Metropole zu Sargons Rivalen in Anatolien, insbesondere Midas von Phrygien, als strategisch riskant erwies, machte Sargon II. im Jahre 717 der profitablen Koexistenz ein Ende (Fuchs 1994, 88, 316: Ann. 72-76). Karkemi$ wurde erobert24 und lag aufgrund der schnellen Ausweitung des assyrischen Reiches an die Mittelmeerküste und euphrataufwärts nach Anatolien unvermittelt im Binnenland Assyriens. Die Stadt erholte sich von der Reduzierung auf eine Provinzstadt nie wieder, und ihre lange Geschichte endet mit dem Fall Assyriens. Die Motivation Assyriens für die Schonung von Handelszentren illustriert besonders gut der Umgang mit den phönizischen Hafenmetropolen Sidon und Tyros. Nachdem unter Tiglath-pileser I. ein erster direkter Kontakt zustande kam (RIMA 2 A.0.87.3: 16-25), standen Sidon und Tyros seit der Regierungszeit Assurnasirpals II. (883-859 v. C.), der Gesandte aus diesen Städten zur Einweihungsfeier von Kal¦u geladen hatte (RIMA 2 A.0.101.30: 145), im regelmäßigen Kontakt mit Assyrien. Ihre Unabhängigkeit behielten sie bis in die Regierungszeit Asarhaddons (680-669 v. C.) bei,25 selbst als Tiglath-pileser III. und seine Nachfolger die übrige Levanteküste und das syrische Hinterland nach und nach annektierten. Phönizier (vgl. Tadmor 1975, 41; Lipin¢ski 1983) und Phönizisches26 waren am assyrischen Königshof allgegenwärtig. Sidon und Tyros war freier Handel mit jedermann gestattet – mit Ausnahme der Feinde Assyriens;27 nachdem diese Auflage nicht immer ernst genommen wurde, insbesondere was Ägypten betraf, waren die Beziehungen spannungsbehaftet. Durch die Eroberungen Tiglath-pilesers III. war Assyrien aber im Vorteil, hing das Bestehen der phönizischen Flotten doch von der steten Holzzufuhr aus dem Libanongebirge ab, das nun von Assyrien kontrolliert wurde. Assyrien überließ Sidon und Tyros die Nutzung der Wälder, gegen entsprechende Besteuerung und bei Einhaltung der Handelsblockade der assyrischen Feinde.28 Aus der Eroberung von Karkemi$ im Jahr 717 v. C. müssen vor allem die phönizischen Städte ungeheuren Profit gezogen haben, stand ihnen durch den 24 Bei der Eroberung von Karkemi$ fiel Sargon II. der reiche Königsschatz des Pisiris in die Hände, der unter anderem 11 Talente Gold und 2100 Talente Silber, aber auch Zinn, Eisen und Elfenbein enthielt (Fuchs 1994, 316: Ann. 72b-c). Genauso wie der weitverbreitete Gewichtsstandard der “Mine von Karkemi$”(s. Radner 1999b, 130-131 und 150-152 für die Belege; Zaccagnini 1999-2001 zur Metrologie) ist dies ein deutlicher Hinweis auf das Handelsvolumen von Karkemi$. 25 Für eine Zusammenfassung dieser Zeit s. Aubet 1993, 70-74; zu den Beziehungen zwischen Tyros und Assyrien s. auch Kestemont 1983. 26 Der Import von phönikischen Gütern und durch den phönikischen Zwischenhandel von Produkten aus Ägypten und anderen Mittelmeeranrainerstaaten stieg seit der Regierungszeit Assurnasirpals II. stetig an. Bekannteste Beispiele sind neben den berühmten Purpurstoffen (dazu Klengel 1990, 411-412) die Elfenbein- und Knochenschnitzereien (s. Hermann 1992) sowie Edelmetallarbeiten (s. Moscati 1988), wie man sie besonders in Nimrud/Kal¦u in großer Zahl entdeckt hat. Die Auswirkungen dieses Kulturimports auf die vor Ort produzierten assyrischen Kunsterzeugnisse sind offensichtlich (zu den Elfenbeinen s. Hermann 1997). 27 Dies ist besonders deutlich in einem Brief an Tiglath-pileser III. (Nimrud Letter 12, s. jetzt Saggs 2001, 155-158); vgl. Elat 1991, 25-26 und Aubet 1994, 72. 28 Auch dazu bietet Nimrud Letter 12 die klarsten Aussagen.

160

Assyrische Handelspolitik

Wegfall dieses zuvor unumgänglichen Zwischenhändlers der assyrische Markt direkt offen. Dadurch sah sich Assyrien unversehens für seine Importe aus dem Westen des Reiches von einer einzigen Quelle abhängig, eine handelspolitisch ungünstige Situation, der durch die Förderung griechischer Handelskolonien in Kilikien und im Hataygebiet von der Regierungszeit Sargons II. an gegengesteuert wurde (Lanfranchi 2000, 20-21, 29-31). Es erscheint mir wahrscheinlich, dass Asarhaddon gerade deshalb vergleichsweise drastisch auf eine Verschwörung Sidons mit Sanduarri von Kundu, einem kilikischen Herrscher,29 reagierte (Borger 1956, 49-50: Episode 6); jede Absprache zwischen diesen von Assyrien als Konkurrenten aufgebauten Regionen war aus assyrischer Perspektive Hochverrat. Sidon wurde 677 erobert und zerstört; an seiner Stelle ließ Asarhaddon den programmatisch benannten Hafen Kar-A$$ur-a¦u-iddina (“Asarhaddons Hafen”) entstehen (Borger 1956, 48-49: Episode 5). Handelspolitisch überaus bedeutsam ist nun das weitere Vorgehen der Assyrer. Sie versuchten nicht, Sidon unter dem neuen Namen als assyrisches Handelszentrum weiterzuführen und so selbst im Seehandel aktiv zu werden, sondern etablierten Sidons alten Konkurrenten Tyros als alleinige phönizische Vormacht im Mittelmeerhandel. Seit der Seepartie Tiglath-pilesers I. (RIMA 2 A.0.87.3: 2125) betrachteten die Assyrer die phönizische Seefahrt mit Respekt; dass man aber nicht vorhatte, die Phönizier auf dem Gebiet des Seehandels zu ersetzen, macht der Pakt, den Asarhaddon mit dem König von Tyros schloss, überaus klar. Wie zuvor “Salmanassars Hafen” Til-Barsip im Falle von Karkemi$, fiel “Asarhaddons Hafen”, dem früheren Sidon, nun die Rolle eines assyrischen Flottenstützpunkts zur Überwachung des 20 km entfernten Tyros zu. “Asarhaddons Hafen” sollte Tyros im Zaum halten, aber nicht Ausgangspunkt für assyrische Überseeabenteuer werden.30 Von Asarhaddon mittels eines uns in Fragmenten erhaltenen Vertrages verbrieft (SAA 2 5),31 erhielt der tyrische König Baõalu (E. Lipin¢ski in PNA I/2 242-

29 Kundu wird mit dem bei Strabo (XIV 5, 10) genannten !"#$% identifiziert, s. Röllig 198083, 341; zu den Quellen s. auch K. Radner in PNA I/1 7 s.v. Abdi-Milk¥ti. 30 Vgl. den assyrischen Umgang mit dem Wüstenkarawanenhandel entlang der Weihrauchstraße, den man trotz aller Einflußnahme nie der Kontrolle durch die arabischen Stammesföderationen zu entreißen versuchte, s. dazu zuletzt Frahm 1999, 84-89. 31 Zur Datierung sind die Bemerkungen von S. Parpola in Parpola/Watanabe 1988, xixx zu beachten. Der in neuassyrischer Schrift und Sprache abgefaßte Vertrag, der in Ninive gefunden wurde, ist auch ein wichtiger Beleg für die Kenntnis der phönikischen Göttervorstellungen am assyrischen Königshof. Mit Sicherheit gab es ein Duplikat, wohl in phönikischer Schrift und Sprache, das in Tyros aufbewahrt wurde. Der Vertragsabschluß bedeutete für beide Parteien eine Konfrontation mit der Götterwelt des jeweils anderen. Dies ist unschwer aus dem erhaltenen Keilschrifttext abzulesen, der, wie in altorientalischen Vertragswerken üblich, mit Sicherungsklauseln in Form von Flüchen beschlossen wird; neben den Gottheiten der Assyrer werden, der bilateralen Natur des Textes entsprechend, auch die kanaanäischen Götter (genannt “Götter von Ebir-nari”, wörtl. “(das Gebiet) jenseits des Flusses”, d. h. westlich des Euphrats, s. SAA 2 5 Rs. iv 9') beschworen: Bethel und Anath-Bethel, Baõal §amaim, Baõal Malagê und Baõal Saphon, Melqarth, E$mun und Astarte. Dabei sind die Flüche so individuell auf diese Gottheiten zugeschnitten, das zumindest von Seiten des assyrischen Schreibers eine

Karen Radner

161

243 s.v.) unbeschränkten Zugang zum Libanongebirge – unerlässlich als Holzlieferant für die Herstellung der Schiffe – und zu allen Mittelmeerhäfen unter assyrischem Einfluss (Elat 1991, 26-27). Tyros hatte damit einen unschätzbaren Vorteil über alle Konkurrenten, und dass die Stadt auch nach dem Untergang Assyriens der bedeutendste phönizische Hafen mit dem am weitest verzweigten Handelsnetzwerk32 blieb (Klengel 1990, 410), verdankte die Stadt der geschickten Ausnutzung dieser bevorzugten Stellung. Die von den Assyrern geforderten Gegenleistungen nehmen sich vergleichsweise moderat aus. Wie schon zuvor (SAA 2 5 Rs. iii 26': ki-i $á ina la-bi-[ri]), partizipierte Assyrien am Gewinn aus dem Handel, während ein assyrischer Beamter mit dem Titel q®pu “Vertrauensmann (des Königs)” (Pe!írková 1987, 166-167) in Tyros residierte. Der Einfluss dieses Beamten sollte nicht unterschätzt werden. Da er durch seine Position automatisch zu den engsten Beratern des lokalen Herrschers gehörte (SAA 2 5 Rs. iii 7-8),33 war garantiert, dass assyrische Interessen ständig auf höchster Ebene vertreten waren. Trotzdem erwies sich Baõalus Loyalität aus assyrischer Sicht schon wenig später als mangelhaft, als er sich 671 vor der assyrischen Invasion Ägyptens auf die Seite des nubischen Pharaos Taharka stellte (Borger 1956, 86: Frt. F: 12-14; 112: AsBbE: 7-8); dies ist weniger als ein militärisches Bündnis als vielmehr ein Fortführen der bestehenden Handelsbeziehungen mit Ägypten zu deuten. Asarhaddons Belagerung und Blockade resultierte in der Kapitulation der Stadt, nicht aber in der Beseitigung Baõalus, ebenso wenig wie eine spätere Strafexpedition Assurbanipals (668-ca. 630 v. C.). Wie leicht Assyrien die militärische Kontrolle von Tyros fiel, zeigt der Vergleich mit Nebukadnedzar II. (604-562 v. C.) von Babylonien, der später 13 Jahre brauchen sollte,34 um die Stadt einzunehmen; die entscheidende Rolle spielte hier sicherlich der assyrische Flottenstützpunkt Kar-A$$ur-a¦uiddina. Vordergründig überraschend ist nach diesem Vertrauensbruch, dass Tyros die Unabhängigkeit behielt, und Baõalu seinen Thron, wenn auch die königliche Familie in Geiselhaft nach Assyrien gebracht wurde. Ob das alte Arrangement mit Asarhaddon trotz der wiederholten Probleme beibehalten wurde oder nicht, verschweigen die Quellen, doch ist klar, dass Assyrien aus einem funktionierenden tyrischen Handel seinen Nutzen zog und keinerlei Interesse hatte, den Handelumschlagplatz zu zerstören oder selbst zu übernehmen (Aubet 1994, 74)35. Nach der

32 33 34 35

eingehende Beschäftigung mit den religiösen Vorstellungen des phönikischen Vertragspartners vorauszusetzen ist; gleiches gilt wohl auch für den tyrischen Schreiber. Dazu s. Liverani 1991; für die noch beschränkte Ausdehnung dieses Handelsnetzwerks in den ersten Jahrhunderten des 1. Jt. s. Klengel 1990, 412. Dieser wichtige Punkt wird in der Diskussion der politischen Organisation von Tyros (dazu zuletzt Sommer 2000) übersehen. Überliefert durch ein Zitat des Menander Ephesius bei Josephus, Contra Apionem I 21. Zu Tyros während der Regierungszeit Nebukadnedzars II. s. Streck 1999, 198-199. Eine assyrische Provinz Tyros gab es nie, obwohl der Eponym des Jahres 650 in der Datumsangabe einer Prophezeiung für Assurbanipal (SAA 9, 9) als Statthalter von Tyros bezeichnet wird. Bel-šaddûõa führt ansonsten den Titel des Statthalters von Kar-Aššur-a¦uiddina = Sidon, und die abweichende Titulierung kann durch die Natur des Textes erklärt werden. Wie in den Datierungen von Königsinschriften, wo Provinzen mit klingenden Namen aus der altorientalischen Tradition angesprochen werden (Lullumû statt Mazamua, Naõiri statt Amedi, Katmu‹‹u statt §ahuppa), oder der Großwesir, der in der neuassyrischen Zeit keiner Provinz vorstand, in Anlehnung auf die mittelassyrische Verwaltungsstruktur als

162

Assyrische Handelspolitik

Eroberung Ägyptens war zumindest ein Stolperstein der assyrisch-tyrischen Beziehungen beseitigt: Der Handel mit Ägypten war Tyros nun erlaubt. Die harmonische Koexistenz mit unabhängigen und deshalb eigenwilligen Handelshochburgen war eine Herausforderung für die assyrische Diplomatie,36 deren Effizienz über die Schilderungen militärischer Erfolge in den assyrischen Königsinschriften leicht übersehen wird. Dieser Aufwand lag freilich nur dann im Interesse Assyriens, wenn vom Partner zu profitieren war. Das Beispiel der Handelsroute entlang des Diyala über den Zagros ins iranische Hochland, ein Streckenabschnitt der berühmten Seidenstraße, zeigt, wie die Assyrer mit ersetzbaren Handelspartnern umgingen. An der Seidenstraße ging es nicht um die Kontrolle eines Warenumschlagplatzes mit weitverzweigten Handelskontakten, sondern einer Vielzahl von Städten und Kleinstaaten, die von den durchziehenden Karawanen profitierten; dies taten sie nicht als Zwischenhändler, sondern in der Art von Raubrittern, die Schutzgeldzahlungen und Wegezölle forderten. Assyrien profitierte von diesem Know-how nicht: Das Eintreiben von Steuern konnte die assyrische Verwaltung unschwer selbst übernehmen, der Erhalt der Raubritterstädte als eigenständige Entitäten schien überflüssig; unter Tiglath-pileser III. und Sargon II. wurde das Gebiet deshalb so weit wie möglich annektiert. Die kleinteilige Geographie des Zagrosgebirges und die zahlreichen Ausweichmöglichkeiten ließen es aber nicht zu, den Streckenabschnitt durch die Beherrschung nur einiger weniger Punkte zu kontrollieren. Nach der Etablierung der zwei östlichsten assyrischen Provinzen im Zagros – im Land der Meder – unter Sargon II. im Jahr 716 wurden nicht weniger als sieben Städte zu assyrischen Festungen ausgebaut. Sie alle erhielten neue Namen, jeweils unter der Verwendung des Elements kªru “Hafen; Handelsstützpunkt”, wobei ›ar‹ar, die wichtigste unter ihnen, wenig überraschend den Namen Kar§arrukin “Sargons Hafen” erhielt.37 Die assyrische Übernahme der Kontrolle über die Seidenstraße hatte weitreichende Konsequenzen. Im Nachhinein kann man sie sicherlich als strategische Fehlentscheidung bezeichnen, die womöglich zum Untergang des assyrischen Reiches beitrug. Indem für Assyriens Feinde, insbesondere Elam und den rebellivorstand, in Anlehnung auf die mittelassyrische Verwaltungsstruktur als Statthalter einer nicht existierenden Provinz ›aningalbat bezeichnet wird (Borger 1956, 67: Nin. H: 13+x), wird die Titulatur des Jahreseponymen als Ausdrucksmittel der allumfassenden und ewigen Vormachtstellung Assyriens gebraucht. 36 Zu den bekannten assyrischen internationalen Verträgen im 8. und 7. Jh. s. Parpola 1987, 184186. Vgl. dazu auch die altassyrischen Verträge, s. Dercksen 1996, 162. Zu %‰ru “Botschafter” s. Tadmor 1994, 178. 37 Im Jahr 716 eroberte Sargon II. ›ar‹ar und Ki$essim und machte sie unter den neuen Namen Kar-§arrukin “Sargons Hafen” und Kar-Nergal “Hafen des Gottes Nergal” zu Hauptstädten zweier neuer Provinzen. Im folgenden Jahr, nach einer Revolte in diesen Provinzen, wurden vier weitere Städte in der Gegend umbenannt: Ki$e$lu, Qindau, Anzaria und Bit-Bagaia (BitGabaia) hießen nun nach wichtigen assyrischen Göttern Kar-Nabû, Kar-Sin, Kar-Adad und Kar-Issar und wurden als assyrische Stützpunkte ausgebaut. 702 folgt Sanherib dem Beispiel seines Vaters und ändert den Namen der Stadt Elenza$ zu Kar-Sin-a‹‹e-eriba “Sanheribs Hafen”, als er sie dem Territorium von Kar-§arrukin hinzufügte. Zu den Quellen s. Radner 2003.

Karen Radner

163

schen Süden Babyloniens („Meerland“), diese wichtige Handelsroute nun gesperrt war, mußten Alternativen gefunden werden. Kamelkarawanen durch die arabische Wüste ermöglichten Elam und der südbabylonischen Meerland-Dynastie auch ohne Zugang zur Seidenstraße und unter Umgehung der assyrischen Machtsphäre die Teilnahme am internationalen Fernhandel (Gibson 1991, 33-36). Die wirtschaftliche Notwendigkeit zur direkten Zusammenarbeit war mitverantwortlich dafür, daß babylonische und iranische Interessen sich im Laufe des 7. Jh. auch politisch rasch annäherten. Eine Folge davon waren Assurbanipals (668- ca. 630 v. C.) jahrzehntelange Kriege gegen Elam und in Babylonien, die kurzfristig die Situation zu Gunsten Assyriens zu entscheiden schienen. Einer Allianz zwischen Meerländern und Medern gelang aber 614 der Vorstoß ins Zentrum des assyrischen Reiches und die Einnahme Assurs. Damit begann der schnelle Zerfall des assyrischen Reiches. Was A$$ur-uballi# I. sieben Jahrhunderte zuvor mit Hilfe ägyptischer Handelsabkommen geschaffen hatte, mußte A$$ur-uballi# II. 610 trotz der Unterstützung ägyptischer Truppen in einer letzten Schlacht bei ›arran zu Grabe tragen. Doch die bewährte Organisationsstruktur des assyrischen Reiches und mit ihr die Außenhandelspolitik überdauerten die Existenz des eigenständigen politischen Gebildes und lebte im neubabylonischen Reich der Meerlanddynastie und später im Achämenidenreich fort.

164

Assyrische Handelspolitik

Abkürzungen ABL CTN 3 PNA I/1 PNA I/2 RIMA 2 RIMA 3 SAA 1 SAA 2 SAA 5 SAA 7 SAA 9 SAA 12 SAA 16

Harper, R. F. 1892-1914. Assyrian and Babylonian Letters. London und Chicago: University of Chicago Press. Dalley, S. M., und J. N. Postgate. 1984. The Tablets from Fort Shalmaneser. Cuneiform Texts from Nimrud. Oxford: British School of Archaeology in Iraq. The Prosopography of the Neo-Assyrian Empire I/1: A, hrsg. von K. Radner. Helsinki: CNA Project (1998). The Prosopography of the Neo-Assyrian Empire I/2: B-G, hrsg. von K. Radner. Helsinki: CNA Project (1999). A. K. Grayson 1991. Assyrian Rulers of the Early First Millennium BC I (1114-859 BC). The Royal Inscriptions of Mesopotamia: Assyrian Periods 2. Toronto: University of Toronto Press. A. K. Grayson 1996. Assyrian Rulers of the Early First Millennium BC II (858-745 BC). The Royal Inscriptions of Mesopotamia: Assyrian Periods 3. Toronto: University of Toronto Press. Parpola, S. 1987. The Correspondence of Sargon II, Part I: Letters from Assyria and the West. State Archives of Assyria 1. Helsinki: Helsinki University Press. Parpola, S., und K. Watanabe. 1988. Lanfranchi, G. B., und S. Parpola. 1990. The Correspondence of Sargon II, Part II: Letters from the Northern and Northeastern Provinces. State Archives of Assyria 5. Helsinki: Helsinki University Press. Fales, F. M., und J. N. Postgate. 1992. Parpola, S. 1997. Assyrian Prophecies. State Archives of Assyria 9. Helsinki: Helsinki University Press. Kataja, L., und R. Whiting. 1995. Luukko, M., und G. Van Buylaere. 2002. The Political Correspondence of Esarhaddon. State Archives of Assyria 16. Helsinki: Helsinki University Press.

Karen Radner

165

Literaturverzeichnis Artzi, P. 1991. “A$$ur-uballi# and the Suteans.” In Ah, Assyria... (= Festschrift Hayim Tadmor). Scripta Hierosolymitana 33, hrsg. von M. Cogan und I. EphÕal, 254-257. Jerusalem: Magnes Press. Artzi, P. 1997a. “The Middle-Assyrian Kingdom as Precursor to the Assyrian Empire.” In Assyrien im Wandel der Zeiten. Heidelberger Studien zum Alten Orient 6, hrsg. von H. Hauptmann und H. Waetzoldt, 3-6. Heidelberg: Heidelberger Orientverlag. Artzi, P. 1997b. “EA 16.” Altorientalische Forschungen 24:320-336. Aubet, M. E. 1993. The Phoenicians and the West. Politics, Colonies and Trade. Cambridge: Cambridge University Press. Borger, R. 1956. Die Inschriften Asarhaddons Königs von Assyrien. Archiv für Orientforschung Beiheft 9. Graz: Selbstverlag E. F. Weidner. Brinkman, J. A. 1997. “Unfolding the Drama of the Assyrian Empire.” In Assyria 1995, hrsg. von S. Parpola und R. M. Whiting, 1-16. Helsinki: CNA Project. Charpin, D., und J.-M. Durand. 1997. “A$$ur avant l'Assyrie.” Mari. Annales de Recherches Interdisciplinaires 8:367-390. Cole, S. W. 1996. Nippur in Late Assyrian Times, c. 755-612 BC. State Archives of Assyria Studies 4. Helsinki: CNA Project. Dercksen, J. G. 1996. The Old Assyrian Copper Trade in Anatolia. Leiden und Istanbul: Nederlands Historisch-Archaeologisch Instituut te Istanbul. Dercksen, J, G. 2001. “When We Met in ›attu$. Trade According to Old Asssyrian Texts from Alishar and Bo azköy.” In Veenhof Anniversary Volume (= Festschrift Klaas R. Veenhof), hrsg. von W. H. van Soldt et al., 39-66. Leiden und Istanbul: Nederlands Historisch-Archaeologisch Instituut te Istanbul. Elat, M. 1991. “Phoenician Overland Trade within the Mesopotamian Empires.” In Ah, Assyria... (= Festschrift Hayim Tadmor). Scripta Hierosolymitana 33, hrsg. von M. Cogan und I. EphÕal, 21-35. Jerusalem: Magnes Press. Elat, M. 1998. “Die wirtschaftlichen Beziehungen der Assyrer mit den Arabern.” In Tikip santakki mala baµmu... (= Festschrift Rykle Borger). Cuneiform Monographs 10, hrsg. von S. M. Maul, 39-57. Groningen: Styx. EphÕal, I. 1976-80. “Karawane C. Ist Millennium B. C.” RLA 5:421-422. EphÕal, I. 1982. The Ancient Arabs. Nomads on the Borders of the Fertile Crescent 9th-5th Centuries B.C. Jerusalem: Magnes Press und Leiden: Brill. Faist, B. I. 2001a. Der Fernhandel des assyrischen Reiches zwischen dem 14. und 11. Jh. v. Chr. AOAT 265. Münster: Ugarit-Verlag. Faist, B. I. 2001b. “Die Handelsbeziehungen zwischen Assyrian und Anatolien in der zweiten Hälfte des 2. Jt.s v. Chr. unter besonderer Berücksichtigung des Metallhandels.” In Anatolien im Lichte kultureller Wechselwirkungen. Akkulturationsphänomene in Kleinasien und seinen Nachbarregionen während des 2. und 1. Jahrtausends v. Chr., hrsg. von H. Klinkott, 53-66. Tübingen: Attempto. Fales, F. M. 1999-2001.“Assyrian Royal Inscriptions: Newer Horizons.” State Archives of Assyria Bulletin 13:115-144.

166

Assyrische Handelspolitik

Fales, F. M., und J. N. Postgate. 1992. Imperial Administrative Records, Part I. Palace and Temple Administration. State Archives of Assyria 7. Helsinki: Helsinki University Press. Frahm, E. 1999. “Perlen von den Rändern der Welt.” In Languages and Cultures in Contact. At the Crossroads of Civilizations in the Syro-Mesopotamian Realm. Orientalia Lovaniensia analecta 96, hrsg. von K. van Lerberghe und G. Voet, 79-99. Leuven: Peeters. Frankenstein, S. 1979. “The Phoenicians in the Far West: A Function of NeoAssyrian Imperialism.” In Power and Propaganda. A Symposium on Ancient Empires. Mesopotamia 7, hrsg. von M. T. Larsen, 263-294. Kopenhagen: Akademisk Forlag. Fuchs, A. 1994. Die Inschriften Sargons II. aus Khorsabad. Göttingen: Cuvillier. Galter, H. D. 1986. “Das §am$i-Adad-Syndrom. Assyrien und die Folgen kultureller Innovation.” In Kulturkontakte und ihre Bedeutung in Geschichte und Gegenwart des Orients. Grazer Morgenländische Studien 1, hrsg. von H. D. Galter, 13-26. Graz: dvb-Verlag. Gasche, H., J. A. Armstrong, S. W. Cole und V. G. Gurzadyan. 1998. Dating the Fall of Babylon. A Reappraisal of Second-Millennium Chronology. Mesopotamian History and Environment Memoirs 4. Ghent/Chicago: University of Ghent/Oriental Institute of the University of Chicago. Gasche, H., J. A. Armstrong, S. W. Cole und V. G. Gurzadyan. 1998a. “A Correction to Dating the Fall of Babylon. A Reappraisal of Second-Millennium Chronology (= MHEM 4), Ghent and Chicago, 1998.” Akkadica 108:1-4. Gibson, McG. 1991. “Duplicate Systems of Trade: A Key Element in Mesopotamian History.” In Asian Trade Routes. Studies on Asian Topics 13, hrsg. von K. R. Haellquist, 27-37 und 254-256 (Anmerkungen). London: Curzon Press. Greenfield, J. C. 1991. “Of Scribes, Scripts and Languages.” In Phoinikeia Grammata. Collection des Études Classiques 6, hrsg. von C. Baurain, 173185. Liège und Namur: Société des Études Classiques. Hawkins, J. D. 1976-80. “Karkami$.” RLA 5:426-446. Hawkins, J. D. 2000. Inscriptions of the Iron Age. Corpus of Hieroglyphic Luwian Inscriptions I. Berlin: de Gruyter. Hermann, G. 1991. “The Nimrud Ivories, 2. A Survey of Traditions.” In Von Uruk nach Tuttul (= Festschrift Eva Strommenger), hrsg. von B. Hrouda, S. Kroll und P. Z. Spanos, 65-79. München und Wien: Profil Verlag. Hermann, G. 1997. “The Nimrud Ivories, 3. The Assyrian Tradition.” In Assyrien im Wandel der Zeiten. Heidelberger Studien zum Alten Orient 6, hrsg. von H. Hauptmann und H. Waetzoldt, 285-290. Heidelberg: Heidelberger Orientverlag. Kataja, L., und R. Whiting. 1995. Grants, Decrees and Gifts of the Neo-Assyrian Period. State Archives of Assyria 12. Helsinki: Helsinki University Press. Kestemont, G. 1983. “Tyr et les Assyriens.” In Studia Phoenicia I-II. Orientalia Lovaniensia Analecta 15, hrsg. von E. Gubel, E. Lipi"ski und B. ServaisSoyez, 53-78. Leuven: Peeters.

Karen Radner

167

Klengel, H. 1990. “Fernbeziehungen und Kulturkontakte in den westlichen Randgebieten des Assyrerreiches.” Jahrbuch des Römisch-Germanischen Zentralmuseums Mainz 37:405-414. Lanfranchi, G. B. 2000. “The Ideological and Political Impact of the Assyrian Imperial Expansion on the Greek World in the 8th and 7th Centuries BC.” In The Heirs of Assyria. Melammu Symposia I, hrsg. von S. Aro und R. M. Whiting, 7-34. Helsinki: CNA Project. Larsen, M. T. 1976. The Old-Assyrian City-State and Its Colonies. Mesopotamia 4. Kopenhagen: Akademisk Forlag. Larsen, M. T. 1987. “Commercial Networks in the Ancient Near East.” In Centre and Periphery in the Ancient Near East, hrsg. von M. Rowlands, M. T. Larsen und K. Kristiansen, 47-56. Cambridge: Cambridge University Press. Larsen, M. T. 2000. “The Old Assyrian City-State.” In A Comparative Study of Thirty City-State Cultures. An Investigation Conducted by the Copenhagen Polis Centre, hrsg. von M. H. Hansen, 77-87. Kopenhagen: Det Kongelige Danske Videnskabernes Selskab. Lipi"ski, E. 1983. “Les Phéniciens à Ninive au temps des Sargonides: Ahoubasti, portier en chef.” Atti del I Congresso Internazionale di Studi Fenici e Punici 1, 125-134. Rom: Consiglio Nazionale della Ricerche. Liverani, M. 1988a. “The Growth of the Assyrian Empire in the Habur/Middle Euphrates Area: A New Paradigm.” State Archives of Assyria Bulletin 2:8198. Liverani, M. 1988b. Antico Oriente. Storia società economia. Rom und Bari: Laterza. Liverani, M. 1990. Prestige and Interest. International Relations in the Near East ca. 1600-1100 B.C. History of the Ancient Near East Studies 1. Padua: sargon srl. Liverani, M. 1991. “The Trade Network of Tyre According to Ezek. 27.” In Ah, Assyria... (= Festschrift Hayim Tadmor). Scripta Hierosolymitana 33, hrsg. von M. Cogan und I. EphÕal, 65-79. Jerusalem: Magnes Press. Liverani, M. 1995. “The Deeds of Ancient Mesopotamian Kings.” In Civilizations of the Ancient Near East, hrsg. von J. M. Sasson, 2353-2366. New York: Charles Scribner's Sons. Meijer, D. J. W. 2000. “State and Trade. Toward a Case Study for Northern Syria.” In La Djéziré et l'Euphrate syriens de la protohistoire à la fin du IIe millénaire av. J.-C. Tendeances dans l'interprétation historique des données nouvelles. Subartu 7, hrsg. von O. Rouault und M. Wäfler, 219-240. Turnhout: Brepols. Moscati, S. 1988. “Metal Bowls.” In The Phoenicians, hrsg. von S. Moscati, 436447. Milan: Bompiani. Oates, D. 1968. Studies in the Ancient History of Northern Iraq. London: Oxford University Press. Oppenheim, A. L. 1967. “Essay on Overland Trade in the First Millennium B.C.” JCS 21:236-254.

168

Assyrische Handelspolitik

Oppenheim, A. L. 1969. “Comment [zu I. M. Diakonoff, “Main Features of the Economy in the Monarchies of Ancient Western Asia”].” In Troisìeme conférence internationale d'histoire économique: Munich 1965. Section VIII: The Ancient Empires and the Economy, hrsg. von M. I. Finley, 33-40. Paris: Mouton. Parpola, S. 1987. “Neo-Assyrian Treaties from the Royal Archives of Nineveh.” JCS 39:161-189. Parpola, S. und K. Watanabe. 1988. Neo-Assyrian Treaties and Loyality Oaths. State Archives of Assyria 2. Helsinki: Helsinki University Press. Pe!írková, J. 1987. “The Administrative Methods of Assyrian Imperialism.” Archiv Orientální 55:162-175. Pongratz-Leisten, B. 1997. “Toponyme als Ausdruck assyrischen Herrschaftsanspruchs.” In Ana $adî Labnªni l¥ allik. Beiträge zu altorientalischen und mittelmeerischen Kulturen (= Festschrift Wolfgang Röllig). AOAT 247, hrsg. von B. Pongratz-Leisten, H. Kühne und P. Xella, 325-343. Kevelaer: Butzon & Bercker und Neukirchen-Vluyn: Neukirchener Verlag. Postgate, J. N. 1983/84. Rezension zu Provincial Governance in Middle Assyria and some New Texts from Yale, von P. Machinist. Mesopotamia 18/19:229233. Radner, K. 1997. “Erntearbeiter und Wein. Neuassyrische Urkunden und Briefe im Louvre.” State Archives of Assyria Bulletin 11:3-29. Radner, K. 1999a. “Traders in the Neo-Assyrian Period.” In Trade and Finance in Ancient Mesopotamia, hrsg. von J. G. Dercksen, 101-126. Leiden und Istanbul: Nederlands Historisch-Archaeologisch Instituut te Istanbul. Radner, K. 1999b. “Money in the Neo-Assyrian Period.” In Trade and Finance in Ancient Mesopotamia, hrsg. von J. G. Dercksen, 127-157. Leiden und Istanbul: Nederlands Historisch-Archaeologisch Instituut te Istanbul. Radner, K. 2000a. “Die neuassyrischen Texte der Münchner Grabung in Assur 1990.” MDOG 132:101-103. Radner, K. 2000b. “How did the Neo-Assyrian King Perceive his Land and its Resources?” In Rainfall and Agriculture in Northern Mesopotamia, hrsg. von R. M. Jas, 233-246. Leiden und Istanbul: Nederlands HistorischArchaeologisch Instituut te Istanbul. Radner, K. 2003. “An Assyrian View on the Medes.” In Continuity of Empire: Assyria, Media, Persia, hrsg. von G. B. Lanfranchi, M. Roaf und R. Rollinger. 37-64, Padua: sargon srl.. Röllig, W. 1980-83. “Kundu.” RLA 6:341. Saggs, H. W. F. 2001. The Nimrud Letters, 1952. Cuneiform Texts from Nimrud 5. London: British School of Archaeology in Iraq. Sommer, M. 2000. Europas Ahnen. Ursprünge des Politischen bei den Phönikern. Darmstadt: Wissenschaftliche Buchgesellschaft. Starke, F. 1997. “Sprachen und Schriften in Karkamis.” In Ana $adî Labnªni l¥ allik. Beiträge zu altorientalischen und mittelmeerischen Kulturen (= Festschrift Wolfgang Röllig). AOAT 247, hrsg. von B. Pongratz-Leisten, H. Kühne

Karen Radner

169

und P. Xella, 381-395. Kevelaer: Butzon & Bercker und Neukirchen-Vluyn: Neukirchener Verlag. Streck, M. P. 1999. “Nebukadnedzar II. A. Historisch.” RLA 9/3-4:194-201. Tadmor, H. 1975. “Assyria and the West: The Ninth Century and its Aftermath.” In Unity and Diversity. Essays in the History, Literature, and Religion of the Ancient Near East, hrsg. von H. Goedicke und J. J. M. Roberts, 36-48. Baltimore und London: Johns Hopkins University Press. Tadmor, H. 1994. ´The Inscriptions of Tiglath-pileser III King of Assyria. Jerusalem: The Israel Academy of Sciences and Humanities. Veenhof, K. 1999. “Silver and Credit in Old Assyrian Trade.” In Trade and Finance in Ancient Mesopotamia, hrsg. von J. G. Dercksen, 55-83. Leiden und Istanbul: Nederlands Historisch-Archaeologisch Instituut te Istanbul. Wilhelm, G. 1993. “Sura/i in Kargamiš und das urartäische Gentiliz §urele.” SMEA 31:135-141. Winter, I. J.1983. “Carchemish ša kišad Puratti.” Anatolian Studies 33: 177-197. Zaccagnini, C. 1999-2001. “The Mina of Karkemiš and Other Minas.” State Archives of Assyria Bulletin 13:39-56.

MYCENAEAN KINGSHIP – A SPECULATIVE VIEW Günter Kopcke For Sinclair Hood When Plato, Laws V 73D-E, declares ‘love of self’ the greatest of evils the very emphasis of this pronouncement will attract attention.1 Will attract attention the more as all of Republic and Laws seem conceived to combat this evil, as his edifice of state is predicated on denying ‘love of self’ any influence. A fault of such presumed magnitude is not ephemeral. Rather it is an age-old trait deeply embedded in the fabric of society. Plato makes a point of saying that this Greek fault affects “most men”, not all. He knows of exceptions, and so do we. Contrarians, social critics come to mind, like Hesiod and Solon. On the other side, the side of prevailing consensus that Plato fights, the extreme is Achilles, a figure consumed by self-love, with socially notably disastrous consequences. In fact, Achilles behavior is so emblematic of the self-centredness of the hero in general, and the hero’s selfcentredness in turn so much a reflection of innate traits in the poet’s audiences – for what else would make them want to listen? - that we may well be led to think that all along, since the earliest days of Mycenae, self-centredness meant viscerally felt reality.2 Politically, though, there is an expected reaction which later Solon and others like him were called to mediate: insurrection, stasis, “the privilege of the free.”3 Throughout the sixth century, nearly everywhere there is stasis or the threat of stasis, regularly in connection with tyrants whose power-drive was echoed and contested by other individuals, clans, segments of the populace. What happened in the sixth century was by no means unique, only better recorded. I presume that some, perhaps all of the colonizing movement arose from threats of stasis, letting-go of people being a way of getting rid of hungry mouths and even more dangerously, hungry ambitions.4 Sometimes archaeology affords a clue. When suddenly, after the middle of the eighth century, in Athens the fashion of monumental tomb-markers is discontinued and one of smaller, cheaper, but also more adventurously decorated vessels sets in, we know with near certainty that something happened to dispossess the former elite and empower other, lesser

1

2 3 4

“There is an evil, great above all others, which most men have implanted in their souls, and which each one of them excuses in himself and makes no effort to avoid. It is the evil indicated in the saying that every man is by nature a lover of self, and that it is right that he should be such. But the truth is that the cause of all transgressions in every case lies in the person’s excessive love of self. For the lover is blind in his view of the object loved, so that he is a bad judge of things just and good and noble …”. Loeb Classical Library, Plato XI, The Laws II. Translated by R. G. Bury. Cambridge, Mass. Knox 1964, 28-61. Finley 1986, 6. Not so Starr 1977, 43-44.

Günter Kopcke

171

people. What else but violence could have produced such a change?5 May we assume that Bronze Age Greece was susceptible to similar events? In Bronze Age Greece we know we have kingship, more precisely the rule of a leader, the ‘wanax’, if not everywhere in this naturally split-up region, but frequently for sure.6 Prestigiously housed in his palace he was the master, regional wealth his to dispose of. The rule of law we know did not exist. Custom, prudence imposed barriers, but barriers probably light enough to breach, given the will to do so. A restraining, regulating factor could have been religion, and probably was. But again, what kind of protection was extended to whom, for what duration, is anybody’s guess. More likely than not, though, in this respect as well, Greek practice may have veered to the anarchic, favoring crude autocracy, permitting the ruler to deal as he saw fit. The king was not as in the East the one chosen by the gods to look after his people. There are no temples to speak of, and we are sure that there was no priesthood safekeeping sacred ordinances. If in Greece at the time anything like it was ever contemplated it had to have been so new, so little rooted in tradition, that one can only wonder about the effects it might have had. In fact, there is something fearsome and ominous about the way one human plenipotentiary stands out with little or nothing by way of balancing forces besides.7 The following is written in the assumption that a simple dialectic underlay Greek political development before, during and after the Dark Age: the over-reaching of individuals or minorities, and majority resistance.8 As will be suggested, the hallmark of Mycenaean kingship, the consequence of the conquest of Crete, may have been that it entailed quite unreflected claims to un-circumscribed powers.9 While surely over time, and perhaps from the beginning, there were modifications, the principle applies. The results were unsupportable, which seems to be the best explanation why the experiment failed and was never repeated. Material signs of failure are taken up in the next few pages. Mycenaean Greece starts out with the Shaftgraves (16th century), and the Shaftgraves are culturally to be equated with the Middle Bronze Age on the Greek mainland, a period lasting some 400 years, of egregious insignificance. The Shaftgraves, looked at critically, merely confirm the impression of a culturally very undeveloped state of affairs. All major objects found there which natives had 5

6

7 8

9

Though keeping in mind that “one problem with the archaeological evidence is that it is better suited to showing the results of structural change than its workings or causes.” I. Morris 1987, 201. Deger – Jalkotzy 1995. I must leave it to others to draw conclusions from what archival records are telling us about the wanax: Palaima 1995. Administrative records say nothing about modes of conduct, or do they? Negative aspects of Mycenaean kingship have been stressed by Deger-Jalkotzy 1996 and S. Sherratt 2001. This is common knowledge. Mutatis mutandis the tension so fascinatingly discussed by Wallace, Raaflaub, Ober and Eder in Democracy 2500?, edited by I. Morris and K. Raaflaub. Archaeological Institute of America, Colloquia and Conference Papers no. 2, 1997. Dubuque, Iowa. Keeping in mind O’Connor’s simple but important observation that “every form of kingship has a unique shape and character, derived from the specific culture that generated it.” O’Connor 1995, 269.

172

Mycenaean Kingship

made on their own were big and aesthetically unsuccessful, we know so because we know the models, Cretan models of course. These people, though huge in ambition, by prevailing standards of the time cannot possibly be called civilized. This drawback may have helped in their attack on Crete, while Crete rather suffered from the opposite affliction, being culturally too finely grained, to the extent that an attack on the center could have precipitated the collapse of the whole.10 This attack happened about three to four generations after the last of the Shaftgraves had been closed. Another reason for their success was that the Thera volcano had erupted, leaving Crete weakened.11 Nevertheless, Crete had remained capable and wealthy, a state much like Venice at the height of its power. The results of the conquest were enrichment and, I believe, hugely boosted ambitions. Some violent selecting – ‘survival of the fittest’ - among mainland leaders, we know, followed.12 In the immediate vicinity of Mycenae the single survivor made himself ‘king’, using the former ruler in Knossos and others in the Near East as models. Some even think he was officially welcomed and recognized by the Egyptian court of Thutmosis III. by sending gifts.13 All in all, and in objective terms, what we are witnessing was a rise from ‘rags to riches’, or popularly speaking, egotrips of the first order. An apt comparison is to someone hitting the jackpot and not knowing what to do with his riches, thinking himself the equal to old wealth. He tries to do as they do. At Mycenae he aspires to being king. The fact that we suddenly are seeing palaces and signs of a palatial administration means little, as we don’t know how effective it all was. Beyond the palaces there was very little spread of prosperity and raised standards of living. The mainland did not acquire towns, or anything like the impressive middle-class residences typical of Crete. Instead, when the walls went up in Mycenae in the 13th century formal burials on the outside nearly disappeared.14 Also in the 13th century, at the height of Mycenaean power, in the eastern district of Messenia, the palace is architecturally impressive, but it may have been the only piece of architecture worthy of that name in the entire kingdom.15 Judging by the remains the ruler may have been the lord and master of depressed peons. I propose that Middle Bronze Age society on the mainland had been fairly egalitarian. Outstanding talent in war was important, leaders were acclaimed, with many perks and rewards. The leader, though, I think remained beholden to his community. No matter how extravagantly conspicuous at times his holdings and presence, the powers he held remained powers allotted, controlled by unwritten laws, subject to consensus. With the conquest of Crete this changed. The same leaders were not rewarded, but rewarded themselves for their prowess. No peer

10 11 12 13 14 15

Soles 1999, 62. Driessen and McDonald 1997. Wright 1995. Helck 1979, 97. Cline 1998. Alden 1981. Compare the poor remains of Nichoria, called ‘a major town’: Shelmerdine 1981. The question of towns in Greece (rather lack thereof) taken up by Donlan and Thomas 1993, Sakellariou 1996, Darcque 1996, Small 1999.

Günter Kopcke

173

consensus was blocking the way to total gratification. This is how Greece almost over night became socially deeply divided. What changed was physically felt, for after the booty ran out subjects had to pay the costs of new prestige and royal pretensions. Let us assume that the majority were vigorous, poor but free people. They saw longstanding traditions flouted. Poverty suddenly was a blemish, disqualifying in ways it had not done before. What else should we expect but opposition? I don’t think the silent majority was silent. It is here that so far scholarship has failed. On account of an outwardly poor showing the people at large have been neglected. Poor information is being mistaken for complacency. The dimension of the Mycenaean, and that is the general Greek, political dilemma has not been realized, the dilemma being the ruthless exercise of power. We know what it means and how it was justified, for much later Thucydides explicitly tells us so.16 Athens misbehaved, but the problem of course is there from the beginning. On the Mycenaean side, there is perhaps one piece of evidence to insinuate the mass’s reaction: Mycenaean ceramics. The arts inside and outside of the palaces differ, and differ radically. It is prestige vs. genuinely native tradition. The palaces in this respect chose not to move one step beyond Crete. All we have to do is look at the relief of the Lion Gate, a Cretan pastiche of the 13th century, so inauthentic that at least one scholar thinks it a Cretan original, an heirloom reused.17 Either way it does not speak for the creativity of palaces that they should have been dependent on things and styles not their own. Visually, the non-native doctrine of rulership is nowhere more apparent than here. Ceramics, by contrast, were left to the unprivileged, the underlings, and they performed outstandingly. The potters and their clients made sure that one day there would be a Parthenon Frieze. This is not said for effect, but is demonstrably true. Mycenaean ceramics develop along lines unconditionally native, though supported only by modest means, causing the character and quality of the design to be overlooked.18 The rift between palace and ‘mass’ is clear, so clear that even internal dissent and opposition begin to seem like a logical conclusion. I hope that in the future the phenomenon will attract the attention it deserves. For all the admiration of things Cretan, the palaces were neither able nor willing to maintain Cretan standards. I am referring here to material of the later 14th and of the 13th centuries as one should, not to material of around 1400 or earlier, when Cretan craftsmen were still around and Cretan craftsmen available. Some of the greatest Cretan achievements in metalwork and glyptics simply were dropped. Looking over this purged and considerably impoverished Mycenaean artistic landscape it eludes me how anyone can think of elite Mycenaeans as connoisseurs, interested in art; prestige-conscious – yes, art-conscious – hardly.19 In high-class art a finished Mycenaean style does not exist. This is still the constituency of the Shaftgraves, only somewhat better informed. What this implies for us and for this 16 17 18 19

In the Melian Dialogue (Thuc. V, 58-111). Pouncey 1980, 231 n. 22. Younger 1997, 231 n. 22 (reference kindly provided by John Younger). Author 2001. Sherratt refers to “the frescoes surprising uniformity” (Sherratt 2001, 230). I would say they are dully repetitive, and more often than not not very well executed.

174

Mycenaean Kingship

Conference is a probable lack or a slack in Mycenaean added-value marketable goods. Mycenaeans were not luxury exporters in the same sense Cretans were, under no circumstances.20 In the Near East this is the time of the 18th and 19th Dynasties – “Egypt led the world in arts and manners”21 - possibly the high-mark of all times in luxury expectations. Mycenaeans neither competed, nor paid attention. What about exports? We know of vases, but we don’t know who the shippers were. Who was shipping Sardinian copper, or who at least funneled knowledge of ingots to the far West? Later on, Phoenicians, not Greeks, first claimed the island. Who was there before the Phoenicians? This is just one possible indicator that in East – West traffic people from the East may have been active, more so than Greeks.22 All signs for travels we have for Crete are missing from the Mycenaean record: no well attested fleet, no safe ports along the way, no luxury production (as mentioned), no marks of admiring reception in the Levant, among top-flight clients.23 Surplus in bulk there was, in wool or oil. Findings do not encourage one to think of palaces cultivating shipping, and mainland merchant princes positively are out of the question. Non-elite shippers? Perhaps. But if they existed (as I think they did), why are we not seeing the fruits of their ventures - homes and comfort? What really is telling, though, is the following. Except perhaps for one oddity which I will mention, there are hardly any signs of creative reaction on the mainland to eastern stimuli. Not even in ceramics, where one might think demonstrable exports might and should have produced a response. By contrast, take the early first millennium when Greece was steeped in eastern ideas. A recent monograph on the famed so-called International Style in the Near East does not even undertake to discuss Greece.24 Mycenae, so affluent, so well connected, and as we are hearing an international player, does not, or cannot respond. To be brief: I think that the Cretan success notwithstanding, Mycenaeans remained Middle Bronze Age peasants, the way they were before setting out for the island. They devastated urban Crete at least partly from ignorance. By Near Eastern and Cretan standards, they were too backward to accept the challenge. There was enough satisfaction in ‘cultivating their own garden.’ Among leaders, the prime national product, poetry, surely flourished. This brings us to the question of how the evidence collected by Professor West in his fundamental book The East Face of Helicon should affect this argument.25 Perhaps verbal communication made an impression even then, or it too arrived later. - Now briefly for the kind of odd import imaginable in this climate of otherwise provincial seclusion. A major extension of the walls in Mycenae in the 13th century contains among other similarly magico-religious features a tight assemblage of temples – religious buildings, unique to the mainland, the well-published Cult Center of Mycenae.26 This is a most strange arrangement, 20 21 22 23 24

The seminal paper for this discussion is Sherratt and Sherratt 1991. Hood 1984, 33. Sherratt 1991, 195. Ead., 1999. Hirschfeld 1996. Niemeier 1995a, b. Feldman 2002. I owe this reference to Sarah Morris. Actually, the International Style has left some traces, for the most part looking like very distant echoes. 25 West 1997. 26 Mylonas 1972.

Günter Kopcke

175

to which perhaps the famous residences of gods in the Oberstadt of Hattusha – Boghazkoey served as a model.27 Other links to Hattusha do exist.28 The extension to the citadel was built to accommodate at least three major designs of a sacral character - why, but to lend spiritual legitimacy to a shaky hold on power (rule by force).29 Here for once talk about Sacral Kingship in Greece makes sense. The message undoubtedly came from the Near East.30 Needless to say, the brainchild, for such it was, did not reach popular imagination. It passed away quickly, only two generations later, along with the rest of the fortress. The way the merchant in the epics is explicitly demeaned is indicative: the mentality of princes made Mycenaean Greece be backward, or non-polemically speaking, be different. The laborer of whatever kind was shunted, anyone earning, not taking his sustenance. Instead of making a point of compensating for poor resources by enterprise and industry as Crete had done, resources were being strained, and in the end probably exhausted.31 Is it far-fetched to believe that the problem was a well-known Greek characteristic, exploitative overreaching? What allowed kingship to flourish carried over into the next generations in other guises, but essentially unchanged. This is what I think Plato meant by disapprovingly referring to ‘love of self’. The leaders that conceived the wild idea of Athens as ‘tyrant’ (Thuc. II.53.2), naturally over all of Greece, were as overbearing as former kings, but making the entire community join. In a climate welcoming audacity Pericles framed his plans that for all the good reasons given publicly still amounted to brinkmanship or gambling. Such was the drive that in former days had produced the takeover of Crete. Athens showed the daring of another age, remarked upon, but of course not understood in these terms, by the Corinthians in their speech arguing for war (Thuc. I.70.1-4). How else to explain this extreme behavior but that first the trauma, then the heady experience of delivery from the Persian threat invited, increased the lust of risk. I wonder whether in intent – domination - there was, or should be for us as onlookers, any difference between the great 13th century extension of the walls of Mycenae and the Parthenon. Autocratic rule stated forthrightly, or brutally, what democratic leaders had to carefully package in order to make sure that all citizens to the last would follow. - The Greek problem of ‘just measure’ only makes sense if ‘just measure’ does not exist, but has to be found. In the Bronze Age, the Dark Age, and later, in Athens down to 27 Neve 1999. For individual plans Canaanite affinities have been claimed (Negbi 1988) and doubted (Albers 1996. Whittaker 1996). - Another interesting case with foreign implications is the Potnia Aswiya in Pylos, advocated by S. Morris (Morris 2001). 28 Schwandner 1991, 216-223. 29 An example of “routinization of charisma” leading to “charismatic elements in depersonalized form”, “a source of legitimate authority for the successors of the charismatic hero.” Weber 1978. Volume 2, 1046-7. 30 In the Near East, for instance: Oppenheim 1964, 98-104. Bottéro 1992, 224. 31 What one might term the ‘continental outlook’ perhaps shows in the fact that answers were sought in attempts at meliorating land, on a gigantic scale practiced in the Kopais plain (Knauss 1987). The question is how workers were found, what their feelings were, whether corvee meant the same in Greece as elsewhere, and whether any benefits accrued to non-elite people.

176

Mycenaean Kingship

the end of the fifth century, the problem was virulent, due to inbuilt human iniquity. I like to believe that under the kings (anaktes) society was exceedingly polarized, due to abuse of power. With the fall of autocratic rule the people, the ‘mass’, automatically broke free; from then on no longer numbers easily subdued, but counting. Leaders were needed; willing followers as well. All Greek ages were Ages of Experiment,32 the Bronze Age not being an exception. In that case the experiment was kingship, which failed. As old patterns of dominance were opportunistically up-dated and precariously upheld, chances for new things to take root, for foreign ideas to penetrate, were becoming ever more limited. Need for foreign goods may have been another matter, but even those seem in short supply, indicating the progress of insulation. If this was the negative result of incompetent management there was a positive result as well. Challenged, the non-privileged ‘mass’ produced its own leaders and probably gained in cohesion in resisting. Nowhere is the result more evident than in the way in which eventually the past was put to use. The ‘mass’ always had looked up to its leaders, seeking guidance. The wayward wanax lost his realm, but in collective reflection as hero retained his leader-prestige. Abstract Mycenaean Kingship – a Speculative View In the history of the central Mediterranean, Mycenaean kingship (ca 1400 – 1200 BCE) is just one episode in a string of many, though distinguished by legend and impressive remains, therefore treated with reverence and scarcely ever critically examined. Acquired late and by stealth, that is the sudden conquest of Crete, Mycenaean kingship never attained to the kind of legitimacy that Near Eastern rulers enjoyed. A rude beginning presaged the end, total disappearance, except for lore in song. - Limitations and prevailing interests will be examined in the planning of palaces; in attempts to insure dynastic rule; in impressive but perhaps desperate measures to increase productivity; in art; trade; and in the likely treatment of subjects, who as their vases show remarkably kept to a cultural identity distinct from that of the elite. The village origins of the new princes can be made to explain an apparently indifferent attitude to shipping, trade, high-value production and any other benefits arising from outside communications. The only real brightness in this picture are the vases, products representative of a free, ‘middling’ population, showing remarkable promise in intelligence and taste. These are the people that should have been responsible for the kinds of borrowings adumbrated in M. L. West’s The East Face of Helicon, but it is not as easy as it would seem to make this case. The obvious disparity between rulers and ‘sub-elite’ (S. Sherratt), not least seen in the division in cultural expression, i.e. palace-style art vs. vases, 32 The allusion is to Snodgrass’ Archaic Greece, The Age of Experiment. London, Melbourne, Toronto 1980.

Günter Kopcke

177

leads to the surmise of social tension. Greeks being Greeks, Mycenaean Greece probably was visited by the same social strife as later, caused by misuse of power, “passionate self-esteem … no matter what crimes it led to” (Knox); Plato (Laws): the self-serving character, the ‘greatest evil’. None of the aspects available for scrutiny assure us that Mycenaean kingship was anything but the spoiled fruit of over-reaching. If any positive consequences resulted they were not intended. Greece retrenched, began again from the beginning, this time without the fatal overhead of ambition that the conquest of Crete had generated. Because lessons to be learned from later Greek history seem fully applicable (there being no need, for instance, for seriously hypothesizing anything like a functioning ‘divine kingship’ on the Near Eastern model), I suggest that mentality as verified later be used as a masterkey to unlocking the history of the second millennium.

178

Mycenaean Kingship

Bibliography Albers 1996 = Albers, G 1996. “Comparative Aspects of Regional Cult Structures of the Late Bronze and Early Iron Ages in the East Mediterranean (Aegean, Cyprus, Levant - Palestine).” In Atti e Memorie del Secondo Congresso Internazionale di Micenologia 1991, edited by E. De Miro, L. Godart and A. Sacconi, vol. 2, 647-661. Rome. Alden 1981 = Alden, M. J. 1981. Bronze Age Population Fluctuations in the Argolid from the Evidence of Mycenaean Tombs (Göteborg). Bottéro 1992 = Bottéro, J. 1992. Mesopotamia. Writing, Reasoning, and the Gods. Chicago and London. Cline 1998 = Cline, E. H. 1998. “Amenhotep III, the Aegean, and Anatolia.” In Amenhotep III. Perspectives an his Reign, edited by D. O'Connor and E. H. Cline, 236-250. Ann Arbor. Darcque 1996 = Darcque, P. 1996. “L’unité de la Grèce mycénienne.” In Secondo Congresso 1996, II, 709-713. Deger-Jalkotzy 1995 = Deger – Jalkotzy, S. 1995. “Mykenische Herrschaftsformen ohne Paläste und die griechische Polis.” In Politeia 1995, II, 267-377. Deger - Jalkotzy 1996 = Deger – Jalkotzy, S. 1996. “On the Negative Aspects of the Mycenaean Palace System.” In Secondo Congresso 1996, II, 715-728. Donlan and Thomas 1993 = Donlan, W. and Thomas, C. G. 1993. “The Village Community of Ancient Greece: Neolithic, Bronze and Dark Ages.” SMEA 31, 61-69. Driessen and Mac Donald 1997 = Driessen, J. and MacDonald, C. F. 1997. The Troubled Island. Aegaeum 17. Liège. Feldman 2002 = Feldman, M. H. 2002. “Redefining a Mediterranean “International Style,” 1400-1200 BCE.” Art Bulletin 84/1, 6-25. Finley 1986 = Finley, M. I. 1986. Ancient History (New York). Helck 1979 = Helck, W. 1979. Die Beziehungen Ägyptens und Vorderasiens zur Agäis bis ins 7. Jahrhundert v. Chr. Wissenschaftliche Buchgesellschaft, Erträge der Forschung Band 120. Darmstadt. Hirschfeld 1996 = Hirschfeld, N. 1996. “Cypriots in the Mycenaean Aegean. ” In Atti e Memorie delSecondo Congresso Internazionale di Micenologia 1991, edited by E. De Miro, L. Godart and A. Sacconi, vol. 1, 289-297. Rome. Hood 1984 = Hood, S. 1984. “A Minoan Empire in the Aegean in the 16th and 15th Centuries B.C.?” In The Minoan Thalassocracy. Myth and Reality. Proc. of the Third International Symposium at the Swedish Institute in Athens,1982. R. Hagg, N. Marinatos (edts.) (Stockholm 1984), 33-37. Knauss 1987 = Knauss, J. 1987. Die Melioration des Kopaisbeckens durch die Minyer im 2. Jt. v. Chr. (München). Knox 1964 = Knox, B. W. 1964. The Heroic Temper. Studies in Sophoclean Tragedy. Sather Classical Lectures 35 (Berkeley and Los Angeles). Kopcke 2001 = Kopcke, G. 2001. “Das schöne Gerät - eine Betrachtung Mykenischer Vasen.” In Zona Archaeologica. Festschrift für Hans Peter Isler zum 60. Geburtstag. Edited by S. Buzzi and others, 239-248. Bonn 2001. Morris 1987 = Morris, I. 1987. Burial and Ancient Society. The Rise of the Greek

Günter Kopcke

179

City State. Cambridge. Morris 2001 = Morris, S. 2001. “Potnia Aswiya: Anatolian Contributions to Greek Religion. ” In Potnia. Deities and Religion in the Aegean Bronze Age, edited by R. Laffineur and R. Hagg, 423-433. Aegaeum 22. Liège. Mylonas 1972 = Mylonas, G. E. 1972. The Cult Center of Mycenae (Athens 1972). Negbi 1988 = Negbi, O. 1988. “Levantine Elements in the Sacred Architecture of the Aegean.” BSA 83, 339-357. Neve 1999 = Neve, P. 1999. Die Oberstadt von Hattusa. Die Bauwerke: I, Das zentrale Tempelviertel (Berlin 1999). Niemeier 1995a = Niemeier, W. - D. 1995a. “Tel Kabri: Aegean Fresco Paintings in a Canaanite Palace.” In Recent Excavations in Israel. A View to the West. Edited by S. Gitin, 1-11. Archaeological Institute of America. Colloquia and Conference Papers, no. 1. Dubuque, Iowa. Niemeier 1995b = Niemeier, W. - D. 1995b. “Minoans and Hyksos: Aegean Frescoes in the Levant.” BulILICS 40, 258-260. O’Connor 1995 = O’Connor, D. B. 1995. “Beloved of Maat, the Horizon of Re: The Royal Palace in New Kingdom Egypt.” In Ancient Egyptian Kingship. D. O’Connor, D. P. Silverman (edts) (Leiden), 263-296. Oppenheim 1964 = Oppenheim, A. L. 1964. Ancient Mesopotamia. Portrait of a Dead Civilization. London. Palaima 1995 = Palaima, Th. G. 1995. “The Nature of the Mycenaean Wanax: Non-Indo-European Origins and Priestly Functions.” In The Role of the Ruler 1995, 119-138. Politeia 1995 = Politieia. Society and State in the Aegean Bronze Age. 2 vls. R. Laffineur, W. – D. Niemeier (edts). Aegaeum 12 (Liège). Pouncey 1980 = Pouncey, P. R. 1980. The Necessities of War. A Study of Thucydides Pessimism (New York). Renfrew 1985 = Renfrew, C. 1985. The Archaeology of Cult. The Sanctuary at Phylakopi (London). Sakellariou 1996 = Sakellariou, M. B. 1996. “Peut-on qualifier Pylos de “ville” ?” In Secondo Congresso 1996, II, 639-646. Schwandner 1991 = Schwandner, H. 1991. “Der Schnitt im Stein. Beobachtungen zum Gebrauch der Steinsäge in der Antike.” In Bautechnik der Antike. Internationales Koll. in Berlin 1990. A. Hoffmann and others (edts.) (Mainz am Rhein). Shelmerdine 1981 = Shelmerdine, C. W. 1981. “Nichoria in Context: A Major Town in the Pylos Kingdom, ” AJA 85: 319-325. Sherratt 1999 = Sherratt, S. 1991. “E pur si muove: Pots, Markets and Values in the Second Millennium Mediterranean.” In The Complex Past of Pottery. Production, Circulation and Consumption of Mycenaean and Greek Pottery. J. P. Crielaard and others (edts.) (Amsterdam), 163-211. Sherratt 2001 = Sherratt, S. 2001 “Potemkin Palaces and Route-Based Economies.” In Economy and Politics 2001, 214-238. Sherratt and Sherratt 1991 = Sherratt, A. and S. 1991. “From Luxuries to Commodities: The Nature of Mediterranean Bronze Age Trading Systems.” In

180

Mycenaean Kingship

Bronze Age Trade in the Mediterranean. Papers Presented at the Conference Held at Rewley House Oxford. Small 1999 = Small, D. B. 1999. “Mycenaean Polities: States or Estates ? ” In Rethinking Mycenaean. Soles 1999 = Soles, J. 1999. “The Collapse of Minoan Civilization: The Evidence of the Broken Ashlar. ” In Polemos. Le contexte guerrier en Egée a 1 ’âge du bronze, edited by R. Lafneur, vol. 1, 57-62. Aegaeum 19. Liège. Starr 1977 = Starr, C. G. 1977. Economic and Social Growth of Early Greece, 800 - 500 B. C. New York. Weber 1978 = Weber, M. 1978. Economy and Society. 2 volumes. Edited by G. Roth and C. Wittich. Berkeley, Los Angeles, London. West 1997 = West, M. L. 1997. The East Face of Helicon. West Asiatic Elements in Greek Poetry and Myth. Oxford. Whittaker 1996 = Whittaker, H. 1996. “Mycenaean Sacred and Domestic Architecture.” In Atti e Memorie del Secondo Congresso Internazionale di Micenologia 1991, edited by E. De Miro, L. Godart and A. Sacconi, vol.3, 1627-1635. Rome. Wright 1995 = Wright, J. C. 1995. “From Chief to King in Mycenaean Society.” In: The Role of the Ruler 1995, 63-75. Younger 1997 = Younger, J. 1997. “The Stelai of Mycenae Grave Circles A and B.” In Techne. Craftsmen, Craftswomen and Craftsmanship in the Aegean Bronze Age. Edited by R. Laffineur and P. P. Betancourt. 229-234. Aegaeum 16. Liège.

IV. GRIECHISCHE ARCHAIK/GREEK ARCHAIK

TRADE AND COMMERCE IN ARCHILOCHOS, SAPPHO, AND ALKAIOS1 David Tandy

!

Krh\j genea\n Bro/taxoj Gortu/nioj e)nqa/de kei=mai ou) kata\ tou=t ) e)lqw/n, a)lla\ kat ) e)mpori/an.

Here I lie a Cretan by race, Brotachos of Gortyn; I didn't come for this, but for trading (Simonides 138 Diehl). There are many kinds of evidence for archaic Greek trade and commerce. This paper is about the written evidence found in Archilochos, Sappho, and Alkaios. The early lyric poets have tended to be overlooked; Lin Foxhall on consumption is an admirable, recent exception (Foxhall 1998). Identifying production location archaeologically is important, but we have ignored often accidental evidence that may help us better understand the formations and institutions within which goods moved, and also help us perceive the nature of economic development and the political economies of the archaic Aegean. Archilochos, Sappho, and Alkaios individually but especially collectively bring light to the nature of archaic Greek trade, as well as to the role of trade in local economic development in the seventh and sixth centuries. The eighth century saw an enormous increase in population density on the mainland of Greece. This contributed to the need for expansions to the west and carried over into the seventh century, where we can see clear indications of redirection to the northern Aegean and into the Black Sea. In the late seventh century we see new action at Kyrene, at Naukratis, at Sigeion. The Parian effort that Archilochos participated in to colonize and exploit Thasos and its peraia can be defined as partly an imitation of earlier western efforts of larger, non-island poleis, and partly a competitive move against eastern neighbors (Miletos, Samos). One heuristic tool here is to look at the broad phenomenon of outward movement as to some extent a product of extra-man management and management policy. Let us look at a taxonomy of extra men (figure 1). Wherever they are, A-men, because they are in (often called agathoi), always have a share in the incremental advantage that comes to the town, controlled by those who are in, from the fields.2 If they stay home I propose that we call them A1; if they leave they would be A2. Wherever they are, B-men, who are out (often called the kakoi), do not share in the town increment. B1 seems an uneconomic but perhaps frequent arrangement, but exceptionally unattractive when avoidable, since the economic 1

2

I wish to thank Drs. Rollinger and Ulf for inviting me to participate in the MELAMMU conference in Innsbruck. The spirited discussion that followed the papers on Archaic Greece was very helpful and I am especially grateful for suggestions from Walter Burkert, Walter Donlan, and Kurt Raaflaub. This paper is a small portion of a longer project, an economic history of the Archaic Period. Archilochos is cited from West 1989, Sappho and Alkaios from Lobel and Page 1955 with several supplements from Voigt 1971. On the increment that comes to the town, see Tandy 2001.

David Tandy

184

formation of the polis within which production is undertaken presumably does not allow the B1-man to himself share in the domestic increment through full polis membership. This fact would lead, routinely I believe, to a conversion of certain members of affected families into B2-men, as I hope this paper will show. IN

A1 stay home A2 go away (to fight, to trade) OUT B1 stay home B2 go away (to fight, to trade) Figure 1. A taxonomy of extra men

Archilochos We are able to situate Archilochos into two places of the taxonomy, A2 early in his career and (with less certainty: see below) B2 later on. Testimonia indicate that Archilochos of Paros went to Thasos to help support a settlement there that had been founded by his father Telesikles, probably in about 680 (cf. Steph. Byz., s.v. Qa/soj); the archaeological material is in keeping with this date. Archilochos joined the Parians on Thasos perhaps between 660 and 650. We are told that he left Paros for Thasos because of poverty and desperation (dia\ peni/an kai\ a)pori/an), a sure sign that he was an extra man and needed to shift from A1 to A2. Further testimony narrates that he outstayed his welcome at Thasos, as well, thus moving from A2 to B2 (295 = Kritias 88 B 44 Diels-Kranz). At any rate, in his Thasos phase Archilochos serves the polis of Paros as citizen, polites, and as soldier, hoplites. What does he reveal about commerce and trade? It is clear that he is familiar with moving freight between Thasos and its peraia and Paros, which we see in fragment 93a: ! ! ! ! ! !!!!!!!!!!!!!!pa/ij Peisistra/tou !

!

a)/ndraj . . .wleu=ntaj au)lo\n kai\ lu/rhn a)nh/gagen e)j Qa/son kusi\ Qre/icin dw=r ) e/)xwn a)kh/raton xruso/n, oi)kei/wi de\ ke/rdei cu/n ) e)poi/hsan kaka/.! !

The son of Peisistratos brought these men (who enjoyed) the pipe and the lyre back to Thasos, bearing gifts for the Thracian dogs, pure gold, and they made public harm with their private gain (93a.4-7). He can refer in passing to a cargo (f[o]rti/wn de/ moi me/[l]ei, “I am concerned about the cargo” 24.8). Archilochos is certainly familiar with sailing and with reading the weather. We see the former clearly: a)ll ) a)/ge su\n kw/qwni qoh=j dia\ se/lmata nho\j foi/ta kai\ koi/lwn pw/mat ) a)/felke ka/dwn, a/)grei d ) oi)=non e)ruqro\n a)po\ trugo/j! ou)de\ ga\r h(mei=j nhfe/men e)n fulakh=i th=ide dunhso/meqa.

!!!!

Come on and make the rounds with the cup along the benches of the swift ship and draw out some gulps from the hollow casks and

Trade and Commerce

185

seize the red wine from the lees. You know that we will not be able to stay sober on this watch (4.6-9). And he seems to speak of the weather at sea with ease: Glau=x ,) o(/ra! baqu\j ga\r h)/dh ku/masin tara/ssetai po/ntoj, a)mfi\ d ) a)/kra Gure/wn o)rqo\n i(/statai ne/foj sh=ma xeimw=noj, kixa/nei d ) a)elpti/hj fo/boj.

Look, Glaukos: the deep sea is being stirred up by the waves, and a cloud stands straight up around the heights of Gyrai, the sign of a storm. It is from the unexpected that fear comes (105). ]ntai nh=ej e)n po/ntwi qoai/ p]ollo\n d )i(sti/wn u(fw/meqa lu/san]tej o(/pla nho/j! ou)ri/hn d ) e)/xe ]rouj, o)/fra seo memnew/meqa ]a)/pisxe, mhde\ tou=ton e)mba/lhij ]n i(/statai kukw/menon ]xhj! a)lla\ su\ promh/qesai ]umoj Swift ships on the sea. . . Let’s loosen the ship's sheets and lower most of the sails. Pray keep the wind fair, so that we will remember you. . . keep it off, and don't throw this [storm at us]. . . [the] swollen [wave] stands before us. But do be mindful of us (106). Even if these are metaphors for political difficulties, Archilochos cannot use sailing language without knowledge of it. He knows about shipwrecks (8, 12, 13) and that there are fifty oars on a big boat (192). He unequivocally decries his life on the sea (e)/a Pa/ron kai\ su=ka kei=na kai\ qala/ssion bi/on, “Let Paros be, and those figs and the life of the sea” 116), and he does it so unequivocally that we should be tempted to reread his e)n dori/ couplet as a declaration of his dependence not on his spear so much as on his boat: e)n dori\ me/n moi ma=za memagme/nh, e)n dori\ d ) oi)=noj I)smariko/j! pi/nw d ) e)n dori\ keklime/noj.

The usual rendering of this couplet is On my spear depends my kneaded bread, and on my spear depends my Ismaric wine; I drink it leaning on my spear. But does it not seem just as likely that dori/ means “boat”? On my boat depends my kneaded bread, and on my boat depends my Ismaric wine; I drink it reclining on my boat (2). I am certain that if editors regularly printed the e)n dori/!couplet next to fr. 116 instead right after fr. 1, in which he refers to himself as soldier and poet, we would start thinking of the dori/ as a boat sooner than a spear.3 One last observation about Archilochos in the north. Let us return to fr. 93a, in which the son of Peisistratos has brought gold to buy off Thracians, and the 3

do/ru nh/ion means a ship’s plank in Homer (e.g., Il. 15.410, 17.744; Od. 9.384, 498; also HH3.403); do/ru by itself means ship as early as Aeschylus (Pers. 411, Aga. 1618). This was proposed and later argued by J.A. Davison (1954: 1960).

186

David Tandy

result has proven negative, for the son of Peisistratos has created public harm for the sake of private gain. I read this as a comment by an A2-man observing the actions of B2-men. It is also an epiphany of the conflict between the demos and polis on one side and aristocratic households (oikoi) on the other. After Archilochos wore out his welcome in the north, his own subsequent B2 career may have taken him south. Herodotos and Near Eastern sources indicate that in the mid-seventh century Ionians and Karians were in Egypt in support of Pharaoh Psamatik (Herodotus 2.66.12-67.2; Haider 1988, 153-84), and now we may be finding their seventh-century barracks at Tell Defenneh, east of Naukratis (Möller 2000, 34-5).4 Among these Ionians we might surmise Archilochos's presence, for he knows about mercenaries in a remark to his friend Glaucus: Glau=k',) e)pi/kouroj a)nh\r to/sson fi/loj e)/ske ma/xhtai.

Glaukos, a mercenary man is a friend only as long as he is fighting (15). And he reveals knowledge of Karian mercenaries as well: kai\ dh\ ) pi/kouroj w(/ste Ka\r keklh/somai. !

Indeed, I will be called a mercenary, like a Karian (216). So we can venture the guess that he himself was a mercenary, an e)pi/kouroj,5 at this point. Archilochos died fighting as an A1- or A2-man in a land-battle against the Naxians.6 A review of Archilochos’s geographical knowledge should tell us something about his movements. He makes clear a knowledge of Aiolis (Lesbos (98.11, 121.1), Imbros (142.3)), Ionia (Miletos (192), Priene (43.2)) and further inland there (Magnesia (20.1), Lydia (19.1)) and south (Karia (216.1). He is familiar with many islands (Mykonos 1224a.1), hated Naxos (89.7), Karpathos (248), Tenos (105.2), Gortyn on Crete (24.2)), and from his days at Thasos he is familiar with the north Aegean coast from Torone (89.20) in the west over to Stryme and Maroneia (6) in the east and over to Phrygia (42.2), too. One fragment alone (89) weaves together Naxians, Paros, Thasos, and Torone. If fr. 79a is Archilochos’s and not Hipponax's, his knowledge of Salmydessos inside the Black Sea may be 4 5

6

On the various ways to see how scholars have gone about dating Archilochos as well as the Ionian/Karian e)pikouri/a, see Lavelle forthcoming. There are two questions that arise here. First, were e)pi/kouroi necessarily mercenaries? Second, how certain can we be that Archilochos was an e)pi/kouroj for Pharaoh? e)pi/kouroi in Homer are not mercenaries, but it is clear that by the mid-seventh century the outsider Ionians and Karians who helped Pharaoh were exchanging the uncertainties of border-skirmish fighting for the more predictable (and presumably more lucrative) service in Egypt (Lavelle 1997, esp. 258-61). As for the second question, whether Archilochos was in their number, we cannot be sure, for it may be a character/persona speaking fr. 216, in which case it is not literally Archilochos who is out fighting for Pharaoh. But it means that the audience understands that men are doing in real life what Archilochos’s verse articulates. I think it makes sense, for the broader inquiry into who is doing what and when, to pursue this as Archilochos ipse, but it really doesn’t matter. Herakleides Lembos 8 (F.H.G. 2.214); Plutarch Sera Num. Vind. 17 p. 560e; Dio Chrysostom, Orationes 33.12.

Trade and Commerce

187

derived from his mingling with Milesians or other Ionians in Egypt, and his references to Syracuse (293) and the Siris river (22.2) in southern Italy may be similarly explained (Siris was founded by Colophonians: Malkin 1998, 30). But it may also be the case that Archilochos traveled to many of these places e)n dori/. What we see so far is that Archilochos served the state's interest when in the north by playing polites/hoplites, bringing goods home and supplying protection for production and extraction and taking extra stuff from the Parian foothold in Thasos. If we may surmise that up to 5% of Parian total product was generated abroad (as opposed to the impossibly low 1-2% that is usually rolled out for preindustrial trading states (e.g., Cartledge 1983, 11), we can assert that Archilochos and those with him in the north were important to the building of economic security for (type A) Parians at home. Now if Archilochos spent time, later, in Egypt before returning home, we may speak of him as abetting the interests, including the trading interests, of Pharaoh, not to mention that he is not making any contribution to the Parian polis increment by producing goods for market at home. In short, Archilochos when in the south does not compete directly with Parian interests as others did in the north (93a), but his service to Pharaoh may impinge negatively on the success abroad of Parian representatives, while his absence from home must reduce the amount of Parian domestic product. Thus as a B2-man, Archilochos works in two ways against the economic best interests of his polis. This is a good indication of how precarious archaic local economic development was.

Sappho Sappho knows about sailing: ]e, ga/noj de\ kai..[ t]u/xai su\n e)/slai ].enoj kre/thsai ]aj melai/naj

]e/loisi nau=tai ] mega/laij a)h/tai[j ]a ka)pi\ xe/rsw ]moqen ple/oi. [ ]deta fo/rti ) ei)k[ ]natim ) e)pei\ k. [ ]re/onti po/ll.. [ ]aide/ka[

David Tandy

188 ]ei

]in e)/rga ] xe/rsw [ The surface of the sea...with good fortune...to repair the black [ships?]...Sailors...with great windblasts toward the land. They are sailing...cargo...chores...toward the land (20.2-21). The Parian Marble (ep. 36) indicates that she spent time in exile in Sicily, during which time her husband might be characterized as at least a passive B2-man through his absence from Mytilene. But we don't know what he was doing when abroad (although the Suda (s.v. Sapfw/) says he was a trader based in Andros: o(rmwme/nwi a)po\ )/Androu). Sappho’s geographical knowledge is not particularly extensive. No actual traveling is needed to explain her references to Troy, to Cyprus, to Kythera. She appears to have some sort of potentially lucrative relationship with people in power in Lydia, to whom her young girls go. She mentions Phokaia (101.3), just south of Lesbos in Aiolis. Her reference to Panormos (35) is unlikely to be to Sicilian Palermo (Panormos is an extremely common toponym, “safe haven for all”), but her mention of Cape Geraistos (96), an excellent and important harbor at the south end of Euboia, a regular first landfall near the mainland for those traveling from the east, may reveal her savviness about moving around the Aegean. Most of all Sappho supplies us with her brother Charaxos, who is apparently on the sealanes carrying wine from Mytilene to Naukratis,7 and presumably carrying something back out from Naukratis to somewhere else. Astrid Möller compares Charaxos to Plato, who sold olive oil that he brought to Egypt to finance his sojourn there. This does not strike me as a good comparison. Möller rejects Caraxos's status as a trader, insisting that he is a traveler or adventurer instead (Möller 2000, 55, 86, 212-13). Herodotos testifies that Mytilenians were present at Naukratis early and contributed to the building of the Hellenion there (2.178); we have inscriptions made by Mytilenians discussed at length by Möller, among which we may have a dedication from Nearchos to the Dioskouroi,8 the protector of sailors, to which we will have reason to return. Herodotos also tells us of Sappho’s brother's relationship with Rhodopis (1.135), whom Sappho herself calls Doricha: Ku/]pri ka[i/ s]e pi[krote/r]an e)peu/r[oi mh]de\ kauxa/s[a]ito to/d ) e)nne/[poisa D]wri/xa to\ deu/[t]eron w)j po/qe[nnon ei)j] e)/ron h)=lqe.

7 8

Herodotos 2.135; Strabo 17.1.33; Athenaios 13.596c-d; P. Oxy. 1800, fr. 1. Ne/arxo/j me ka/[qqeke to]i=j D[iosko/roij: “Nearchos de[dicated] me to the D[ioscuri].” See Möller 2000, 173.

Trade and Commerce

189

Kupris, and may she find you harsher (this time) and let not Doricha boast this, saying that on this second time she came to a longed-for love (15b.9-12). Sappho prays for his safe return by sea: Ku/pri kai\] Nhrh/idej a)bla/bh[n moi to\n kasi/]gnhton d[o/]te tui/d ) i/)kesqa[i kw)/ssa "]o?i? qu/mwi ke qe/lhi ge/nesqai pa/nta te]le/sqhn, o)/ssa de\ pr]o/sq ) a)/mbrote pa/nta lu=sa[i kai\ fi/lois]i "oi=si xa/ran ge/nesqai kw)ni/an e)/]xqroisi, ge/noito d ) a)/mmi m]hd ) ei)/j! ta\n kasig]nh/tan de\ qe/loi po/hsqai ]ti/maj, [o)n]i/an de\ lu/gran ]otoisi p[a/]roiq ) a)xeu/wn… Kupris and the Nereids, grant that my brother arrive here unhurt and that everything he desires be fulfilled, and that he pay for all the mistakes he made in the past and that he be a blessing to his friends and a pain for his enemies; and let no-one be a grief for us. Let him wish to bring honors to his sister and bitter pain . . . formerly grieving. . . (5.1-11). Given the at least one-time exile (kako/thj) of Sappho’s husband (however he handled it) and the clear presence of Mytilenians at Naukratis, I conclude that Charaxos is at sea as a B2-man at Naukratis kat )e)mpori/an, for trading. A review of Alkaios’s activities will make this clearer.

Alkaios Let me begin by referring to Alkaios’s role, as an A2-man, in the battle between Mytilene and Athens at Sigeion, near Troy, perhaps in the last decade of the seventh century. There we see him, a Mytilenian polites at Sigeion (428 = Hdt. 4.9495), parallel to Archilochos polites at Thasos. But he is most of the time if not all of the time out of power. The life of Antimenidas his brother seems parallel to Archilochos’s; Alkaios’s own life has important similarities, we just saw to Archilochos’s, but more pertinently, to Charaxos’s. Let us begin with his geographical knowledge. He refers to many unsurprising places: Hebros river at Ainos polis in Thrace (45), Kyzikos on the Propontis (440), Antandros opposite Lesbos (337), Teos just to the south (322). He seems to have some familiarity with Boiotia (325, 425). Fr. 388 mentions “shaking a Karian helmet-plume” (lo/fon te sei/wn Ka/rikon). This is in keeping with the tradition that Alkaios claims to have gone to Egypt (432 = Strabo 1.2.30), for it is not in Aiolis that Alkaios will encounter Karians but in Egypt. So I am willing to presume that Alkaios’s activities, at some time during the course of three

David Tandy

190

exiles, included going to Egypt and behaving like Charaxos. To call these men travelers and adventurers prevents us from seeing the economic roles they must have been playing through their presences abroad and their absences from home. Charaxos and Alkaios are B2-men and as such they are through their actions competing with their own and other states and individuals on the trading scene. What it means specifically for Mytilene, which has made Charaxos and Alkaios into B2-men, is that Mytilene’s ability to gain 1%, 2%, 5% of national product from trading abroad is diminished; Mytilene’s success abroad is compromised by her domestic policy. Also B2 is Antimenidas, Alkaios’s brother, who is said to have served the King of Babylon as e)pi/kouroj: h=)lqej e)k pera/twn ga=j e)lafanti/nan la/ban tw\ ci/feoj xrusode/tan e)/xwn. . . a)/eqlon me/gan, eu)ru/sao d ) e)k po/nwn kte/nnaij a)/ndra maxai/tan basilhi/wn pala/stan a)pulei/ponta mo/nan i)/an paxe/wn a)pu\ pe/mpwn. . . .

)Alkai=oj

You have returned from the ends of the earth with an ivory and gold-worked hilt of a sword (Alkaios says that his brother Antimenidas completed his mercenary service with the Babylonians)... a great achievement, and you rescued them from their travails by killing a fighter man who lacked only one palm’s breadth from five royal cubits (in height) (350). His brother is perhaps the source of Alkaios’s knowledge of Ashkelon (48), north of Gaza, destroyed by Nebuchadrezzar in 604. He is perhaps the source of Alkaios’s knowledge of Karian helmet-plumes, and almost certainly the reason Alkaios knows what a cubit is. Antimenidas may even have been an e)pi/kouroj for Pharaoh in the Ashkelon region until Egypt's withdrawal in 605 and then stayed on and joined up with Nebuchadrezzar. But he may also have served Babylon many years later; Alkaios’s knowledge of Ashkelon might then be explained by his own alleged trip to Egypt. Let us stay with Alkaios and his claim that he went to Egypt. It is possible to speak of Alkaios as the B2-man par excellence. Alkaios uses a lot of seafaring language in his poems, much of which is allegorical, of course. I repeat my remark about Archilochos, that one need knowledge of nautical language to use that diction metaphorically or allegorically. to\ lai=foj

the sail (33c.4) pa\n fo/rti[o]n…d ) o)/tti ma/lista…kai\ ku/mati pla/geis[a]…o)/mbrwi ma/xesqai…fai=s ) ou)de\n i)me/rrh[n. a)sa/mi] d” e)/rmati tuptom[e/na

Trade and Commerce

191

all the cargo. . . [the boat] says that she has no desire to be hit by a wave and to fight against the storm, struck by a hidden reef (73.1-6) po/nt[o]n ka/telke drag a ship down to sea (118.2) [a)]sfa/ltw asphalt (124.7) Finally, Alkaios’s perhaps best known verses are a nautical commentary on local political affairs: a)sune/thmmi tw\n a)ne/mwn sta/sin! to\ me\n ga\r e)/nqen ku=ma kuli/ndetai, to\ d ) e)/nqen, a)/mmej d ) o)\n to\ me/sson na=i forh/m<m>eqa su\n melai/nai xei/moni mo/xqentej mega/lwi ma/la! pe\r me\n ga\r a)/ntloj i)stope/dan e)/xei, lai=foj de\ pa\n za/dhlon h)/dh, kai\ la/kidej me/galai ka\t au)=to, xa/laisi d ) a)/gxurai, ta\ d ) o)h[/ ia……

I cannot read the lie of the winds. One wave rolls in from this side, another from that, and we are carried through the middle of it with our black ship, much distressed by the great storm. Bilge-water covers the mast-footing, and we can see through the entire sail now, and there are huge tears through it. The anchors are loosening, and the rudders…(326). This last fragment is now generally perceived as introductory to fr. 208 (and so printed in Campbell 1982, 320-22), which follows and will serve as my last point: toi po/dej a)mfo/teroi me/no[isi e)n bimbli/dessi! tou=to/ me kai\ s[a/on mo/non! ta\ d ) a)/xmat ) e)kpep[.].a/xmena ]men [.]rhnt ) e)/perqa. tw\n[! Both feet remain in the ropes; this alone keeps me safe. The cargo is carried overhead. . .(208.ii.5-8). I begin with a)/xmata, which is derived from a)/gw, and therefore clearly a synonym for forti/a (fo/rtia in Aiolic) and other terms for cargo. But it made me become curious when a TLG search revealed that Alkaios is the only author in whose work this word survives (Alkaios has it again in the very flimsy fr. 167.7); I noted, too, that here in fr. 208, he features it in a figura etymologica, a)/xmata…a)/xmena (as if a Greek auditor needed a/)xma to be explained!). What my curiosity has led me to conclude is that in spite of its simplicity a)/xma is part of the sailor's specialist vocabulary, drawn from the lexicon of those who work the sea seriously. A look right above the!a)/xmata in 208 brings us closer to understanding what I mean by the specialist lexicon: toi po/dej a)mfo/teroi me/no[isi] e)n bimbli/dessi. “Both feet remain in the ropes” is how I translated

192

David Tandy

this above but there is no certainty about e)n bimbli/dessi#!I think that people with an opinion on this agree that these feet are Alkaios’s feet and that they are still tangled (me/noisi$ in the ropes (e)n bimbli/dessi). These bi/mblidej are a hapax. (From Hesychius we can see that bimbl = bibl = bubl; but at this early date it is difficult to be certain what the word ought to mean.) They are logically sheets of some kind, part of the rigging of a sailing vessel, and Alkaios’s feet are tangled up in them, which is a bad thing, allegory or not. There are at least two other possible interpretations of this locution. One is that the feet are the feet or bottom two corners of the sail (LSJ, s.v. pou/j, II.2) and that the bi/mblidej are the ropes or sheets that hang from them and that are used to pull in or let out the sails. If the feet are still on the sheets, that is a good thing, but if they have been introduced as a topic then perhaps the feet and sheets will be soon separated from each other. Holding onto these ropes is the only thing that saves Alkaios. Another interpretation, for the sake of an example, is that the po/dej are Alkaios’s but that the bi/mblidej are not ropes of any sort but rather mats of papyrus used to improve the footing of the seamen and perhaps especially of the steerer. So Alkaios is saying that he still has his footing (but perhaps not for long). bi/mblidej only appear in Alkaios and I conclude that it is drawn from the specialist lexicon.9 My point here is not that I have got a new interpretation of this passage but that the presence of specialist diction betrays Alkaios’s experience on the sea, which is substantial. To all the references to seafaring and to the specialist language we can finally add Alkaios’s Hymn to the Dioskouroi: deu=te/ moi na=]son Pe/lopoj li/ponte[j pai=dej i)/fq]imoi D[i/oj] h)de\ Lh/daj eu)no/w]i qu/[m]wi pro[fa/]nhte Ka/stor kai\ Polu/deukej, oi)\ ka\t eu)/rean x[qo/na] kai\ qa/lassan pai=san e)/rxesq ) w)[kupo/]dwn e)p ) i/)ppwn r)h/a d ) a)nqrw/poi[j] qa[n]a/tw r)u/esqe zakruo/entoj eu)sd[u/g]wn qrw/iskont[ej. .]a)/kra na/wn ]tr[ ]ntej p]h/loqen la/mproi pro[ a)rgale/ai d ) e)n nu/kti f[a/oj fe/]rontej na=i m[e]lai/nai!!

Come to me, leaving behind the island of Pelops, strong sons of Zeus and Leda, with kind spirit appear, Kastor and Polydeukes, who travel over the broad land and all the sea on swift-footed horses, and you easily rescue people from cold death, leaping to the tops of their well-benched ships, shining afar ... bringing light to the black ship in the arduous night (34).

9

Fr. 305, a second-century CE commentary to fr. 208, glosses bimbli/dessi with a common word for ropes, sxoini/a. That bimbli/dessi needs a gloss is perhaps more telling than the content of the gloss itself. Charlton (1996) associates all matting with cargo.

Trade and Commerce

193

What a fine after-dinner song for Nearchos (see note 8) and his other fellow Mytilenians and other Greeks at the Hellenion or its predecessor at Naukratis! In short and in conclusion, Alkaios betrays an expertise that is eye-catching; his work on the sea is not what he wants to write about but he reveals what he knows nevertheless. He and other poets point to an enormity of competition between polis and and other interests, including independent households. Poleis are no doubt sponsoring their own trading abroad, but the characteristic stasis of the polis, as political behaviors play themselves out, is economically self-defeating or at least self-restricting, just as policies that discourage peasant producers, which I've written about elsewhere (Tandy and Neale 1996; Tandy 1997, 2001), are counter-productive, development-wise. This indicates, I think, an immaturity of vision by these early states that will only be overcome by time. Eventually citystates will understand the importance of expanded inclusions both of excluded elites and of other classes, and extra men will play less of a competitive role against the polis.

194

David Tandy

Bibliography Braun, T.F.R.G. 1982. “The Greeks in the Near East.” In CAH2 3.3, 1-31. Campbell, D.A., ed. and trans. 1982. Greek Lyric I. Cambridge: Harvard University Press. Cartledge, P. 1983. “‘Trade and Politics’ Revisited: Archaic Greece.” In Trade in the Ancient Economy, edited by P. Garnsey, K. Hopkins, and C.R. Whittaker, 1-15. Berkeley: University of California Press. Charlton, W.H. Jr. 1996. “Rope and the Art of Knot-Tying in the Seafaring of the Ancient Eastern Mediterranean.” MA Thesis, Texas A&M University. College Station: Texas A&M University. Davison, J.A. 1954. Review of E. Diehl, ed., Anthologia Lyrica Graeca, fasc. 3, 3rd ed., Leipzig: B.G. Teubner. ------.1960. “Archilochus Fr. 2 Diehl.” CR n.s. 10: 1-4. Foxhall, L. 1998. “Cargoes of the Heart's Desire: The Character of Trade in the Archaic Mediterranean World.” In Archaic Greece: New Approaches and New Evidence, edited by N. Fisher and H. van Wees, 295-309. London: Duckworth. Haider, P.W. 1988. Griechenland, Nordafrika: Ihre Beziehungen zwischen 1500 und 600 v. Chr. Darmstadt: Wissenschaftliche Buchgesellschaft. Lavelle, B.M. 1997. “Epikouros and Epikouroi in Early Greek Literature and History.” GRBS 38:229-262. ------. 2002. “The Apollodoran Date for Archilochos.” CP 91: 535-537. Lobel, E., and D. Page, eds. 1955. Poetarum Lesbiorum Fragmenta. Oxford: Clarendon Press. Malkin, I. 1998. The Returns of Odysseus: Colonization and Ethnicity. Berkeley: University of California Press. Möller, A. 2000. Naukratis: Trade in Archaic Greece. Oxford: Oxford University Press. Tandy, D.W. 1997. Warriors into Traders: The Power of the Market in Early Greece. Berkeley: University of California Press. ------. 2001. “Agroskopia: Material Centripetalism and the Contingent Nature of Early Greek Economic Development.” In Prehistory and History: Class, Ethnicity, and Political Economy, edited by D.W. Tandy, 159-178. Montreal: Black Rose. Tandy, D.W., and W.C. Neale. 1996. Hesiod’s Works and Days: A Translation and Commentary for the Social Sciences (Berkeley: University of California Press) Voigt, E.-M., ed. 1971. Sappho et Alcaeus. Fragmenta. Amsterdam: Athenaeum— Polak & van Gennep. West, M.L., ed.1989. Iambi et Elegi Graeci ante Alexandrum Cantati. 2nd ed. Oxford: Clarendon Press.

V. WIRTSCHAFTSTHEORIEN IN ANWENDUNG AUF DIE KLASSISCHE ANTIKE/ ECONOMIC THEORIES APPLIED TO CLASSICAL ANTIQUITY

ARCHAIC GREEK ARISTOCRATS AS CARRIERS OF CULTURAL INTERACTION Kurt A. Raaflaub Background and question In an earlier paper, I discussed an old and much contested question: to what extent was the formation of the Greek polis and its institutions influenced by impulses from Phoenician city states? (Raaflaub 2004 with bibliog.). In my conclusion, I suggested that one of the problems in urgent need of investigation is how (through what channels of transmission or what kinds of persons) such impulses might have reached the Greeks. Since my earlier thoughts on this issue serve as a starting point for my present exploration, I briefly repeat them here,1 although I will then abandon my specific focus on things Phoenician and investigate more generally the personnel responsible for the transmission of intellectual, ideological, and political influences from the entire ancient Near East and Egypt. My interest lies in the transfer of ideas, not in that of material goods and the skills to produce them. That Phoenicians may have played a crucial role in such transmissions is an obvious possibility (Niemeyer 1984; Patzek 1996). Evidence for any full-scale Phoenician settlement in the Aegean is lacking so far, but it is likely that clusters of Phoenician settlers (enoikismoi of traders, craftsmen, and the like) existed in some Greek towns and villages (such as Kommos in southern Crete: Shaw 1989).2 Such enoikismoi were established as well by Greeks especially in towns on the Levant (Al Mina is only the best known among these; see Niemeier 2001, 12-16). Thus it might have been small groups or individuals who transmitted stimuli that proved useful in the formation or further development of Greek poleis. We might think of Greek traders who returned from the Levant or who had communicated with Phoenician traders in the West, or of Phoenician traders or migrating artisans who visited Greece or even settled there for extended periods or permanently.3 Such contacts were numerous and are well attested. There can be no doubt, therefore, that the Greeks of the late Dark Ages and early Archaic Period knew of the Phoenician city states and probably also of some of their institutions. The question only is whether the Greeks respected these types of informants sufficiently to be interested in learning from them not only about crafts but also about issues that concerned their communities and their interaction with each other (that is, about “political issues”). As Barbara Patzek points out (1996, 3-4), Herodotus sees the Phoenicians, before they became the naval arm of the Persian empire, as peaceful transmitters of 1

2 3

I cite in this first section only some recent bibliography, referring the reader for fuller references to my 2003 paper. I now see that Patzek 1996, 31 also concludes that the Phoenician city did not serve as a model for the formation and institutionalization of the Greek polis. See generally Coldstream 1982; Markoe 1985, 110-27; Gehrig 1990; Burkert 1992, chap. 1; Hoffman 1997. Matthäus 1993, esp. 176-84 emphasizes that transmission of social and religious customs required as a necessary precondition close and extended familiarity between Greeks and Easterners. He thinks of Easterners living in Greece. I will explore the reverse possibility.

198

Kurt A. Raaflaub

cultural goods and skills (most important among them, of course, the art of writing: 5.58). In Homer we find admiration for the skills of the “Sidonians” next to contempt for Phoenician traders who enjoyed a dubious reputation, perhaps like gypsies in modern Europe, as cheaters and kidnappers (Latacz 1990; Patzek 1996, 9-19). Phoenician artisans who settled in Greek villages may have been respected more highly, comparable perhaps to the d!miourgoi whom we meet already in Homer’s epics. However, in a world of farmers, in which those who wanted to be accepted and belong needed to own land, even Greek traders probably were not esteemed highly (Donlan 1997, 651-54; Tandy 1997, 62-75). The d!miourgoi were in demand because of their skills and products, but they remained outsiders (metanastai) and were unprotected (Gschnitzer 1981, 29, 33-34). If individuals played a significant role in transmitting intellectual and political knowledge, I suggest, we need to look for them in different circles. We should think of aristocratic relations that typically connected Greek elite families with their peers in other poleis and even non-Greek states (such as, in the sixth century, Lydians and Persians in Asia Minor). Greek aristocrats collected and exchanged prestige goods and hired migrating artisans. As leaders of colonizing ventures and raiding expeditions and for numerous other reasons, they traveled through the entire Mediterranean and beyond (Humphreys 1978, chap. 7; Stein-Hölkeskamp 1989). From the late eighth century, they met with their peers at events that took place at the emerging panhellenic sanctuaries (especially at Delphi and Olympia but also in the Heraion at Samos), and there they were joined by non-Greeks as well (Morgan 1990; Rosenberger 2003). At such occasions, and during their travels, they may have exchanged information and knowledge and discussed ideas that seemed useful, not least for tackling and resolving communal problems. I think of three obvious examples, among others, that are well attested in the ancient Near Eastern world long before they were applied in the emerging Greek poleis. One is the possibility of enacting laws (and inscribing them on durable material) as a means to resolve urgent problems that threatened the well-being of the community (Gehrke 2000). The second is the possibility of debt relief or even the abolition of debt bondage as a means to avoid civil strife and assuage the anger of masses of impoverished farmers (Raaflaub 2000, 54-57). The third is the possibility of concluding binding treaties and contracts, firmed up by specific formulae and religious sanctions (Karavites 1992; Rollinger 2004). What we know about colonization suggests that especially at the oracle of Delphi a vast amount of knowledge about geography and political experiences was accumulated and that such knowledge was used to advise those who planned new colonizing ventures (Malkin 1987, chap. 1; Malkin 1989; Londey 1990). The elite thus had access to information from all over the world.4 Moreover, ten years

4

Sacks 2003 warns against taking the notion of “elite” too narrowly and to distinguish rigidly and on the basis of untested assumptions between an active and purposeful elite and passive nonelites. My purpose here is to investigate what we can find out about the elite’s role as transmitters of ideas and thus to build a stronger foundation for further discussion. My understanding of “elite” is not very narrow anyway, and in the archaic period, which was charac-

Archaic Greek Aristocrats

199

ago Klaus Seybold and Jürgen von Ungern-Sternberg (1993) suggested that we should perhaps think of a cultural koin! that developed in the early Iron Age in the Eastern Mediterranean and in which Phoenicians, Greeks, and others participated (cf. R. Rollinger’s introduction to this volume). So far my premise. In this chapter, I hope to substantiate this thesis. Since, elsewhere in this volume David Tandy discusses the evidence on trade that is offered by the lyric poets, I will focus here on some of the information preserved by Herodotus and explore how far back it can be extended. But first a few general observations on the Greeks’ own views on some of the issues we are concerned with here.

Greek views on cultural transmission In his digression on the Scythians in book four, Herodotus characterizes the Scythians as adamantly opposed “to adopting customs imported from anyone else, especially Greeks.” He illustrates this with the tales of two Scythians of royal lineage (Anacharsis and Scyles) who were killed by their own relatives because they engaged in Greek religious rituals (Hartog 1988, 61-84), and concludes, “The Scythians are so conservative, then, that this is how they treat people who adopt foreign ways” (4.76-80; tr. here and elsewhere Waterfield 1998). The offenses of these two persons may have been considered especially grave precisely because they were members of the royal family and because religion was involved. Still, as many have observed, Herodotus has a strong tendency to use especially the Scythians as a mirror for the Greeks (Hartog 1988). Hence, we understand, in this respect too the Greeks are exactly the opposite of the Scythians: they like to adopt foreign customs. At the beginning of this particular passage, Herodotus alerts us that in this respect the Scythians are not alone (kai houtoi: they too). This cross-reference leads us back to book two. At the beginning of his description of Egyptian customs, Herodotus states: “In keeping with the idiosyncratic climate which prevails there and the fact that their river behaves differently from any other river, almost all Egyptian customs and practices are the opposite of those of everywhere else” — which the historian illustrates with numerous examples (2.35-36). Not only that, but their customs are also entirely their own. With very few exceptions, “they perpetuate their traditional customs rather than acquiring new ones” (2.79), and: “The Egyptians avoid using Greek customs or, by and large, those of any other people either” (2.91). In this case, Herodotus makes the contrast explicit. The Greeks have adopted a great deal from the Egyptians, things well-known and others, as the historian insists, that closer inspection reveals as undeniably imported from Egypt: Dionysiac rituals, the names of gods, general festive assemblies and religious processions (2.49-50, 58), and so on. In the latter case, Herodotus explains: “My evidence for this suggestion is that these activities have obviously been going on terized by much social mobility, it was (and was perceived as) rather fluid and contested (Donlan 1980, chaps. 2-3; Stein-Hölkeskamp 1989, chap. 3).

200

Kurt A. Raaflaub

in Egypt for a very long time, whereas they have only recently started in Greece” (58). Herodotus is only the first in a long tradition of Greek writers (Plato, Diodorus Siculus, and Plutarch foremost among them) who tell stories about Greek borrowings from Egypt and travels of Greek sages and lawgivers especially to this country. Many of these stories are taken at face value by modern scholars. Yet, I believe, caution is due. Some of them are perhaps based on vague memories and genuine traditions but most are the result of rationalization and constructions intended to explain phenomena that seemed similar in both cultures. They follow well-established patterns, as Andrew Szegedy-Maszak (1978) has shown in a classic article. Usually, they do not represent historical fact (Raaflaub 2000, 60-61 with bibliography). My purpose in emphasizing all this is not to deny that the Greeks learned from the Egyptians, Mesopotamians, Phoenicians, and others. It would be absurd to do that, given the pervasiveness of cultural borrowings we observe in what has come to be called the “Orientalizing Period” and far beyond.5 Rather, I wish to make clear that we are not obliged to accept specific Greek ideas about how, and by whom, such cultural transfers were realized. Who, then, were the carriers of cultural (especially intellectual and political) influences and exchange?

Greeks in contact with the Persian court or its representatives I begin at the lower chronological end, which is too late for my primary question but illustrates some significant facts. Josef Hofstetter’s prosopography of Greeks in the Persian empire before Alexander lists six names under Cyrus, seven under Cambyses, and some forty under Darius I (1978, 192-93). These include a number of exiled Greek elite persons who found refuge at the Persian court (the Athenian Peisistratids and the Spartan king Demaratus are prominent examples), tyrants of Greek poleis under Persian rule (some of whom, like Histiaeus of Miletus, spent time at the court for various reasons), kings of other territories (like Macedonia or Cyprus) that were Greek but part of the Persian Empire, and ambassadors of Greek cities to the Great King (such as the Spartan envoy Lacrines who warned Cyrus, to no avail, not to attack the Ionian Greek poleis, Hdt. 1.152-53).6 Most of these persons, whether major political players or incidental figures (such as Hermippus whom Histiaeus sent from the Persian court to Miletus with a message written on his head that triggered the Ionian revolt, Hdt. 6.4), are mentioned in connection with the story of Persia’s conquest or reconquest of the Aegean coast and islands from 546 to 490. 5

6

See recently Burkert 1992; Morris 1992; West 1997, and the bibliog. cited in Raaflaub 2000, 53 n.6. For critiques of the concept of simple dissemination, see Humphreys 1993; Patzek 1996. Hofstetter’s title is thus slightly misleading: his prosopography includes all persons who are known to have had any contact with the Persians, even if they did not spend much time in Persia. See Walser 1984, chap. 5 for additional names and bibliog.

Archaic Greek Aristocrats

201

If we deduct these from the list (because they did not really spend much time in Persia), few persons remain: a prophetess (Herophile, who warned Cyrus not to execute Croesus, Hdt. 1.86-87) and a seer (Onomacritus, whose false prophecies supported the Peisistratids’ request for reinstatement in Athens, 7.6), Pythagoras the philosopher (who supposedly, according to various traditions, spent some years in Babylon before he emigrated to Magna Graecia; Hofstetter, no. 281), two mercenary generals (one of whom, Eurybatus, defected from Croesus to Cyrus [1.76, 141, 149], the other, Phanes of Halicarnassus, from Amasis to Cambyses [3.4ff., 11]), Scylax (admiral of a naval expedition from India to Egypt, 4.44), Mandrocles of Samos (the builder of the bridge over the Bosporus during Darius’ Scythian expedition, 4.87-89), Democedes (Darius’ doctor, 3.125, 129-37), and Gillus of Tarentum (an exile, who did Darius a great favor, 3.138). Pythagoras’ stay in Babylon, not mentioned by Herodotus, is likely to be pure fiction. Of Herophile we know nothing else. Onomacritus, linked with the Peisistratids, presumably did not return to Greece. The others, without exception, are interesting cases, representing various categories of Greek elite persons who came into close contact with the Persians. I shall use them as leads for my discussion of the types of persons who had intimate knowledge of Near Eastern civilizations and might have served as carriers of cultural transmission or exchange. Including other persons who were not connected with the Persian Empire but whom Herodotus mentions elsewhere, I distinguish the following categories: (a) colonizers, raiders, or adventurers, (b) “specialists,” (c) mercenaries, (d) traders or travelers who engaged in trade.7 It is important to note that Herodotus mentions these persons because they were especially memorable for some specific reason. They were the best in some way or other, they had done or achieved something that deserved to be qualified with a superlative (for example, making a particularly conspicuous or interesting dedication in a sanctuary), or they were linked to an otherwise noticeable person. This probably means that they merely represent the “tip of an iceberg”: there were others like them, whose fates or accomplishments were not quite as memorable and who thus escaped remembrance and mention in Herodotus. Many of them lived in the sixth century, too late for our purposes. In some cases, other sources, Greek, Egyptian, and Near Eastern, help us trace their predecessors back to the seventh or even late eighth century.8 Even when this is not the case, we are able to make a plausible argument that such forerunners were active many decades earlier.

7 8

I will thus omit artisans and craftsmen who only in very exceptional cases rose to elite status; they are discussed thoroughly by Burkert and Hoffman (cited in n. 2). On Greeks in the Near East and Egypt, see, for example, Austin 1970; Braun 1982a; Braun 1982b; Haider 1988, Haider 1996; Helck 1995; Niemeier 2001; Rollinger 2001 (most with excellent bibliog. of recent scholarship).

202

Kurt A. Raaflaub

Colonizers, adventurers, or raiders The adventures of the Spartan Dorieus and some of his companions offer an illuminating example (Hdt. 5.41-48).9 He was king Cleomenes’ younger half-brother, the “outstanding man of his generation.” Refusing to be ruled by his brother, he collected a band of settlers and led them on a colonizing expedition, without, however, consulting Delphi and observing any of the other rules an oikist was supposed to follow in preparation for such a venture. Not surprisingly, therefore, the colony he founded in Libya collapsed after two years because of native resistance. He returned to Greece and was advised to colonize Heraclea in Sicily, for which he received a positive oracle. Enlisting the same men, he took off for Sicily. After perhaps stopping on the way to support Croton in a war against Sybaris (Herodotus received conflicting reports on this issue), he reached Sicily in full strength but perished with most of his men in a battle against an army of Phoenicians and Segestans. Euryleon, one of four Spartiates involved in this expedition, survived. He gathered the remnants of Dorieus’ army, conquered Minoa (a colony of Selinus), helped the Selinuntians drive out their tyrant, but was killed when he tried himself to establish a tyranny (5.46). Another person who went to Sicily with Dorieus was Philippus of Croton. He had been engaged to the daughter of Telys, the tyrant of Sybaris. The war between Croton and Sybaris not only spoiled his marriage plans but also caused him to be exiled by his fellow citizens. He sailed to Cyrene and then joined Dorieus’ expedition, providing his own trireme and paying the expenses for his entire crew. “He was an Olympic victor and the most handsome man of his generation in Greece. His good looks have earned him a unique accolade from the people of Segesta: they offer propitiary sacrifices at his tomb, where they have erected a hero’s shrine” (5.47). Such colonizing ventures were frequent from the second quarter of the eighth century. They were preceded by exploratory and trading expeditions throughout the Mediterranean. Adventurers had roamed the seas all along. The colonizers retained contact with their mother cities and often returned if they were unsuccessful, only to try again later.10 To be sure, Greeks were not able to found independent settlements in areas that were controlled by organized states and superior powers (such as Carthage or the Phoenicians). But controlled settlements of Greek mercenaries are attested in Egypt from the mid-seventh century, and of traders not much later. Greek enoikismoi existed with great probability from at least the seventh century in several Syrian and Phoenician ports (Haider 1996, 60-79; Niemeier 2001, 12-16 with bibl.), perhaps even encouraged by the Assyrians (Lanfranchi 2000, 9-12). Moreover, Greeks settled in Cilicia as well, after their violent intrusions had been repelled by Sargon in 715 and Sennacherib in 696 (Lanfranchi 2000, 13-31). Apparently the Assyrian kings did not tolerate full-scale foreign settlements (colonies) in the territory they controlled, but had no objections to, or 9 Malkin 1994, chap. 7; Dougherty 1993, 17-19; DNP 3 (1997) 778-9 with bibliog. 10 For a survey, see Graham 1982a, Graham 1982b. On the narrative patterns of colonization stories, see Dougherty 1993.

Archaic Greek Aristocrats

203

even encouraged, enoikismoi. Whether farther west, in Rough Cilicia, Greek colonies existed already at that time remains uncertain (Haider 1996, 92-95 is perhaps too optimistic: Lanfranchi 2000, 29-30). Hence Greek settlers were not even excluded from those areas where major cultural influences originated. In addition, Greeks must have been in touch frequently elsewhere with representatives of these cultures, especially with the Phoenicians who were equally active in the western Mediterranean around the same time (Niemeyer 1982; Aubet 1993), and not all encounters were as hostile as that which brought about Dorieus’ demise. The Odyssey, composed in the late eighth or early seventh century, refers to experiences of the age of colonization, especially in the foundation story of the Phaeacian town of Scheria (6.3-10) and the description of an ideal spot for a colony on “goat island” off the coast of “Cyclops country” (9.116-41). The same epic mentions Greek raiding expeditions to distant shores. Odysseus, sailing by the Thracian coast on his way home from Troy, spots a town and cannot resist the temptation to raid it, with harmful consequences for his undisciplined companions (9.39-61). In his fictitious life story, Odysseus “the Cretan” boasts of having undertaken nine successful raids against foreign men. “I made a lot in those wars. I would cull / the loot I liked best and get even more / when the rest was divided later by lot. / So my house grew rich, and I became / one of the most feared and respected men in Crete” (14.230-34, tr. S. Lombardo). The earliest known Assyrian reference to Greeks tells precisely of such a raid undertaken by “Ionians” against the southern Phoenician coast in the reign of Tiglathpileser around 730 BCE (Braun 1982a, 15; Rollinger 2001, 237-39). Assyrian sources mention several royal interventions on the Mediterranean coast and in Cilicia from the late eighth century, not least to suppress Greek intrusions (Haider 1996, 79-80; Lanfranchi 2000, 13-31). In such contexts, they allude several times to “Ionians” (Braun 1982a, 16; Rollinger 2001, 239-41). “Ionians,” in various Assyrian forms, was the name used for all Greeks, whether from Cyprus or the Aegean (Rollinger 2001, 235-36; Lanfranchi 2000, 13 n. 20). It is likely that as the result of such interventions Greeks were deported to the interior of Assyria (see below). Some of them may have returned later. We tend to think of neither raiders nor deportees as carriers of cultural transmission, but they may have included elite leaders, and if these kept their eyes and ears open, they may well have picked up some pieces of information that could prove helpful at home. It is worth listening once more to Odysseus “the Cretan.” After the nine raids mentioned earlier, he was compelled by his community to become one of the leaders of the Cretan contingent in the Trojan War. He returned home safely but could not stand the peaceful life with wife and children. Soon he set out again, this time on an expedition all the way to Egypt. Ignoring all precautions, his companions went about plundering and abducting women and children, only to be surprised, decimated, and enslaved by an Egyptian counterattack. He himself survived by supplicating the Egyptian leader, who took pity on him and accepted him into his home. “Seven years I stayed there, amassing wealth, / for all the Egyptians gave me gifts. / When the eighth year rolled around, there came / a man from Phoe-

204

Kurt A. Raaflaub

nicia, / and I stayed with him there for one full year, / after which he took me in a seafaring ship / bound for Libya.” His treacherous Phoenician host intended to sell him into slavery, but a storm destroyed the ship, while he, clinging to the mast, was washed ashore in Thesprotia (14.235-315, quote: 285-95; cf. 17. 425-44 with a different ending) and eventually reached Ithaca — destitute and as a beggar, to be sure, but obviously intending to find a way home, where presumably, like the real Odysseus, he would resume his former life as a respected member of his community. This story, invented on the spot to disguise Odysseus’ true identity, had to sound realistic enough to be credible. The pattern it describes thus must have been familiar to a Greek of Homer’s time.

“Specialists” In this category I include the two architects and the physician who, according to Herodotus, rendered important services to Persian kings and were awarded generously by them. Mandrocles of Samos built the bridge over the Thracian Bosporus for Darius’ Scythian campaign. He used part of the reward he received to commission “a painting of the whole bridging of the Bosporus, with the king sitting on a dais and his army crossing the bridge.” This painting was dedicated in the Heraion of Samos, with an epigram quoted by the historian (4.87-89). One of Mandrocles’ successors, not named by Herodotus (7.34-36), was Harpalos of Tenedos who, succeeding where Egyptian and Phoenician engineers had failed, built the bridge over the Hellespont that Xerxes used in his great expedition against Greece (Hofstetter 1978, no. 130; on the bridge, see Hammond and Roseman 1996). While these men may not have been more than superficially familiar with Persia, Democedes, son of Calliphon, of Croton certainly was. He was the best physician of his day. He left Croton because of a disagreement with his father and emigrated to Aegina, where he was hired as state physician for one talent a year. Soon the Athenians hired him away for 100 minas, only to be topped by Polycrates of Samos who offered two talents. Democedes accompanied Polycrates on his fatal visit to the Persian satrap Oroites and was sent to Susa with all of Oroites’ belongings after the latter’s violent death. Pulled out of oblivion, when Darius’ doctors failed to heal his sprained ankle, he succeeded and then helped the queen Atossa overcome a serious health problem as well. He was richly rewarded and rose from a slave’s misery to become an influential personality at the Persian court. Desiring to return home, he convinced the king to send him to Greece with a Persian reconnaissance mission and jumped ship in Croton (3.125, 129-37).11 The Persians continued their trip without him and were shipwrecked and enslaved by the Iapygians. An exile from Tarentum, Gillus, obviously a wealthy man, ransomed them and brought them back to Susa. In gratitude, Darius mobilized the Cnidians to return him to Tarentum, but his fellow-citizens rejected him; his further fate is unknown (3.138). By contrast, Democedes married the daughter of the world11 Griffiths 1987; Austin 1990, 299; Asheri 1990, 341-42 with bibliog.

Archaic Greek Aristocrats

205

famous wrestler Milo, who boasted 32 victories at panhellenic games (DNP 8 [2000] 191-92 with bibliog.). Although Herodotus does not say so, Democedes’ marriage suggests that he assumed high status and an important position in his home town. He certainly is the type of person we are looking for: he spent an extended period of time at the Persian court, was thoroughly familiar with Persian customs and government, returned home to tell about it, and was in a position to be taken seriously when he did so. So far Herodotus. Do we find any clues that take us farther back? From the time of Cyrus’ conquest of the Greek poleis on the west coast of Anatolia many Greek architects, stone masons, building engineers and other specialists were attracted to or pressed into Persian service. Their participation, for example, in the construction of the palaces of Cyrus and Darius can be inferred from specific technical indications preserved among the remains and is confirmed by explicit references in inscriptions on walls and columns (Walser 1984, 23). Early sixth-century documents attest to the presence of Ionian specialists working in Nebukhadnezzar’s capital Babylon (Haider 1996, 94). Sennacherib deported those who did not submit to his victorious campaign in 696 to Nineveh, where they were used as construction workers (Haider 1996, 9091). These included Greeks, for in 694 the king undertook a ship building program in Assyria, in which Phoenicians and “Ionians” were involved: “Khatti people, plunder of my bow, I settled in Nineveh. Mighty ships after their workmanship of their land, they built dexterously. Tyrian, Sidonian and Ionian sailors, captives of my hand, I ordered to descend the Tigris with them” (Braun 1982a, 19 with tr.; Rollinger 2001, 242-43). According to Robert Rollinger, this “is to date the only text telling what happened to some Greeks after they had been beaten and taken prisoners by the Assyrians,” and showing that “Greeks also came into contact with the interior of the Assyrian empire” (243; see ibid. for a tiny fragment mentioning an “Ionian” who obviously was in the capital of Assyria, and 252 about one Antikritos who in the first half of the seventh century moved about the eastern part of the Assyrian empire: below n. 15). Among tributary kings who provided timber and other building materials for Esarhaddon’s palace in Nineveh, sources name the kings of “Ionians” on Cyprus (Braun 1982a, 19-20). Building materials were perhaps accompanied by builders (we think of the Phoenicians who built Salomon’s temple and palace in Jerusalem, 1 Kings 5:15-32, 7:13-50). At any rate, knowledge about Assyrian (and even more so Phoenician) customs and institutions must have been especially broad among Cypriote Greeks, and Cyprus probably played a role comparable to that of Phoenicia in the transmission of Near Eastern information to the Aegean. For our purposes, other types of specialists, familiar with various aspects of Near Eastern religious and intellectual achievements, might seem even more important. Migrating healers, professional ancestors of Democedes, as well as priests and seers or diviners are amply attested both in the ancient Near East and Greece. The Odyssey (17.383-85) counts them, like accomplished workmen and inspired singers, among the d!mioergoi sought after because of their skills. Walter Burkert and others have suggested that oriental specialists of these types were

206

Kurt A. Raaflaub

present in Greece (especially in Crete) from the eighth century. So far, only similarities in practices support this assumption; explicit testimony is lacking (Burkert 1983; 1992, chap. 2; Rollinger 1996, 203-10). Many practices, of course, can migrate without the specialists, for example, “in the luggage” of craftsmen or traders. Nor do we know, although it is not a priori unlikely, that Greek seers or healers traveled to the Near East and learned such practices there. At any rate, such persons, who often enjoyed high social prestige, would seem to be perfect candidates as transmitters of ideas even outside their field of specialization, including political knowledge. Epimenides, who supposedly purified Athens in the late seventh or early sixth century from the pollution caused by the murder of Cylon’s followers, is a good example. Though shrouded in the mist of miracle legends, he was a Cretan and apparently connected with Delphi and perhaps also Solon (Arist. Ath. Pol. 1; cf. Rhodes 1981, 83; DNP 3 [1997] 1144). Finally, I should at least mention yet another category of specialists with potential importance for our topic: poinikastai (“secretaries, scribes,” that is, men in charge of Phoenician letters, although this is not the only explanation of the term) who also serve as mnamones (“rememberers,” “living archives” [Koerner 1993, 539], that is, men in charge of the polis’ cultural and institutional memory). They are attested in Crete from around the mid-sixth century. In my view, the hist"r (“knower”) in the famous arbitration scene on the shield of Achilles has a similar function (Il. 18.501; see Edwards 1991, 213ff., esp. 216). Knowing the customary law and oral traditions of his community, such a specialist is capable of sorting out problems, assessing a dispute, resolve it himself, or pass it along to a more elaborate arbitration panel (Connor 1993, 5-7 with bibliog.). The best-known among the poinikastai is Spensithios, whose elaborate contract with the polis Dattalla is preserved (van Effenterre and Ruzé 1994, no. 22). Whether or not he was a native of this town is debated but he certainly was Greek. As pointed out earlier, the concept of engraving laws on durable materials, perhaps even of writing them down at all, was Near Eastern; so, of course, was that of writing. The function of these specialists, to serve both as rememberers and recorders, reflects a period of transition in which orality and literacy complemented each other (Gehrke 1997, 46). Yet nothing suggests that they depended on—or could even have profited from—contacts with their Near Eastern colleagues. Once Greek scripts were adapted from their Phoenician model, they became fully independent; alphabetic scripts, however limited their use may have been in the first centuries, did not require long training in scribal schools; and the preservation of memory was dictated by the needs and traditions of a given community. It would be surprising, therefore, if the poinikastai were among the transmitters of Near Eastern ideas.

Mercenaries Greek military leaders were active in the early Achaemenid Empire. Eurybatus of Ephesus was despatched by Croesus to Greece to hire Peloponnesian mercenaries. He defected to Cyrus and informed him of Croesus’ preparations. His name became

Archaic Greek Aristocrats

207

proverbial for a traitor (Hdt. 1.76, 141, 149; Diod. 9.32). Phanes of Halicarnassus served as a mercenary general under Amasis in Egypt. He became disgruntled, defected to Cambyses, and offered him valuable advice for his Egyptian campaign. He was remembered especially because the Greeks and Carians in the Egyptian army took revenge by murdering Phanes’ children in a particularly gruesome way in sight of both armies (Hdt. 3.4, 7, 11). In the service of Darius, Scylax of Caryanda led a naval expedition from India to the Red Sea (Hdt. 4.44), circumnavigating the Arabian peninsula and writing a report (Periplous) which was used by Hecataeus and later authors. The presence of Greek mercenaries in Egypt is well attested from the time of Psammetichus I (664-10). Under Apries they supposedly numbered 30,000 (Hdt. 2.163). The “Bronzemen” (2.152) made a deep impression, and it is likely that Carians and Greeks served as mercenaries even earlier (Haider 1988, 183).12 A fragment of Archilochus’ poetry (no. 216 in West 1971) indicates that around the mid-seventh century “mercenary” was almost synonymous with “Carian.” The great numbers of mercenaries in Egypt, their permanent settlement, and their gradual adaptation to Egyptian society (Haider 1996, 95-113; 2004) suggest that the Egyptian case represents a particular type of mercenariate, different from the short-term employment usually associated with this phenomenon, and more comparable to the contemporaneous colonization movement.13 Still, some of these “military emigrants” returned to Greece later. A spectacular case is Pedon, son of Amphinnes, who settled in or near Priene after highly successful service in Egypt under Psammetichus I. He set up an Egyptian statue with a Greek inscription recording the rewards he had received for his outstanding achievements.14 Another example is Euthykartides from Naxos, who in the late seventh century dedicated in Delphi a kouros standing on the backs of men — an Egyptian royal motif which this Greek, probably returning from foreign service, used to emphasize his importance (Haider 1996, 113). Herodotus, at any rate, assumes firm contacts between Egyptian and Aegean Greeks: “They were the first foreigners to live in Egypt, and it is thanks to their residence there that we Greeks have had some connection with the country, and that is how we have reliable information about Egyptian history from the reign of Psammetichus onwards” (2.154). Nor did Greek mercenaries apparently avoid the Near East (Bettalli 1995, 4352). In the late seventh century, several forts on the Phoenician and Palestinian coast as well as farther inland (Austin 1970, 16; Haider 1996, 69-76) seem to have been staffed with Greeks. In 664 Carian (and probably Greek) mercenaries served in the Assyrian army that defeated a usurper and reinstalled Psammetichus I as vassal on the Egyptian throne (Bettalli 1995, 54-59; Haider 1996, 92-93). Gyges of Lydia (ca. 680-644 BCE) also sent a contingent of mercenaries to Egypt to support Psammetichus, and it seems certain that Gyges himself employed large num12 On early Greek and Carian mercenaries, see now Kammerzell 1993; Bettalli 1995; Niemeier 2001, 16-24. See also the excellent observations by Morgan 2001. 13 For detailed discussion, see Haider 1988, chap. III; Austin 1970, chap. 2. 14 Ampolo and Bresciani 1988; Masson and Yoyotte 1988; Haider 1996, 100-2.

208

Kurt A. Raaflaub

bers of Carian and Ionian mercenaries (Haider 1988, 164-74; Kammerzell 1993, 111-14; Bettalli 1995, 75-76). In 681 Asarrhadon conquered the Assyrian throne with the help of a mercenary army he had gathered in Cilicia; this army included Greeks (Haider 1988, 183; 1996, 91).15 In the late eighth century, Sargon II reports an intervention in Ashdod on the Levant, where the people had deposed their king, Azuri, and made one Yamani (the “Ionian”?) their ruler. Sargon besieged Ashdod, Yamani fled to Egypt and was later extradited to Sargon. Was he a Greek mercenary officer in Azuri’s bodyguard? (Braun 1982a, 16; Haider 1996, 81-82; see now the detailed discussion by Rollinger 2001, 245-51). The same name occurs in various tablets in Nineveh: one Yamani sold a slave woman to an officer in 661, was captain in 659 and witnessed a similar sale and served as witness in 654. Are we dealing here with one or several persons and with Greeks? (Braun 1982a, 21; Rollinger 2001, 244-45). Attractive though this possibility seems, strong doubts remain, and “the use of the name ‘Yamani’ proves no more than that Greeks were at that time familiar in the Levant” (Niemeier 2001, 17). According to Strabo the geographer (13.2.3), “Mytilene produced famous men: in olden times Pittacus… and the poet Alcaeus and his brother Antimenidas, who according to Alcaeus performed a great feat while fighting as ally of the Babylonians, and rescued them from trouble by killing a warrior who, he says, was only one palm’s breadth short of five royal cubits.” Alcaeus probably refers to Antimenidas in an extant fragment: “You have come from the ends of the earth with the hilt of your sword ivory bound with gold” (fr. 350 in Campbell 1982 with both tr.). An ancient commentary (scholion) on this fragment specifies that Antimenidas achieved his spectacular deed during Nebuchadnezzar’s campaign against Ascalon in 604 (Quinn 1961; Braun 1982a, 22). Alcaeus himself may have entered foreign service while in exile (Kaplan 2002, 234-35). Reliable textual and documentary information thus helps us etablish a terminus ante quem in 664 or perhaps even 681 for the presence of Carian and Greek/Ionian mercenaries in the Near East. Their numbers increased dramatically when Psammetichus and his successors made large-scale use of this resource. A magnificent Cypro-Phoenician silver bowl from Amathus, dated to 710-675 BCE (Markoe 1985, 151-56), shows East Greek hoplites, together with Assyrian archers, horsemen, and chariots, among the attackers and defenders of a citadel (Cy4 in Markoe 1985, 51-52, 172-74). As Niemeier concludes (2001, 21), whether “the scene represented is a mythological… or a real one…, there is no doubt that the Amathus bowl reflects warlike events in the Near East around 700 B.C., in which Greek hoplites were involved.” All this brings us close to the time of the composition of the Homeric epics, which, for good reasons, do not mention mercenaries (but see Bettalli 1995, 39-40; Morgan 2001, 29, 36; Rollinger 2001, 256). Several scholars have proposed recently that these Greek and Carian mercenaries in the Near East, apparently forming only small groups among much larger

15

What Antikritos (Addikritusu), a (Cypriote?) Greek mentioned in a letter of the time of Asarrhadon, did in the eastern part of the Assyrian empire is unknown: see Rollinger and Korenjak 2001, esp. 333.

Archaic Greek Aristocrats

209

numbers of native soldiers, must have been members of the elite.16 They were driven by misfortune, civil strife, and exile, or a spirit of adventure. As Philip Kaplan puts it (2002, 241), “To be a soldier of fortune, one must not only be able to afford arms, one must also be trained to use them. In addition, one must have the education to function in a foreign society and to make contact, directly or through officers, with the sort of people who are likely to hire mercenaries. The evidence… certainly suggests that it was a literate elite from eastern Greece that made contact, perhaps through the mediation of their Carian neighbors, with the powers of the Eastern Mediterranean.” These suggestions may well be correct but none of them supports the view, contradicted by all historical analogies we know, that early mercenary service in the Near East was exclusively or mostly an elite phenomenon.17 Moreover, recent work on Homeric warfare has dispelled the long-held view that only elite warriors wore the panoply and excelled as well-trained, almost professional fighters, while the masses of commoners were poorly equipped and ineffective in battle. Closer inspection reveals that the poet assumes the masses as well to be armed with the panoply; they fight in formations and tactics that clearly foreshadow the hoplite phalanx, and they play a crucial role in deciding the battle.18 The Homeric “proto-hoplites” were thus commoners who fought side-byside with their elite leaders, and I see no good reason to think that the hoplite mercenaries showing up in the Near East were different.19 In fact, we should consider the possibility that elite leaders (perhaps like Antimenidas a century later), used to undertaking raiding expeditions with their own warrior bands (Jackson 1993; Raaflaub 1997, 51-52), discovered that there were other profitable ways to employ such bands and offered their services to interested buyers; even to their followers, the expected rewards would have seemed attractive (Morgan 2001, 34-35). I do not believe, therefore, that we should consider the mercenary, as Bettalli (1995, 23) suggests, only as an isolated individual, completely cut loose from all social ties connecting him to his native community. In fact, Herodotus tells us that the first Ionian and Carian mercenaries in Egypt had left home on a raiding expedition (2.152). Similarly, a pattern of raiding and trading expeditions may have preceded the appearance of Carian and Greek mercenaries in Cilicia and the Levant (Bettalli 1995, 52; Luraghi 2003). As Catherine Morgan observes, “military mobility forms part of a complex pattern of commercial and political interaction and cannot be understood in isolation” (2001, 37). Clearly, then, Eurybatus and Phanes had their predecessors, probably from the late eighth or at least the early seventh century. Some of these elite mercenary generals must have returned to Greece (as Antimenidas and Pedon did) and held important positions in their communities. The analogy to successful raiders (as de16 17 18 19

Bettalli 1995, 24-27, 52, 108-9; Niemeier 2001, 23-24; Kaplan 2002, 241. Rollinger 2001, 256; Luraghi 2003 also oppose this view. See recently van Wees 1994, 1997, 2000; Raaflaub 1997, forthcoming. Bettalli 1995, 101-5; van Wees 2000 ephasize correctly that these early hoplites must have been able to fight individually as well as in close formation. On leaders and followers, see Donlan 1994.

210

Kurt A. Raaflaub

scribed in the story of Odysseus “the Cretan,” mentioned above) and traders (below) seems obvious. Hoplites were respected members of their communities. What a hoplite mercenary or general coming back from foreign service had to tell would have been taken seriously — much more seriously, at any rate, than the tales of a common trader. The self-confidence and independence of such types is well attested in the fragments of Archilochus and Hybrias, who both taunt their spear as the source of their wealth and power.20

Traders and Travelers I am interested here only in elite traders, and I do not distinguish between these and elite travelers who on the side engaged in trade and other forms of exchange.21 The prime example here is Sostratos, son of Laodamas, of Aegina, whom Herodotus considers the unsurpassed leader in profits from trade (4.152.3). The dedication on an anchor found in Gravisca, the harbor of Tarquinia, dating to the late sixth or early fifth century, reads: “I belong to Aeginetan Apollo; Sostratos, son of …, had me made.” About one hundred Attic vases found in Etruria and dated to ca. 535-505 bear the trademark SO, suggesting that Sostratos specialized in trade with Etruria (Möller 2000, 56-57 with bibliog.). Herodotus mentions Sostratos incidentally, while telling a story connected with the foundation of Cyrene (ca. 630). One Kolaios of Samos, captain of a ship on the way to Egypt, was blown off course twice by storms, the second time all the way through the pillars of Heracles to Tartessos. “This trading center was virgin territory at the time, and consequently Kolaios came home with the biggest profit any Greek trader we have reliable information about has ever made from his cargo” (except for Sostratos)! He spent ten percent of his profit, six talents, on a bronze vessel in the style of an Argive bowl with protruding griffin heads, supported by three kneeling bronze figures, each seven cubits high. This bowl was dedicated, of course, in the Heraion of Samos (4.152; on Kolaios, see Möller, 5455). Samian trade with Egypt from the seventh century is documented abundantly by bronzes and ivories in this very sanctuary (Shipley 1987, 54-65; Haider 1988, 208-9). Herodotus also tells us about Charaxos of Mytilene, the brother of Sappho (2.134-35). He became famous because he spent a great deal of money to buy the freedom of the renowned courtesan Rhodopis, who had been brought to Egypt by another Samian, Xanthos. Rhodopis became wealthy enough to make her own dedication to Apollo in Delphi (a bundle of ox-sized iron spits, which “even today are still lying in a pile behind the altar which the Chians dedicated and in front of the actual temple”). Sappho’s poetry attests to the embarrassment Charaxos 20 Archil. fr. 2 in West 1971; Hybrias: no. 909 in Page 1962; on the latter, see Page 1965; Gehrke 1997, 29 (with a different interpretation). 21 The nature of trade in the Archaic Period is much debated; see recently Tandy 1997; Foxhall 1998; Möller 2000, esp. ch. IV. See also Tandy, this volume. On trade and cultural influences, see Patzek 1996 (with further bibliog.).

Archaic Greek Aristocrats

211

caused his family, although she speaks of Doricha; we do not know whether this was another woman or a different name for Rhodopis (frs. 5 and 15 in Campbell 1982). Strabo in turn tells us the reason why Charaxos traveled to Egypt in the first place: he brought wine to Naucratis (17.1.33; cf. Möller 2000, 55). Strabo does not say, and it is not important here, whether he did this once or several times. What matters is that this is a Greek elite person who went to Egypt, apparently stayed there for a while, and returned home. Greek sources thus allow us to trace this type of traveler back to the time of Sappho, that is, no later than the early sixth century. The travels of Solon the Athenian, if authentic, would fit the same pattern and time (Möller, 55-56). Nothing prevents us from assuming that Charaxos had many predecessors, some of them probably even in the century before colonization began. That Greek traders lived in many sites of Cilicia and the Levant from at least the early seventh century is suggested by the distribution of Greek pottery (Haider 1996; Lanfranchi 2000; Niemeier 2001). They had their own settlement in Naucratis from the early sixth century (Möller 2000) and formed enoikismoi elsewhere as well (Haider 1996, 103-4). The Iliad mentions a market in the Achaean camp, where elite traders from nearby islands exchanged wine for booty (7.467). This is an incidental remark, thus describing something well familiar to the audience and taken for granted in the late eighth or early seventh century. Similarly, in the Odyssey (1.179-89), Athena assumes the persona of Mentes, a friend of Odysseus’ family, who is described as an elite leader on his way, with a crew of companions, to trade a ship load of iron against bronze (Patzek 1996, 27). In his contribution to this volume, David Tandy discusses related evidence from lyric poetry and Walter Donlan that from the epics (Donlan 1997). Their results are clear: Greek elite persons often were involved in extensive travel abroad, and their travel was usually combined with some form of trade or exchange of goods or gifts. Such activities were perfectly compatible with an elite ideology that focused on fighting and raiding and despised the professional trader, whether Greek or Phoenician.

Conclusion Scattered though it is, and mostly reduced to single examples that were especially memorable, enough evidence survives to illustrate the important role Greek elite persons played in interactions and exchanges between the Archaic Greek world and that of the ancient Near East and Egypt. Hints in the epics and other early Greek poetry as well as Near Eastern sources permit us to trace the activities of such persons long before the emergence of the Persian empire, to the early sixth, the seventh and even the late eighth century. The names we know form just the tip of an iceberg, and it is almost certain that at least some of the categories of persons we discussed had predecessors in the tenth, ninth, and early eighth centuries. The evidence assembled here suggests that Greek elite persons in various functions (as mercenary officers, specialists, traders and travelers, and colonizers, raiders, or adventurers) had frequent and often intensive contacts with the cultur-

212

Kurt A. Raaflaub

ally superior areas of the eastern and southern Mediterranean or, elsewhere in the Mediterranean, with representatives of these areas. Some hints (such as the characterization of Mentes and Odysseus “the Cretan” in the Odyssey, Philippus of Croton, and perhaps one or the other of the mercenary generals, all discussed above) suggest that aristocrats with their bands of followers and companions (Donlan 1994) pursued various purposes, according to circumstances and opportunities; they went on raiding or trading expeditions or hired themselves out as mercenaries. It does not seem far-fetched to assume that some of these elite persons served as transmitters of intellectual issues and political ideas, whether practical or theoretical, and that they did this precisely in the period in which the Greek polis and its institutions were shaped and refined. Barbara Patzek (1996, 27-32) argues plausibly that exchange by trade concerned what we might call “cultural forms,” that is, objects and technology, and in itself did not affect “cultural contents,” that is, ideas, social values, and institutions. In other words, the integration of cultural forms did not prompt the imitation of their social or political contexts. This confirms my thesis: influences on the level of cultural contents and most importantly on that of social and political institutions could only be transmitted by persons who enjoyed high status and social prestige in the receiving society. The transmitters on that level had to be Greek elite persons. That there was no lack of such potential transmitters—this, and only this, was to be demonstrated in this chapter. The next question is what such intellectual issues and political ideas might have been, where they originated, how they were integrated into the rather different world of the emerging Greek poleis, and how they were transformed and filled with new contents and meanings in the very process of such integration.22

22 I thank Robert Rollinger for valuable comments and suggestions and Nino Luraghi for drawing my attention to the silver bowl from Amathus and to recent scholarship on mercenaries.

Archaic Greek Aristocrats

213

Bibliography Ampolo, Carmine, and Edda Bresciani. 1988. “Psammetico re d’Egitto e il mercenario Pedon.” Egitto e Vicino Oriente 11, 237-53. Aro, Sanna, and R. M. Whiting, eds. 2000. The Heirs of Assyria. Melammu Symposia 1. Helsinki. Asheri, D. 1990. Erodoto, Le Storie, Libro III: La Persia. Milan. Aubet, M. E. 1993. The Phoenicians in the West: Politics, Colonies and Trade. Cambridge. Austin, M. M. 1970. Greece and Egypt in the Archaic Age. PCPS supp. 2. Cambridge. ----. 1990. “Greek Tyrants and the Persians, 546-479 B.C.” CQ 40, 289-306. Bettalli, M. 1995. I mercenari nel mondo greco, vol. I: Dalle origini alla fine del V secolo a.C. Pisa. Braun, T. F. R. G. 1982a. “The Greeks in the Near East.” CAH 3.32, 1-31. ----. 1982b. “The Greeks in Egypt.” Ibid. 32-56. Burkert, Walter. 1983. “Itinerant Diviners and Magicians: A Neglected Element in Cultural Contacts.” In R. Hägg, ed., The Greek Renaissance of the Eighth Century B.C.: Tradition and Innovation, 115-19. Stockholm. ----. 1992. The Orientalizing Revolution: Near Eastern Influence on Greek Culture in the Early Archaic Age. Cambridge (Mass.). Campbell, D. A., ed., tr. 1982. Greek Lyric, I. Loeb Classical Library 142. Cambridge Mass. Coldstream, J. N. 1982. “Greeks and Phoenicians in the Aegean.” In Niemeyer 1982, 261-75. Connor, W. R. 1993. “The Histor in History.” In Ralph M. Rosen and Joseph Farrell, eds., Nomodeiktes: Greek Studies in Honor of Martin Ostwald, 3-15. Ann Arbor (Michigan). Donlan, Walter. 1980. The Aristocratic Ideal. Lawrence (Kansas). Repr. in id. 1999, 1-222. ----.1997. “Homeric Economy.” In Morris and Powell 1997, 649-67. ----.1994. “Chiefs and Followers in Pre-State Greece.” In David Tandy and C. Duncan, eds., From Political Economy to Anthropology, 34-51. Montréal. Repr. in Donlan 1999, 345-57. ----. 1999. The Aristocratic Ideal and Selected Papers. Wauconda (Illinois). Dougherty, Carol. 1993. The Poetics of Colonization: From City to Text in Archaic Greece. New York and Oxford. Edwards, Mark W. 1991. The Iliad: A Commentary, vol. V: books 17-20. Cambridge. Effenterre, Henri van, and Françoise Ruzé. 1994. Nomima. Recueil d’inscriptions politiques et juridiques de l’archaïsme grec. Rome. Foxhall, Lin. 1998. “Cargoes of the Heart’s Desire: The Character of Trade in the Archaic Mediterranean World.” In Nick Fisher and Hans van Wees, eds., Archaic Greece: New Approaches and New Evidence, 295-309. London and Swansea. Gehrig, Ulrich. 1990. “Die Phönizier in Griechenland.” In Gehrig and Niemeyer 1990, 21-32.

214

Kurt A. Raaflaub

Gehrig, Ulrich, and H. G. Niemeyer, eds., Die Phönizier im Zeitalter Homers. Mainz. Gehrke, Hans-Joachim. 1997. “Gewalt und Gesetz. Die soziale und politische Ordnung Kretas in der Archaischen und Klassischen Zeit.” Klio 79, 23-68. ----. 2000. “Verschriftung und Verschriftlichung sozialer Normen im archaischen und klassischen Griechenland.” In E. Lévy, ed., La codification des lois dans l’antiquité, 141-59. Strasbourg. Graham, A. J. 1982a. “The Colonial Expansion of Greece.” CAH 3.32, 83-162. ----. 1982b. “The Western Greeks.” Ibid. 163-95. Griffiths, A. 1987. “Democedes of Croton: A Greek Doctor at Darius’ Court.” In Heleen Sancisi-Weerdenburg and Amélie Kuhrt, eds., Achaemenid History II: The Greek Sources, 37-51. Leiden. Gschnitzer, Fritz. 1981. Griechische Sozialgeschichte von der mykenischen bis zum Ausgang der klassischen Zeit. Stuttgart. Haider, Peter W. 1988. Griechenland – Nordafrika. Ihre Beziehungen zwischen 1500 und 600 v. Chr. Darmstadt. ----. 1996. “Griechen im Vorderen Orient und in Ägypten bis ca. 590 v. Chr.” In Ulf 1996, 59-115. ----. 2004. “Kontakte zwischen Griechen und Ägyptern und ihre Auswirkungen auf die archaisch-griechische Welt.” In Rollinger and Ulf 2004, 447-491. Hammond, N. G. L., and L. J. Roseman. 1996. “The Construction of Xerxes’ Bridge over the Hellespont.” JHS 116, 88-107. Hartog, François. 1988. The Mirror of Herodotus: The Representation of the Other in the Writing of History. Tr. Janet Lloyd. Berkeley and Los Angeles. Helck, Wolfgang. 1995. Die Beziehungen Ägyptens und Vorderasiens zur Ägäis bis ins 7. Jahrhundert v. Chr. 2d ed., rev. by Rosemarie Drenkhahn. Darmstadt. Hoffman, Gail L. 1997. Imports and Immigrants: Near Eastern Contacts with Iron Age Crete. Ann Arbor. Hofstetter, Josef. 1978. Die Griechen in Persien. Prosopographie der Griechen im persischen Reich vor Alexander. Berlin. Humphreys, S. C. 1978. Anthropology and the Greeks. London. ----. 1993. “Diffusion, Comparison, Criticism.” In Raaflaub and Müller-Luckner 1993, 1-11. Jackson, Alastar. 1993. “War and Raids for Booty in the World of Odysseus.” In John Rich and Graham Shipley, eds., War and Society in the Greek World, 6476. London. Kammerzell, F. 1993. Studien zu Sprache und Geschichte der Karer in Ägypten. Wiesbaden. Kaplan, Philip. 2002. “The Social Status of the Mercenary in Archaic Greece.” In Vanessa B. Gorman and Eric W. Robinson, eds., Oikistes: Studies in Constitutions, Colonies, and Military Power in the Ancient World Offered in Honor of A. J. Graham, 229-43. Leiden. Karavites, Panayotis. 1992. Promise-Giving and Treaty-Making. Homer and the Near East. Leiden.

Archaic Greek Aristocrats

215

Koerner, Reinhard. 1993. Inschriftliche Gesetzestexte der frühen griechischen Polis, ed. by Klaus Hallof. Cologne. Lanfranchi, G. B. 2000. “The Ideological and Political Impact of the Assyrian Imperial Expansion on the Greek World in the 8th and 7th Centuries BC.” In Aro and Whiting 2000, 7-34. Latacz, Joachim. 1990. “Die Phönizier bei Homer.” In Gehrig and Niemeyer 1990, 11-21. Londey, Peter. 1990. “Greek Colonists at Delphi.” In Jean-Paul Descoeudres, ed., Greek Colonists and Native Populations, 117-27. Canberra and Oxford. Luraghi, Nino. 2003. “A Carian Sort of Allies: Greek Mercenary Soldiers in the Mediterranean World.” Unpublished lecture given at the spring 2003 meeting of the New England Colloquium of Ancient History at Brown University. Malkin, Irad. 1987. Religion and Colonization in Ancient Greece. Leiden. ----. 1989. “Delphoi and the Founding of Social Order in Archaic Greece.” Metis 4, 129-53. ----. 1994. Myth and Territory in the Spartan Mediterranean. Cambridge. Markoe, Glenn. 1985. Phoenician Bronze and Silver Bowls from Cyprus and the Mediterranean. Berkeley and Los Angeles. Masson, O., and J. Yoyotte. 1988. “Une inscription ionienne mentionnant Psammétique Ier.” Epigraphica Anatolica 11, 171-79. Matthäus, Hartmut. 1993. “Zur Rezeption orientalischer Kunst-, Kultur- und Lebensformen in Griechenland.” In Raaflaub and Müller-Luckner 1993, 165-86. Möller, Astrid. 2000. Naukratis: Trade in Archaic Greece. Oxford. Morgan, Catherine. 1990. Athletes and Oracles: The Transformation of Olympia and Delphi in the Eighth Century BC. Cambridge. ----. 2001. “Symbolic and Pragmatic Aspects of Warfare in the Greek World of the 8th to 6th Centuries BC.” In T. Bekker-Nielsen and L. Hannestad, eds., War as a Cultural and Social Force: Essays on Warfare in Antiquity, 20-44. Copenhagen. Morris, Ian, and Barry Powell, eds. 1997. A New Companion to Homer. Leiden. Morris, Sarah P. 1992. Daidalos and the Origins of Greek Art. Princeton. Niemeier, Wolf-Dietrich. 2001. “Archaic Greeks in the Orient: Textual and Archaeological Evidence.” BASOR 322, 11-32. Niemeyer, Hans-Georg, ed. 1982. Phönizier im Westen. Mainz. ----.1984. “Die Phönizier und die Mittelmeerwelt im Zeitalter Homers.” Jahrbuch des Römisch-Germanischen Zentralmuseums Mainz 31, 3-94. Page, D. L., ed. 1962. Poetae Melici Graeci. Oxford. ----. 1965. “The Song of Hybrias the Cretan.” PCPS 191, 62-65. Patzek, Barbara. 1996. Griechen und Phöniker in homerischer Zeit. Fernhandel und der orientalische Einfluss auf die frühgriechische Kultur. Münstersche Beiträge zur antiken Handelsgeschichte 15.2, 1-32. Quinn, J. D. 1961. “Alcaeus 48 (B 16) and the Fall of Ascalon (604 B.C.).” BASOR 164, 19-20.

216

Kurt A. Raaflaub

Raaflaub, Kurt A. 1997. “Soldiers, Citizens, and the Evolution of the Early Greek Polis.” In Lynette G. Mitchell and P. J. Rhodes, eds., The Development of the Polis in Archaic Greece, 49-59. London. ----. 2000. “Influence, Adaptation, and Interaction: Near Eastern and Early Greek Political Thought.” In Aro and Whiting 2000, 51-64. ----. 2004. “Zwischen Ost und West: Phönizische Einflüsse auf die griechische Polisbildung?” In Rollinger and Ulf 2004, 271-289. ----. Forthcoming. “Die homerischen Krieger als Proto-Hopliten? Alte Fragen, neue Antworten.” In B. Meissner et al., eds., Krieg, Gesellschaft, Institutionen. Kriegführung und Kultur in der Antike. Raaflaub, Kurt, and Elisabeth Müller-Luckner, eds. 1993. Anfänge politischen Denkens in der Antike: Die nahöstlichen Kulturen und die Griechen. Munich. Rhodes, P. J. 1981. A Commentary on the Aristotelian Athenaion Politeia. Oxford. Rollinger, Robert. 1996. “Altorientalische Motivik in der frühgriechischen Literatur am Beispiel der homerischen Epen. Elemente des Kampfes in der Ilias und in der altorientalischen Literatur (nebst Überlegungen zur Präsenz altorientalischer Wanderpriester im früharchaischen Griechenland).” In Ulf 1996, 156210. ----. 2001. “The Ancient Greeks and the Impact of the Ancient Near East. Textual Evidence and Historical Perspective (ca. 750-650 BC).” In R. M Whiting, ed., Mythology and Mythologies, 233-64. Melammu Symposia 2. Helsinki. ----. 2004. “Die Verschriftlichung von Normen: Einflüsse und Elemente orientalischer Kulturtechnik in den homerischen Epen, dargestellt am Beispiel des Vertragswesens.” In Rollinger and Ulf 2004, 369-445. Rollinger, Robert, and Martin Korenjak. 2001. “Addikritusu: ein namentlich genannter Grieche aus der Zeit Asarhaddons (680-669 v. Chr.). Überlegungen zu ABL 140.” Altorientalische Forschungen 28, 372-84. Rollinger, Robert, and Christoph Ulf, eds. 2004. Griechische Archaik: Interne Entwicklungen – Externe Impulse. Berlin. Rosenberger, Veit. 2003. “Reisen zum Orakel. Griechen, Lyder und Perser als Klienten hellenischer Orakelstätten.” In Markus Witte and Stefan Alkier, eds., Die Griechen und der Vordere Orient. Beiträge zum Kultur- und Religionskontakt zwischen Griechenland und dem Vorderen Orient im 1. Jahrtausend v. Chr, 25-57. Freiburg (Switzerland) and Göttingen. Sacks, Kenneth. 2003. “The Transmission of Ideas by and among Non-Elites.” Unpublished lecture given in April 2003 in the Brown University Seminar on Cultures and Religions of the Ancient Mediterranean. Seybold, Klaus, and Jürgen von Ungern-Sternberg. 1993. “Amos und Hesiod. Aspekte eines Vergleichs.” In Raaflaub and Müller-Luckner 1993, 215-39. Shaw, J. W. 1989. “Phoenicians in Southern Crete.” AJA 93, 165-83. Shipley, Graham. 1987. A History of Samos 800-188 BC. Oxford. Stein-Hölkeskamp, Elke. 1989. Adelskultur und Polisgesellschaft. Studien zum griechischen Adel in archaischer und klassischer Zeit. Stuttgart. Szegedy-Maszak, Andrew. 1978. “Legends of Greek Lawgivers.” GRBS 19, 199209.

Archaic Greek Aristocrats

217

Tandy, David W. 1997. Warriors into Traders: The Power of the Market in Early Greece. Berkeley and Los Angeles. Ulf, Christoph, ed. 1996. Wege zur Genese griechischer Identität. Die Bedeutung der früharchaischen Zeit. Berlin. Walser, Gerold. 1984. Hellas und Iran. Studien zu den griechisch-persischen Beziehungen vor Alexander. Darmstadt. Waterfield, Robin, tr. 1998. Herodotus: The Histories. Oxford. Wees, Hans van. 1994. “The Homeric Way of War.” GaR 41, 1-18, 131-55. ----. 1997. “Homeric Warfare.” In Morris and Powell 1997, 668-93. ----. 2000. “The Development of the Hoplite Phalanx: Iconography and Reality in the Seventh Century.” In id., ed., War and Violence in Ancient Greece, 12566. London and Swansea. West, M. L., ed. 1971. Iambi et Elegi Graeci Ante Alexandrum Cantati, I. Oxford. ----. 1997. The East Face of Helicon: West Asiatic Elements in Greek Poetry and Myth. Oxford.

ZUR AKTUALITÄT DER WIRTSCHAFTSANTHROPOLOGIE KARL POLANYIS Astrid Möller Durch die stockende Konjunktur und die immer umfassender werdende Globalisierung der Wirtschaft scheinen die Selbstzweifel unter denjenigen Wirtschaftswissenschaftlern zuzunehmen, die danach streben, mit Hilfe formalisierter Modelle realexistierende ökonomische Entwicklungen zu erfassen, wenn nicht gar vorherzusagen. Gleichzeitig führt die Globalisierung Konflikte verschiedener Denkungsarten vor Augen und regt die Frage nach den kulturellen Hintergründen unterschiedlicher Wirtschaftsweisen an. Folglich wenden sich manche Wirtschaftswissenschaftler wieder stärker den Rahmenbedingungen für wirtschaftliches Handeln zu, wie Werten, Traditionen, Gebräuchen und geschriebenen wie ungeschriebenen gesellschaftlichen Regeln. Diese wurden bislang durch eine Wirtschaftswissenschaft, die sich als strenge Wissenschaft verstand und an gewisse Gesetzmäßigkeiten des Marktes glaubte, die sich gegen alle politischen Steuerungsversuche stets durchsetzen würden, weitgehend ausgeklammert. In den letzten Jahren oder Jahrzehnten haben sich verschiedene ökonomische Schulen gebildet, die den kulturellen Faktoren mehr Gewicht einräumen. Die vielleicht zur Zeit bekannteste Schule ist die von Douglass C. North begründete Neue Institutionenökonomie (neo-institutional economics). Nach North (1991, 97) sind Institutionen die auf sozialer Übereinkunft beruhende Einschränkungen, die politische, wirtschaftliche und soziale Interaktionen strukturieren. Sie bestehen aus informellen Zwängen (Sanktionen, Tabus, Sitten und Gebräuchen, Traditionen, Verhaltensregeln) und formellen Regeln (Verfassungen, Gesetze, Eigentumsrechte). Zusammen mit den üblichen wirtschaftlichen Beschränkungen bilden sie den Vorrat an Verhaltensmöglichkeiten und bestimmen daher die Transaktions- und Produktionskosten sowie die Rentabilität und Durchführbarkeit ökonomischen Handelns. Trotz der Berücksichtigung gesellschaftlicher Rahmenbedingungen hat sich dieser Ansatz nicht von der als universal angenommenen Maxime, daß ökonomische Aktivitäten grundsätzlich der Maximierung des Nutzens oder des Reichtums dienen, losgesagt. Die traditionelle Neoklassik verbindet sich hier mit etwas Institutionalismus,1 wobei der Schwerpunkt nach wie vor auf den formalisierten Analysen liegt. Letztlich gewinnt man den Eindruck, daß beim neoinstitutionalistischen Ansatz der Wirtschaftsgeschichte nicht wirklich die Institutionen im Mittelpunkt der Analyse stehen, sondern die formalisierbaren Transaktionskosten, die zwar durch gesellschaftliche Rahmenbedingungen, die Institutionen, mitbestimmt, jedoch nicht gänzlich gestaltet werden. Diese Vermutung wird durch das neo-institutionalistische Verständnis des Marktes bestätigt. Zum Teil wird er als ökonomische Organisation bezeichnet, worunter funktionelle Körperschaften oder Gruppen, die für spezielle Zwecke in Übereinstimmung mit institutionellen Beschränkungen gebildet werden, verstan1

Eggertsson 1990, xii, strebt explizit eine Synthese von Neoklassik und Institutionalismus an, die er „Neo-institutional Economics“ (NIE) nennt.

Astrid Möller

219

den werden. So können die Neo-Institutionalisten erklären, daß Firmen Märkte ersetzen und drei Organisationen die Arbeitsteilung in einer Gesellschaft koordinieren: der Markt durch das Mittel des Wettbewerbs, der Staat durch Zwangsmittel und die Gemeinschaft durch Kooperation. Alle drei interagieren und formen so die wirtschaftliche Entwicklung. Der Markt scheint andererseits als einziges außerhalb einschränkender Sozialbeziehungen und damit losgelöst von den institutionellen Beschränkungen zu stehen. Die einzige Einschränkung für Märkte sind die Transaktionskosten, die, sind sie zu hoch, die Bildung (freier) Märkte behindern. In jedem Fall läßt sich der neo-institutionalistischen Schule vorwerfen, daß sie den Markt als naturgegebenen Bestandteil der Wirtschaft hinnimmt und seine historische Entstehung und Entwicklung nicht berücksichtigt. Daß sich Märkte als historische Institutionen entwickeln, wurde von einem Vertreter der ‚älteren‘ Institutionenanalyse, Karl Polanyi (1886-1964),2 aufgezeigt.3 Den Markt als Institution zu bezeichnen (cf. Maucourant 1996, 136-7), heißt ihn als eine mögliche Sozial- und Wirtschaftsbeziehung neben anderen zu sehen und ihn nicht als einzig mögliche Wirtschaftsform hinzunehmen. Polanyi griff die zu seiner Zeit vorherrschende neoklassische Wirtschaftstheorie an, die von der grundlegenden Prämisse ausging, daß Ökonomie das Verhalten von Menschen bezeichne, die angesichts der Knappheit von Ressourcen eine Selektion von Mitteln und Zielen bezüglich deren Erlangung und Verwendung vornehmen müssen. So betrachtet, läßt sich menschliches ökonomisches Verhalten weitgehend formalisieren bzw. berechnen. Polanyi kritisierte, daß die Neoklassiker ‚wirtschaftlich‘ nur unter dem Aspekt des Wirtschaftens mit knappen Mitteln verstehen würden, während ‚wirtschaftlich‘ doch auch viel grundlegender die Versorgung mit Gütern und Dienstleistungen meint. Eine Formalisierung der Ökonomie als des Verhaltens von Menschen, die angesichts der Knappheit von Ressourcen eine Selektion von Mitteln und Zielen vornehmen, sei nicht universal anwendbar. Die zweite Bedeutung von ‚wirtschaftlich‘ als Versorgung mit Lebensnotwendigem in Abhängigkeit von der Natur (Polanyi 1968, 139) steht im Zentrum seines Ansatzes, den er gegen den formalistischen der Neoklassiker formulierte. Dieser substantivistische, oder auch institutionalistische, Ansatz der Wirtschaftswissenschaft untersucht nicht die Wirtschaft, sondern Wirtschaften, d.h. die Art und Weise, wie sich Menschen mit dem Lebensnotwendigen versorgen. Es werden weder allgemein gültige Ziele, noch Methoden, noch eine universale Logik vorausgesetzt. Im Zentrum der Analyse stehen die Institutionen (Neale 1987, 1180).4

2 3

4

Zu Polanyis Biographie vgl. Bohannan, Dalton 1965; Humphreys 1969=1978, 33-40; Halperin 1984, 248-9. Halperin 1984, 269 Anm. 4, weist daraufhin, daß man das institutionelle Paradigma nicht mit der amerikanischen Schule der (alten) Institutionenökonomie (Veblen, Commons, Mitchell) verwechseln sollte, die sich mit der Analyse des Kapitalismus befaßte und nicht mit Konzepten für transkulturelle Vergleiche; vgl. 250 für das institutionelle Paradigma. Halperin 1984 zeigt die Wurzeln auf, die Polanyi mit Karl Marx verbinden, deren gemeinsame Grundlage die Institutionen als Schlüsseleinheiten der Analyse darstellten. Polanyi lehnte allerdings den wirtschaftlichen Determinismus der marxschen Lehre ab.

220

Wirtschaftsanthropologie Karl Polanyis

Um seine Theorie zu untermauern, verlegte Polanyi die Argumentation in einen historischen und kulturanthropologischen Kontext. Für ihn brachte die historische und anthropologische Forschung die Erkenntnis, daß „die wirtschaftliche Tätigkeit des Menschen in der Regel in seine Sozialbeziehungen eingebettet ist. Sein Tun gilt nicht der Sicherung seines individuellen Interesses, sondern der Sicherung seines gesellschaftlichen Rangs, seiner gesellschaftlichen Ansprüche und seiner gesellschaftlichen Wertvorstellungen“ (Polanyi 1944=1978, 75).5 Seine Fragestellung ist bestens mit heutigen kulturgeschichtlichen Ansätzen vereinbar. Durch die so betriebene historische Kontextualisierung seiner Theorien entsteht leicht der Verdacht, er habe eine rückwärts gewandte, romantische Utopie geschaffen.6 Die Marktlosigkeit vergangener Kulturen läßt sich jedoch recht gut belegen, obwohl bei genauerer Betrachtung einzelne Marktelemente vorkommen können, ohne daß sich die spezifische Wirtschaft als Marktwirtschaft bezeichnen ließe. Kosten-Nutzen-Rechnungen sind in nicht-marktwirtschaftlichen Gesellschaften weder unbekannt noch ausgeschlossen, aber durch Mentalitäten, gesellschaftliche Regeln und religiöse Vorstellungen eingeschränkt. Selbst in einer Marktwirtschaft werden Kosten-Nutzen-Rechnungen häufig durch gesellschaftliche Rahmenbedingungen bestimmt, indem man z.B. bereit ist, für einen Zugewinn an sozialem Status und gesellschaftlichem Prestige viel mehr für ein Auto auszugeben, als nötig wäre, um gemütlich zur Arbeit oder zum Einkaufen zu fahren. In seinem 1944 erschienenen Werk „The Great Transformation“ analysierte Polanyi die Entwicklung der Wirtschaftsformen. Seiner Meinung nach kam es durch die Herausbildung der liberalen Marktwirtschaft im 18. und 19. Jh. zur Herauslösung der Ökonomie aus der Gesellschaft, die nicht länger in die Gesellschaft eingebettet war und zu einem separaten Sektor wurde. Er suchte die gesellschaftliche Bedeutung eines spezifischen Wirtschaftssystems, nämlich der Marktwirtschaft, wie sie im 19. Jh. ihren Höhepunkt erreichte, zu enthüllen. Gleichzeitig wollte er die Möglichkeit wie auch Notwendigkeit von Gesellschaftsordnungen, in denen die Ökonomie keine Eigengesetzlichkeit entfaltet, empirisch belegen. Die Idee des sich selbstregulierenden Marktes stellt für Polanyi eine „krasse Utopie“ (Polanyi 1944=1978, 19) dar, die grundlegend ambivalent ist: Zum einen enthält sie das Versprechen auf Wirtschaftswachstum und materiellen Reichtum, zum anderen stellt sie einen Angriff auf die menschliche und natürliche Substanz der Gesellschaft dar. Die wirtschaftsliberale Umwandlung der Gesellschaft im 18./19.Jh. war kein spontaner Vorgang. Der Markt war das Resultat einer bewußten und oft gewaltsamen Intervention von Seiten der Regierung, die der Gesellschaft die Marktorganisation aus nicht-ökonomischen Gründen aufzwang. Die Ideologie der freien Marktwirtschaft, die das Individuum absolut setzt, die sozialen Zwänge, die zwischen Menschen herrschen, zum Verschwinden brachte, und den rationa5 6

Der Gedanke der ‚Einbettung‘, wie der der Gegenseitigkeit (Reziprozität), stammt von Thurnwald 1932. Zu Thurnwald und Polanyi vgl. Wagner-Hasel 2000, 31-2, 41, 45-6. Maucourant 2000, 12, betont, daß die anti-marktorientierte Utopie nicht gleichbedeutend mit der Sehnsucht nach einer vor-marktwirtschaftlichen Welt sei.

Astrid Möller

221

len, eigennutzorientierten homo oeconomicus entstehen ließ, hätte die Gesellschaft als Ganzes zum Verschwinden gebracht (Polanyi 1944=1978, 87-9. 32931). 1977 widmete North Polanyis Werk einen Artikel, in welchem er dessen analytische Konzepte als Herausforderung für Wirtschaftshistoriker anerkannte (North 1977, 704). Auch wenn Polanyi nicht alle elementaren ökonomischen Prinzipien begriffen hätte (1977, 707), sollte man seiner Herausforderung durchaus begegnen. North schlägt vor, ein analytisches Raster zu entwickeln, das in der Lage sein müsse, vergangene und gegenwärtige institutionelle Strukturen zu erklären. Dieses Raster sieht North in der Berücksichtigung der Transaktionskosten, die seiner Meinung nach die Möglichkeit bieten, falsifizierbare Erklärungen nicht-marktwirtschaftlicher Formen wirtschaftlicher Organisationen, wie der Redistribution und der Reziprozität, zu liefern (1977, 709).7 Das Interesse an Karl Polanyi, dessen Werk Alternativen zur bestehenden und immer bedrohlicher wirkenden globalisierten Marktwirtschaft aufzeigt und kulturalistischen Ansätzen das Konzept der Einbettung der Wirtschaft in die sie umgebenden gesellschaftlichen und politischen Rahmenbedingungen bietet, scheint wieder gewachsen zu sein.8 Seine Theorien kommen dem Bedürfnis entgegen, sich aus angestammten Denkmustern, die alles unter dem Aspekt des Umgangs mit beschränkten Mitteln betrachten und komplexe Wirklichkeiten mit mathematischen Mitteln erfassen wollen, zu befreien. Zudem trifft sich Polanyis Ansatz mit der kulturalistischen Wende und einem erneuerten Historismus, der wirtschaftliches Handeln historisch und kulturell kontextualisieren will. Doch Polanyis Theorien als neues Paradigma vorzuschlagen, liegt mir fern.9 Seine konkrete Behandlung historischer Kulturen stößt in vielen Fällen zurecht auf Ablehnung, da seine Darstellungen häufig für Fachleute zu wenig differenziert sind oder auf inzwischen widerlegten Interpretationen basieren.10 Mir kommt es mehr darauf an, seinen methodischen Ansatz zu fördern, denn Polanyi hat einen deutlichen Weg aus der unsäglichen Modernismus-Primitivismus-Debatte aufgewiesen, indem er Konzepte und Begriffe entwickelte, die nicht in der modernen Marktwirtschaft kontextualisiert sind, sondern aufgrund empirisch gesammelter Befunde vorindustrialisierter Gesellschaften gebildet wurden. In idealtypischer Weise konzipierte Polanyi so Begriffe, die sich als heuristische Hilfsmittel zur Betrachtung von Gesellschaften

7

Für eine Auseinandersetzung mit dem Verständnis der Redistribution durch die NIE s. Maucourant 1996, 141-54; 1997. 8 Marc Van De Mieroop berichtete auf der diesem Band zugrundeliegenden publizierten Tagung, daß sich während der Vorstellung einer Neuauflage von Polanyis „Great Transformation“ (Boston: Beacon Press 2001, 2. Taschenbuchauflage) an der Columbia University New York mehrere hundert Zuhörer, vorwiegend aus der Politikwissenschaft und der neueren Geschichte versammelt hätten. Jérôme Maucourant (CNRS Lyon) fördert seit längerem die Verbreitung des Gedankenguts Karl Polanyis (1993; 2000; http//:www.ish-lyon.cnrs.fr/labo/walras/membres.htm). 9 Dalton 1975 und Gledhill, Larsen 1982 sahen in Polanyis Konzepten einst einen paradigmatischen Ansatz. 10 Eine grundsätzlich positive Einschätzung, wenn auch mit Einschränkungen, bei Nippel 1982; 1988, 303-9.

222

Wirtschaftsanthropologie Karl Polanyis

und ihrer Wirtschaften vor der industriellen Revolution eignen.11 Diese Begriffe beruhen weder auf der Voraussetzung des Marktes noch auf modernen Wirtschaftstheorien. Er wandte auch keine kultur-immanenten Begriffe der untersuchten Kulturen an. Polanyi übernahm oder schuf „dritte Begriffe“ (Meier 1980, 437), die weder unserer, der Welt der Beobachter, noch der Welt der Beobachteten angehören. Sie verhalten sich quasi neutral zu beiden Vorstellungswelten. Allerdings ist es schwierig, für Polanyi eine vollständig ausgearbeitete Wirtschaftstheorie zu postulieren. Die Schriften, die nach der „Great Transformation“ entstanden sind, fügen sich nicht leicht zu einer geschlossenen Theorie zusammen. Zudem sollte nicht vergessen werden, daß er seine einzelnen Konzepte idealtypisch entwickelte, was heißt, daß sie heuristische Modelle darstellen, in der formulierten Form aber nicht in der Realität auffindbar sind. Auch war er in seiner Terminologie nicht konsequent. Daher dürfte jede Darstellung seiner Konzepte über eine bloße Wiedergabe seiner Ideen hinausgehen und eigene Untersuchungsergebnisse und Interpretationen beinhalten. Als Grundlage seiner Konzepte dienten ihm die von seiner Arbeitsgruppe an der Columbia University während der 50er Jahren des 20. Jhs. gesammelten Materialen zu vormodernen Gesellschaften, aus denen er einzelne Konzepte oder Idealtypen entwickelte, die nun im einzelnen besprochen werden sollen.12 Den Ausgangspunkt bildet Polanyis Unterscheidung zwischen zwei Bedeutungen des Adjektivs ‚wirtschaftlich‘ (economic) (Polanyi 1968, 139-74): (1) Zum einen bedeutet es ‚sparsam‘, ‚ökonomisch‘ im Sinne des sparsamen Umgangs mit Ressourcen. So wird es von der neoklassischen Wirtschaftstheorie verwendet. Wirtschaften steht unter dem Aspekt des Haushalts, der mit knappen Mitteln das bestmögliche Resultat erzielen muß. Das ist die formale Bedeutung von ‚wirtschaftlich‘. (2) Wirtschaftlich kann aber auch nur ganz allgemein die Versorgung mit Gütern bezeichnen. Nach Polanyi hat ‚wirtschaftlich‘ zunächst in jeder Gesellschaft die Bedeutung strukturierter Vereinbarungen über die Versorgung mit materiellen Gütern. Dies ist die wesentliche, substantielle oder materiale13 Bedeutung von wirtschaftlich (the substantive meaning of economic). In der formalen Bedeutung wird wirtschaftlich als zweckrationales Handeln verstanden, das logischen Gesetzen folgt und sich arithmetisch ausdrücken läßt. Die meisten modernen Wirtschaftstheorien basieren auf dieser Grundlage. Wirtschaftliche Handlungen werden arithmetischen Berechnungen unterworfen und durch Gesetze und Formeln formalisiert. Auch die neo-institutional economics formalisieren letztlich ihre Untersuchungen mit Hilfe der sog. Transaktionskosten. Diese Kosten werden durch die Verfügbarkeit von Informationen, die Infrastruktur, geregelte Eigentumsverhältnisse und gesicherten Frieden gesteuert und sind 11 vgl. Möller 2000a, 3-5; 2000b; 2003. 12 Im folgenden werde ich auf eigene Übersetzungen der polanyischen Terminologie zurückgreifen. Die im Suhrkamp Verlag Frankfurt a.M. erschienene Übersetzung einiger ausgewählter Aufsätze, die 1979 unter dem Titel „Ökonomie und Gesellschaft“ erschien, halte ich für unbrauchbar. 13 Material im Ggs. zu formal: stofflich, inhaltlich.

Astrid Möller

223

Kosten, die entstehen, wenn Güter oder Dienstleistungen den Besitzer wechseln. Zwar wird bei diesem Ansatz den Institutionen besondere Beachtung geschenkt, die als gesellschaftliche Rahmenbedingungen das Verhalten von Individuen bestimmen, wie Gesetze, informelle Regeln, Konfliktregelungen, moralisches und ethisches Verhalten usw., untersucht werden sie aber im Hinblick auf das Interesse der Individuen oder Korporationen, bei knappen Ressourcen Wohlstand zu maximieren oder den größtmöglichen Nutzen daraus zu ziehen. Polanyis Wirtschaftstheorie basiert dagegen auf der Bedeutung von ‚wirtschaftlich‘, das kein logisches, zweckrationales Handeln voraussetzt, sondern wertrational bestimmt wird. D.h. wirtschaftliche Handlungen sind eingebettet in politische, soziale und kulturelle Gegebenheiten und werden durch wertende Postulate bestimmt. Diese substantielle Bedeutung sah Polanyi als die für die Kulturen vor der industriellen Revolution angemessene an. Vor der industriellen Revolution war die Wirtschaft in die Gesellschaft eingebettet.14 Durch diesen gravierenden Unterschied der antiken Kulturen, in denen die Wirtschaft keinen eigenen Sektor außerhalb der Gesellschaft darstellte, lassen sich diese Kulturen auch nicht mit dem Instrumentarium der modernen Wirtschaftstheorien analysieren, d.h. sie lassen sich nicht formalisieren, was aber nicht gleichbedeutend mit einer irrationalen Haltung der wirtschaftenden Subjekte ist. Die Instrumente zur Analyse wirtschaftlichen Handelns in der Antike müssen danach substantiell gebildet werden, d.h. unter Berücksichtigung der kulturellen Rahmenbedingungen und nicht formal in Abhängigkeit von zweckrationalen Überlegungen der Gewinnmaximierung durch sparsamen Umgang mit Ressourcen. Zu den Grundpfeilern des Polanyischen Ansatzes gehören die drei Integrationsmechanismen (patterns of integration), die der Verteilung von Gütern innerhalb einer Gesellschaft dienen und diese Gesellschaft gleichzeitig zusammenhalten (Polanyi 1968, 149, 151). Dalton (1975, 92) hat diese Integrationsmechanismen später Güterverteilungsarten (modes of transaction) genannt, was zwar die Verteilung von Gütern gut beschreibt, aber Polanyis Aspekt der Einheit von Wirtschaft und Gesellschaft ausblendet. Die Integrationsmechanismen sind die Grundstrukturen, die der Wirtschaft und Gesellschaft ihre Stabilität geben: (1) Redistribution, was die Bewegung von Gütern und Dienstleistungen in Richtung auf ein Verteilungszentrum und wieder weg von diesem beschreibt. (2) Reziprozität, was die Bewegung von Gütern zwischen einander entsprechenden Punkten symmetrischer Gruppierungen in der Gesellschaft, zumeist über persönliche Beziehungen, bezeichnet.15 (3) Marktaustausch: Die Bewegung von Gütern durch ein System von Angebot und Nachfrage, bei dem die Beziehungen zwischen Anbietern und Nachfragern unpersönlich sind und ausgehandelt werden müssen.

14 Natürlich läßt sich fragen, ob die Wirtschaft wirklich nach der Industriellen Revolution ihren politischen und gesellschaftlichen Rahmen verlassen hat. Andererseits agieren multinationale Konzerne weitgehend losgelöst von staatlichen Kontrollen. 15 Wagner-Hasel 2000, 52-9, hat den Reziprozitätsbegriff einer kritischen Betrachtung unterzogen; vgl. dort für weitere Literatur.

224

Wirtschaftsanthropologie Karl Polanyis

Ein vierter Integrationsmechanismus, die Haushaltung (Polanyi 1944, 53; cf. 1968, 307-8), stellt insofern eine Anomalie dar, als sie den ökonomischen Aspekt einer grundlegenden sozialen Einheit darstellt, während sich die anderen Integrationsmechanismen auf die Organisation wirtschaftlicher Beziehungen zwischen Einheiten beziehen. Um die jeweilige Organisation der Wirtschaft innerhalb einer Gesellschaft genau bestimmen zu können, schlug Polanyi die Analyse dreier Institutionen vor: (1) des Gebrauchs von Geld (money use), (2) des Handels oder externen Tauschs ([external] trade), (3) und der Marktelemente (market elements). Alle drei Institutionen existieren nach Polanyi auch ohne den Markt und im Gegensatz zur Marktwirtschaft können alle drei Institutionen auch unabhängig voneinander entstehen und bestehen. Daher muß deren Analyse, was so viel heißt wie deren Beschreibung aufgrund von Beobachtung und die Bestimmung von Regeln in ihrem Verhalten, getrennt voneinander erfolgen. Aus der Existenz der einen Institution darf in marktlosen Ökonomien nicht automatisch auf die Existenz einer anderen geschlossen werden. Polanyi schlägt für jede dieser Institutionen eine substantielle bzw. materiale Definition vor. (1) der Gebrauch von Geld (Polanyi 1968, 166-9, 175-203): Die substantielle Bedeutung von Geld entspricht dem Vorhandensein quantifizierbarer Objekte, die einer oder mehreren der folgenden Funktionen dienen: der Bezahlung, als Wertmaßstab und als Tauschmittel. Bezahlung ist die Erfüllung von Verpflichtungen, bei der quantifizierbare Objekte den Besitzer wechseln. Diese Gegenstände müssen aber der Erfüllung von mehr als einer Verpflichtung dienen, um als Mittel der Bezahlung zu gelten. Diese Art des Geldes wird üblicherweise mit primitiven, segmentierten Gesellschaften verbunden. Der Gebrauch von Geld als Wertmaßstab oder Rechnungseinheit dient der Vereinheitlichung von Mengen verschiedener Arten von Gütern zu bestimmten Zwecken, die eine Tauschsituation oder die Bewegung von Massengütern darstellen können. Diese Art des Geldes findet man überwiegend in redistributiven Systemen. Der Bedarf an Geld als Tauschmittel beruht auf einem direkten Tausch von Gütern. Es kann sich hierbei um den Tausch auf freien Märkten, aber auch um den organisierten externen Tausch, wie er in den Ports-of-Trade stattfindet, handeln. Diese Arten des Geldes werden Geld für einen spezifischen Zweck (special purpose money) genannt, im Gegensatz zu unserem heutigen, allgemein gültigen Geld (all-purpose money). Dalton (1975, 97-8) teilt das Geld für spezifische Zwecke aufgrund der Verwendungssituation in zwei Klassen ein: In primitives Geld, das den Geschäften auf einem Marktplatz dient, und in primitive Wertgegenstände, die nicht anonym austauschbar und hierarchisch gegliedert sind, d.h. in einer bestimmten Prestigesphäre verbleiben. (2) der Handel oder externe Tausch (Polanyi 1968, 158-66): Substantiell gesehen ist externer Tausch eine friedliche Methode, sich Güter aus einer Entfernung

Astrid Möller

225

anzueignen. Er unterscheidet sich von Jagd, Raub, Plünderung und Tributeinziehung durch die Beidseitigkeit der Bewegung und nimmt im all-gemeinen einen annähernd regelmäßigen Charakter an. Formal betrachtet ist externer Tausch eine Bewegung von Gütern durch den Markt. Um die Bedeutung des externen Tausches innerhalb einer Gesellschaft genauer bestimmen zu können, muß man die am Tausch beteiligten Personen und die Organisation des Tausches analysieren. Die mit dem Tausch befaßten Personen lassen sich hinsichtlich ihrer Motivation (Status, persönliches Gewinnstreben), ihres Status und Lebensstandards in einer Gesellschaft und ihrer ethnischen Herkunft (trading people) betrachten. Bezüglich der Organisation des externen Tausches muß man vorausschicken, daß es unter vorindustriellen Bedingungen keinen Tausch im allgemeinen gegeben hat, er hat immer dem Erwerb spezifischer Güter gegolten. Polanyi unterscheidet zwischen drei Haupttypen des externen Tauschs: (a) Der Geschenketausch (gift trade) beruht auf Reziprozität, die Organisation ist zeremoniell und bedarf der gegenseitigen Bekanntschaft. Die getauschten Güter sind Wertsachen, die der Schatzbildung dienen bzw. innerhalb der Prestigesphäre verbleiben. (b) Der verwaltete Tausch (administered trade) beruht auf vertraglicher Übereinkunft, er wird von administrativen Organen überwacht, die Äquivalente und Güter festsetzen. Er findet häufig in Ports-of-Trade statt. (c) Beim Handel unter Marktbedingungen (market trade) ist die Anzahl und die Art der getauschten Güter, d.h. in diesem Falle Waren,16 quasi unbegrenzt und die Organisation folgt dem Angebot-Nachfrage-Mechanismus. (3) die Marktelemente (Polanyi 1968, 169-73; 1977 123-42): Im Gegensatz zur formalen Sicht, in der der Markt die bestimmende ökonomische Institution ist, geht man bei einem substantiellen Ansatz davon aus, daß Markt und Tausch unabhängig voneinander existieren. Um die Vielzahl von Erscheinungen, die unter der Bezeichnung ‚Markt‘ existieren, und die aus der Marktwirtschaft stammenden Konzepte besser dekonstruieren zu können, eignet sich die Untersuchung von Marktelementen. Durch Polanyis Konzept der Markelemente ist man in der Lage, auch in nicht-marktwirtschaftlich organisierten Ökonomien Spuren der Entwicklung eines Marksystems zu entdecken, was die Analyse deutlich flexibler macht, da auch einzelne Elemente vorkommen können, ohne daß gleich die gesamte Wirtschaft einer Kultur als Marktwirtschaft zu bezeichnen wäre. Solche Marktelemente sind: Anbieter und Nachfrager, Äquivalente, die den Maßstab des Tauschverhältnisses ausdrücken, wie Preise, aber nicht notwendigerweise in Geld, der Platz des Austausches, also ein Marktplatz, austauschbare Güter oder Dienstleistungen, Bräuche und Gesetze. Da Handel und Austausch mit fremden Völkern nicht unbedingt prinzipiell friedlich vonstatten gehen, haben sich verschiedene Kulturen immer wieder bestimmte Institutionen wie Gesetze oder Vereinbarungen ausgedacht, die den Austausch friedlich regeln sollten. Zu diesen Institutionen gehört der Port-of-Trade. 16 Ein erweiterter, kulturalistischer Begriff von Ware findet sich bei Appadurai 1986 und Kopytoff 1986.

226

Wirtschaftsanthropologie Karl Polanyis

Der Port-of-Trade stellt die Schnittstelle zwischen zwei verschiedenen Wirtschaftssystemen dar, wodurch er den regelten, konfliktfreien Austausch materieller wie kultureller Güter und Informationen ermöglicht. Der 1963 von Polanyi publizierte Artikel „Ports of Trade in Early Societies“ (Polanyi 1968, 238-60) stellt den Versuch dar, ein von Mitgliedern der Arbeitsgruppe an der Columbia University festgestelltes Phänomen und zum Teil in „Trade and Market in the Early Empires“ 1957 publiziert, zusammenfassend zu umreißen. Da das Modell des Port-of-Trade idealtypisch gebildet wurde, bleibt es offen für Veränderungen, die sich aus empirischen Untersuchungen ergeben. Folglich haben sich durch die Konfrontation des Modells mit dem Material aus Naukratis Verschiebungen innerhalb der charakteristischen Merkmale eines Port-of-Trade ergeben.17 Die Untersuchung von Naukratis ergab, daß sich dieser von Herodot (II 179) als empórion bezeichnete Ort im ägyptischen Nildelta idealtypisch als Port-ofTrade bezeichnen läßt. In diesem Falle handelt es sich deutlich um ein Instrument des verwalteten Außenhandels der Ägypter, die durch die Bereitstellung eines Port-of-Trade die Versorgung mit einigen Prestigegütern wie Silber, Olivenöl und Wein sicherstellen wollten. Das kam den Griechen entgegen, die immer Bedarf an dem in Ägypten reichlich vorhandenen Getreide hatten und sich auch sonst für ägyptische Nippes interessierten: Amulette, Skarabäen und Fayencen. Ob jedoch alle kulturellen Einflüsse und Ägyptiaka, die Griechen aus Ägypten mitbrachten, durch dieses Nadelöhr kamen, darf man wohl bezweifeln, da auch aus Ägypten zurückkehrende Söldner nachweislich einige Andenken, wenn nicht Reichtümer, mit nach Hause brachten. Durch die Konzentration der Handelsaktivitäten der Griechen in Ägypten auf Naukratis waren der ägyptische Pharao und seine Beamten in der Lage, die unternehmerischen Griechen zu kontrollieren. Ihre Beschränkung auf Naukratis läßt sich auch im archäologischen Befund nachweisen, da sich im gesamten westlichen Nildelta, das während des amerikanischen Surveys in den 70er und 80er Jahren des 20. Jh. untersucht wurde, kaum Spuren von Griechen außerhalb von Naukratis vor der hellenistischen Zeit fanden. Griechische Söldner, die in verschiedenen Festungen untergebracht waren, unterstanden dem militärischen Kommando und waren ohnehin in ihrer Bewegungsfreiheit eingeschränkt. Die so erreichte Trennung von externem Fernhandel und lokalem Austausch war Polanyi eine gewichtige Voraussetzung für die mögliche Existenz eines Portof-Trade. Die handeltreibenden Griechen wurden in ihrer Aktivität auf Naukratis beschränkt und traten dort mit ägyptischen Beamten in Kontakt, die den Austausch betrieben und kontrollierten. So ließen sich auch Steuern und Abgaben leichter erheben und das ägyptische System blieb vor möglichen ‚schlechten‘ Einflüssen geschützt. Diese Trennung zwischen externem und internem Tausch, die durch den Port-of-Trade sichergestellt werden konnte, wird bei einigen als Alternativen zum Port-of-Trade bezeichneten Modellen aufgehoben. So betont die gateway community gerade die Verbindung zwischen externem und internem Austausch und der solar central-place ist eine Art akkumulatives Konsumptionszent17 Für die von mir herausgearbeiteten neun, den Port-of-Trade charakterisierenden Punkte s. Möller 2000a, 20-5; Möller 2003, 61-4. „Naukratis revisited“ liegt vor in Möller 2001.

Astrid Möller

227

rum.18 Auch ist der Port-of-Trade keineswegs mit dem griechischen empórion identisch. Nicht jedes empórion ist ein Port-of-Trade.19 Empória, die nicht am Rande eines politisch kontrollierten Gebietes liegen, sei es einer fremden Kultur oder einer griechischen Polis, können nicht, jedenfalls nicht nach meiner idealtypischen Modellbildung, als Port-of-Trade bezeichnet werden. Ich hoffe, daß diese äußerst geraffte Darstellung der wirtschaftsanthropologischen Konzepte Karl Polanyis dazu beitragen mag, die Diskussion über seine Konzepte auch im deutschsprachigen Raum anzuregen und das Potential, das seine Ideen und Analyseraster für eine kulturalistische Wirtschaftsgeschichte bieten, zu erkennen. Daß sein Werk auch Globalisierungskritikern und Wirtschaftswissenschaftlern, die neue Wege aus ihrem formalisierten Korsett suchen, einen Weg zeigt, scheint sich allmählich herumzusprechen.

18 Vgl. Hodges 1988, 42-52 für gateway communities, 55-9 für solar central-places. 19 Diese Gleichung wurde von Figueira 1984 aufgestellt, der dadurch die Nichtanwendbarkeit des Port-of-Trade-Modells auf die griechische Kultur belegen wollte.

228

Wirtschaftsanthropologie Karl Polanyis

Literaturverzeichnis Adams, J. 1987. “Trade and Payments as Instituted Process: The Institutional Theory of the External Sector.” Journal of Economic Issues 21:1839-1860. Appadurai, A. 1986. “Introduction: commodities and the politics of value.” In The social life of things: Commodities in cultural perspective, hg. von A. Appadurai, Cambridge: University Press, 3-63. Block, F. und M. Somers. 1984. “Beyond the economistic fallacy: the holistic social science of Karl Polanyi.” In Vision and Method in Historical Sociology, hg. von T. Skocpol, Cambridge: University Press, 47-84. Bohannan, P. und G. Dalton. 1965. “Karl Polanyi (1886-1964).” American Anthropologist 67:1508-1511. Dalton, G. 1975. “Karl Polanyi’s Analysis of Long-Distance Trade and His Wider Paradigm.” In Ancient Civilization and Trade, hg. von J.A. Sabloff, und C.C. Lamberg-Karlovsky, Albuquerque, NM, 63-132. Eggertsson, T. 1990. Economic Behavior and Institutions, Cambridge: University Press. Figueira, T. J. 1984. “Karl Polanyi and Ancient Greek Trade: The Port of Trade.” AncW 10:15-30. Gledhill, J. und M. Larsen. 1982. “The Polanyi Paradigm and a Dynamic Analysis of Archaic States.” In Theory and Explanation in Archaeology: The Southampton Conference, hg. von C. Renfrew, M.J. Rowlands und B.A. Segraves, New York, London: Academic Press 197-229. Halperin, R. H. 1984. “Polanyi, Marx, and the Institutional Paradigm in Economic Anthropology.” Research in Economic Anthropology 6:245-272. Hodges, R. 1988. Primitive and Peasant Markets, Oxford: Blackwell. Humphreys, S. C. 1978. “History, Economics, and Anthropology: The work of Karl Polanyi.” In S. C. Humphreys, Anthropology and the Greeks, London: Routledge 31-75, 276-283. Kopytoff, I. 1986. “The cultural biography of things: commoditization as process.” In The social life of things: Commodities in cultural perspective, hg. von A. Appadurai, Cambridge: University Press, 64-91. Maucourant, J. 1993. “Monnaie et calcul économique selon Karl Polanyi. Le projet d’une économie socialiste fédérale.” Revue européenne des sciences sociales 31:29-46. --- 1996. “Une analyse économique de la redistribution est-elle possible? Élements de comparaison entre la « new institutional economics » et l’approche substantive.” Topoi 6 :131-158. --- 1997. “Le défi de la « new economic history » - le cas des économies non modernes.” La Revue du Mauss 2:65-81. --- 2000. “Échange, commerce et monnaie dans les économies non modernes - Un réexamen de l’approche de Karl Polanyi.” Transeuphratène 20:9-43. Meier, Chr. 1980. Die Entstehung des Politischen bei den Griechen, Frankfurt a.M.: Suhrkamp. Möller, A. 2000a. Naukratis: Trade in Archiac Greece, Oxford: University Press. --- 2000b. “Seductive and Nutritious: On Max Weber’s Ideal-Types” In Periplous:

Astrid Möller

229

Papers on Classical Art and Archaeology Presented to Sir John Boardman, hg. von G.R. Tsetskhladze, A.J.N.W. Prag und A.M. Snodgrass, London: Thames & Hudson, 205-210. --- 2001. “Naukratis - griechisches emporion und ägyptischer ‘port of trade’.” In Naukratis: Die Beziehungen zu Ostgriechenland, Ägypten und Zypern in archaischer Zeit, Akten der Table Ronde in Mainz, 25.-27. November 1999, hg von U. Höckmann und D. Kreikenbom, Möhnesee: Bibliopolis, 1-25. --- 2003. “Modelle, Idealtypen, Naukratis oder Verstehen durch Vergleichen.” In Zwischen Erklären und Verstehen? Beiträge zu den erkenntnistheoretischen Grundlagen archäologischer Interpretation, hg. von M. Heinz, M.K. Eggert und U. Veit, Münster: Waxmann (Tübinger Archäologische Taschenbücher Bd. 2) 53-65. Neale, W. C. 1987. “Institutions.” Journal of Economic Issues 21:1177-1206. Nippel, W. 1982. “Die Heimkehr der Argonauten aus der Südsee.” Chiron 12:1-39. --- 1988. “Sozialanthropologie und Alte Geschichte.” In Historische Methode, hg. von Chr. Meier, J. Rüsen, München: dtv (Theorie der Geschichte, Beiträge zur Historik Bd. 5) 300-318. North, D. C. 1977. “Markets and Other Allocation Systems in History: The Challenge of Karl Polanyi.” Journal of European Economic History 6:703-716. --- 1981. Structure and Change in Economic History, New York, London: W.W. Norton & Co. --- 1991. “Institutions.” Journal of Economic Perspectives 5:97-112. Polanyi, K. 1944. The Great Transformation, Boston: Beacon Hill (dt. Übers. The Great Transformation. Politische und ökonomische Ursprünge von Gesellschaften und Wirtschaftssystemen, Frankfurt a.M.: Suhrkamp 1978). --- 1957. “The Economy as Instituted Process.” In Primitive, Archaic, and Modern Economies: Essays of Karl Polanyi, ed. by G. Dalton, Boston, 139-174. --- 1963. “Ports of Trade in Early Societies.” Journal of Economic History 23:30-45; abgedruckt in Primitive, Archaic, and Modern Economies: Essays of Karl Polanyi, ed. by G. Dalton, Boston, 238-260. --- 1968. Primitive, Archaic, and Modern Economies: Essays of Karl Polanyi, ed. by G. Dalton, Boston. --- 1977. The Livelihood of Man, New York, London: Academic Press (Studies in Social Discontinuity). --- 1979. Ökonomie und Gesellschaft, Frankfurt a.M.: Suhrkamp. Polanyi, K., C.M. Arensberg und H.W. Pearson. 1957. Trade and Market in the Early Empires: Economies in History and Theory, Glencoe, Ill.: The Free Press and the Falcon’s Wing Press. Thurnwald, R. 1932. Die menschliche Gesellschaft in ihren ethno-soziologischen Grundlagen. Bd. 3: Werden, Wandel und Gestaltung der Wirtschaft im Lichte der Völkerforschung, Berlin: de Gruyter. Wagner-Hasel, B. 2000. Der Stoff der Gaben. Kultur und Politik des Schenkens und Tauschens im archaischen Griechenland, Frankfurt a.M.: Campus Verlag.

VI. LEVANTE, ÄGYPTEN UND DIE ÄGÄIS IN DER 1. HÄLFTE DES 1. JAHRTAUSENDS V.CHR./ LEVANT, EGYPT AND THE AEGEAN WORLD IN THE FIRST HALF OF THE FIRST MILLENIUM B.C.

DIE PERIPHERIE ALS ZENTRUM: DIE PHÖNIKER UND DER INTERKONTINENTALE FERNHANDEL IM WELTSYSTEM DER EISENZEIT Michael Sommer Herihor hatte ein Problem. Der „Wedelträger zur Rechten des Königs“, Oberbefehlshaber von Ober- und Unterägypten und eigentlich starke Mann im Nilreich benötigte dringend Zedernholz. Die langen Stämme waren als Bauholz unentbehrlich; obendrein dienten sie als Rohstoff zur Verfertigung der kostbaren Grabausstattung, auf die Ägypter von Stand nicht verzichten konnten und wollten. Zedern aber wuchsen im Libanon. Also sandte Herihor den Thebaner Wenamun nach Byblos, wohin Ägypten seit dem Alten Reich intensive Handelskontakte unterhielt. Wenamuns Reise, die wohl im ersten Viertel des 11. Jh. v. Chr. stattfand, ist uns in Form eines literarischen Berichts aus Ägypten überliefert. Unter mannigfachen Gefahren für Leib und Leben ins phönikische Byblos gelangt, fordert der Ägypter den Stadtherrn von Byblos in der Manier des Kolonialherrn zur sofortigen Lieferung des Holzes auf.1 Doch etwas Unerwartetes, bisher nie Dagewesenes geschieht: Zekerbaal, der Herrscher von Byblos, weigert sich, das Holz herauszugeben. Seine Begründung ist einfach: „Bin ich dein Diener, der Diener dessen, der dich schickte?“ (ebd., 76). Zekerbaal verlangt schlicht eine Gegenleistung. Er läßt Aufzeichnungen über frühere Transaktionen seiner Vorfahren bringen und verweist darauf, daß die ägyptischen Empfänger stets in Silber und Gold bezahlten. Wenamun, der mit leeren Händen gekommen ist, spielt nun seinen letzten Trumpf aus: „Es gibt kein Schiff auf dem Fluß, das nicht Amun gehört. Sein ist auch das Meer. Und sein ist der Libanon, von dem du denkst ‚Er ist mein‘.“ Er reiht so den Holzhandel in die universelle Semantik eines theokratischen Universalismus ein: Was Amun ohnehin gehört, kann seinem Statthalter auf Erden, Pharao, nicht verweigert werden. Doch hat sich seit dem Ende des Neuen Reichs die Geschäftsgrundlage dramatisch verändert.2 Zekerbaal beharrt auf seiner Forderung; Wenamun läßt aus Ägypten vier Krüge Gold, fünf Krüge Silber, Tuche, Papyrus, Rinderhäute und Tauwerk sowie 20 Säcke Linsen und 30 Körbe Fisch herbeischaffen (ebd., 94). Zekerbaal läßt das Holz einschlagen und liefert prompt. Ein Problem hatte auch Salomo, Herrscher eines relativ armen Agrarstaats in der südlichen Levante, der seinem Gott Jahwe einen Tempel zu bauen gedachte, der die knappen Ressourcen seines Landes gründlich überforderte. Salomo schritt 1

2

Hier und im folgenden ist der Text der Wenamun-Erzählung nach Goedicke 1975 zitiert. Wenamun formuliert seine Forderung unmißverständlich: „Ich bin wegen des Bauholz-Abkommens für die große August-Barke des Amun-Re, Königs der Götter, gekommen. Wie dein Vater und dein Großvater, so solltest auch du es tun [sc. das Holz beschaffen und liefern].“ (ebd., 73). Zu den Prozessen strukturellen Wandels im östlichen Mittelmeer am Ende der Spätbronzezeit Liverani 1987; Zaccagnini 1987; Sommer 2001. Das Gewicht verlagerte sich namentlich in der Levante von redistributiv wirtschaftenden Imperien mit institutionellen Großhaushalten zu kleineren Stammes- und Stadtstaaten.

234

Michael Sommer

– dem Bericht des 1. Buchs Könige zufolge – dennoch zur Tat, wandte sich an Hiram, den Machthaber im benachbarten Tyros, heuerte dort kurzerhand Arbeitskräfte an und orderte Bauholz. Hiram half nur allzu gerne. Mit den Worten „Gepriesen sei heute Jahwe, der David einen weisen Sohn als Herrscher über dieses große Volk gegeben hat“ (1 Könige 5,21) ordnete Hiram an, Holz im Libanon zu schlagen, es zum Meer zu schaffen und nach Israel zu flößen. Doch damit nicht genug: Salomo ließ aus Tyros den Bronzeschmied Hiram, einen Namensvetter des Königs, kommen, der wichtige Teile der Tempelausstattung ausführte (ebd., 7,13). Hiram – der König – erhielt von Salomo großzügige Gegengabe. „Salomo gab Hiram zwanzigtausend Kor Weizen zum Unterhalt seines Hofes und zwanzig Kor feinstes Öl. Diese Menge lieferte Salomo Jahr für Jahr an Hiram.“ (ebd., 5,25). Es blieb nicht dabei. Hiram, der Salomo auch mit der sagenhaften Menge von 120 Talenten Gold versorgt hatte, erhielt zu den Lebensmittellieferungen auch Land: 20 „Städte“ trat Salomo ihm ab, die Hiram freilich nicht in Begeisterung versetzten. „Er meinte: Was sind das für Städte, die du mir gegeben hast, mein Bruder?“ Die Bibel führt auch den Grund für Hirams Mißfallen an: „Man nennt sie ‚Land Kabul‘(dürres Holz) bis zum heutigen Tag.“ (ebd., 9,13). Ein Problem hatte schließlich auch Eumaios, der Schweinehirt des Odysseus, gebürtig von der Insel Syria, wo sein Vater König war. Nach Syria kamen einst „Phöniker, berühmt in der Seefahrt und Erzhalunken“ (Od. 15,414 f.). Die Phöniker brachten im „schwärzlichen Schiffe“ (ebd., 419) Waren von unterschiedlichster Art, die sie zum Tausch feilboten. Sie blieben ein ganzes Jahr, „kauften und schleppten ins Schiff unzählige Güter zusammen“ (ebd., 455). Mit Hilfe einer phönikischen Sklavin lockten sie den jungen Eumaios aus des Vaters Palast und brachten ihn auf ihr Schiff. „Wind und Woge trieben sie jetzt an Ithakas Ufer, wo Laertes mich mit seinem Vermögen erkaufte.“ (ebd., 481 f.). Ein klassischer Fall von Menschenraub.3 Der ägyptische Bericht des Wenamun, die biblische Schilderung des salomonischen Tempelbaus, die fiktive Erzählung des homerischen Schweinehirten Eumaios – drei Quellen, die aus der Außenperspektive Schlaglichter auf Phönikien, seine Städte und deren Fernhandelstätigkeit werfen. Was können wir ihnen – mit Blick auf das Konferenzthema „Means of Transmission and Cultural Interaction“ – an konkreten Informationen entnehmen? Die Antwort fällt zunächst enttäuschend, ja aus Perspektive der Phönikerforschung geradezu niederschmetternd aus: Die Quellen enthalten weit mehr Informationen über ihre Verfasser selbst, deren Bilder, Konzepte, Konventionen und Erzählabsichten weitgehend ungefiltert in die Texte eingehen, als über die Phöniker. Sie sind auf einer spezifischen Ebene eingeflochten in Wirtschaftsdiskurse, wie sie niemand treffender als Karl Polanyi auf einen Nenner gebracht hat. Was davon einer historischen Deutung zugänglich ist, ist wenig genug.

3

Zum Phöniker-Bild in den homerischen Epen Latacz 1990; allgemein die Beziehungen zwischen Ägäisraum und Levante in der homerischen Zeit behandeln Muhly 1970 und Winter 1995.

Die Phöniker und der Fernhandel

235

Kommerzielle Interaktion, der Austausch von Waren, wird von den ägyptischen, israelitischen und griechischen Verfassern in ein ganzes Bündel normativer Orientierungen, religiöser Weltbilder und sozialer Nahverhältnisse eingewoben, mit einem Wort Polanyis: „embedded“. Symmetrisches Nahverhältnis auf Gegenseitigkeit ist Freundschaft: Hiram und Salomo kooperieren beim Tempelbau, weil Hiram bereits zeitlebens ein „Freund“ Davids war. Geradezu topischen Rang besitzt die göttliche Ordnung, zu der menschliches ökonomisches Handeln in Beziehung gesetzt wird: Hiram leistet mit seiner Unterstützung des Projekts Gottesdienst an Jahwe; Wenamun fordert Zekerbaal unter Berufung auf die Universalität Amuns zur Lieferung auf. Schließlich die Geltungskraft der Reziprozität: Merkantile Aktivität wird in den Quellen konsequent als Gabentausch gedeutet, so beim Zustandekommen der Kooperation zwischen Hiram und Salomo. Hiram erhält die „Städte“ von Salomo zum „Geschenk“, als Teil eines reziproken Gabentauschs, mit Bereitstellung spezifischer Rohstoffe und Leistungen (Zedernholz, Handwerker) durch Hiram und entsprechende Gegengaben (Lebensmittel) durch Salomo. Gabentausch ist auch das Paradigma für die Holzlieferungen von Byblos nach Ägypten. Zekerbaal klagt vor Wenamun materielle Gegenleistungen ein, weil er kein „Diener“ Pharaos ist, mithin: weil das Reziprozitätsverhältnis nach seiner Auffassung symmetrisch, nicht asymmetrisch ist. Wenamun kann mit seinem Vorschlag einer gleichsam immateriellen Reziprokation („Leben und Gesundheit“, Goedicke 1975, 87) durch Pharao nicht punkten.4 Die zitierten Quellen sind Ausdruck einer bestimmten Erwartungshaltung. Sie weisen den Phönikern als Austausch- und Kooperationspartnern konkrete Rollen zu, die durch den situativen Kontext und den herrschenden Ökonomie-Diskurs vorgegeben sind. Keine Differenz zwischen Erwartungshaltung und Agieren der Phöniker wird – in der Sache kaum überraschend – im Bericht über den Tempelbau Salomos erkennbar. Schon die Textsorte schließt dies aus: Undenkbar ein autonomes Agieren der Phöniker. Der Bericht ist natürlich in einen weiten, primär von religiösen Überlegungen bestimmten, Zusammenhang eingelassen und erfüllt hier seine konkrete narrative Funktion. Interessant wird es, wenn die in den Texten agierenden Phöniker der vorgegebenen Rollenverteilung gerade nicht entsprechen. Das ist in der WenamunErzählung in dem Moment der Fall, als Zekerbaal die Herausgabe des Holzes ohne materielle Gegenleistung verweigert. Die Rollenzuweisung des Neuen Reichs an seine Vasallen war obsolet geworden, seit im 12. Jh. die Vasallen aufgehört hatten, Vasallen zu sein; neue Modalitäten schälten sich heraus. Zekerbaal verweigert sich, nehmen wir die Quelle beim Wort, nicht den Regeln der Reziprozität, er erkennt nur deren ursprüngliche Asymmetrie nicht mehr an. Wiederum anders handeln die Phöniker der Eumaios-Geschichte. Sie haben – übrigens in pointiertem Gegensatz zu den kunstfertigen Sidonern der Ilias, Produzenten von allerlei Preziosen – eine notorisch schlechte Presse. Auch sie versto4

Als klassische vergleichende Studie zum Gabentausch nach wie vor unentbehrlich Mauss (1968). Bezogen auf die Verhältnisse im frühen Griechenland, neben vielen anderen, Finley 1979, 61f. und Stein-Hölkeskamp 1989, 50-52.

236

Michael Sommer

ßen, so dürfen wir folgern, mit ihrem Kommerz gegen das comme il faut eines ungeschriebenen Regelwerks, von dem Eumaios – und mit ihm der Ilias-Erzähler – selbstverständlich ausgeht. Doch kann es hier kaum um asymmetrische Reziprozität gehen, wie im Fall Wenamuns. Auch der angedeutete Sklavenhandel, so schicksalhaft seine Versklavung für den späteren Hirten ist, wird den Phönikern kaum ihr offenbar bereits topisches Halunken-Image eingetragen haben. Menschenraub, Sklavenhandel und Piraterie galten im Mittelmeerraum der Eisenzeit, horribile dictu, keineswegs als unehrenhafter Broterwerb. Die Kritik richtet sich gegen etwas ganz anderes: Die Phöniker kommen, bringen „Tand“ (Od. 15,415), tauschen und segeln mit den erhandelten Tauschgütern wieder ab. Kritikwürdig vom griechischen Standpunkt ist das Außerkraftsetzen der Reziprozität schlechthin, das Verlassen des zeremoniellen Rahmens, in dessen Semantik die postpalatiale Gesellschaft der Dark Ages, mit ihrer extremen Fragmentierung in autarke oikoi, jegliche ökonomische Transaktion einkleidete. Hier sind wir bei Polanyi und seiner Kategorie der „eingebetteten“ Wirtschaft. Elemente des Marktes wie Preisfluktuation und Wettbewerb spielten im Denken der homerischen Akteure keine Rolle. Wenigstens für die frühen Griechen gilt: „Der Mensch ist kein ökonomisches, sondern ein soziales Wesen. Er zielt beim Erwerb materiellen Besitzes nicht auf die Sicherung seiner individuellen Interessen, vielmehr auf die Erlangung gesellschaftlicher Anerkennung, gesellschaftlichen Rangs und gesellschaftlicher Werte. Er bewertet Besitz primär als Mittel zu diesem Zweck.“ (Polanyi 1976, 135).5 Doch was beweist das schon mit Blick auf die Phöniker? Wenn Griechen der Dark Ages, verpflichtet einer – nennen wir es einmal so – „primitiven“ Wirtschaftsethik, phönikischen Händlern grundsätzlich die Verletzung der geltenden Transaktionsregeln unterstellen – was folgt daraus? Eine Rekonstruktion der phönikischen Wirtschaftstätigkeit und besonders des Fernhandels läßt sich auf einer einzigen Quelle, dazu einer so problematischen wie dem homerischen Epos, gewiß nicht begründen. Dennoch gibt der Text einen Fingerzeig: Die Griechen begegneten in den Phönikern offensichtlich Händlern, die beim Warentausch andere Prioritäten setzten und nach anderem Regelwerk operierten. Ihr Augenmerk scheint weniger auf die sozialen Implikationen des Tauschs gerichtet als auf den Tausch selbst. Ihr Streben nach Gewinnmaximierung ist, wenigstens aus dem Blickwinkel der Griechen, bar jeder Ethik. Gerade hierin liegt der Verstoß gegen den Komment reziproken Tauschs. Weiter wird man nicht gehen wollen. Zwei Konzeptionen des Warentauschs stehen sich gegenüber: eine überwiegend von sozialen Normen getragene Variante und ein Austausch auf Grundlage von Marktelementen. Die Arbeitshypothese soll lauten: Der phönikische Fernhandel wurde maßgeblich vom Markt bestimmt, die Ilias-Passage ist gleichsam ein ferner Reflex davon. Das wichtigste der von Polanyi benannten Marktelemente ist 5

Polanyi eröffnete mit seiner Bemerkung faktisch die bis heute andauernde Debatte zwischen „Primitivisten“ und „Modernisten“. Sie kann hier unmöglich erschöpfend behandelt oder auch nur in groben Umrissen nachgezeichnet werden. Ersatzweise sei auf die einschlägigen Beiträge von Morris Silver und Astrid Möller in diesem Band verwiesen.

Die Phöniker und der Fernhandel

237

die freie Verhandelbarkeit von Preisen. Möchten wir den Nachweis führen, daß der phönikische Fernhandel wenigstens partiell von Kategorien des Marktes beherrscht war, so muß die Beweiskette unweigerlich über das Kriterium der Preisfluktuation führen. Sie in den verfügbaren Texten, samt und sonders Sekundärquellen, aufzuspüren, ist schier hoffnungslos, da die Lebenswirklichkeit der Verfasser ja gerade die marktlose Ökonomie war. Kein Grieche vor Aristoteles hat je Überlegungen zu Marktmechanismen angestellt, und für Ägypter wie das Alte Israel gilt das erst recht. Vorausgesetzt, unsere Arbeitshypothese ist richtig – in den Quellen würden wir kaum einen Beleg dafür finden. Der Nachweis ist daher gleichsam nur durch die Hintertür zu führen, über ein heuristisches Modell, das zugegebenermaßen auch für die Neuzeit nicht unumstritten ist. Dennoch fügen sich, so wird zu sehen sein, die wenigen Dokumente wie Mosaiksteinchen zu dem Modell, das damit immerhin eine plausible Deutungsvariante eröffnet – und das ist in diesem Fall schon viel. Gemeint ist das „Weltsystem“-Modell des Soziologen Immanuel Wallerstein, das sich auf den transkontinentalen Handel in der Frühneuzeit bezieht und die Ursprünge der modernen, kapitalistischen Weltwirtschaft zu beschreiben sucht.6 Weltsysteme bestehen aus einem Zentrum, um das sich, hierarchisch und idealtypisch in konzentrischen Kreisen, eine abgestufte Folge von Peripherien lagert, die durch Fernhandel mit dem Zentrum verknüpft sind. Von der Peripherie zum Zentrum hin nimmt Komplexität auf allen Feldern zu, mit unendlich vielen dazwischen denkbaren Abstufungen und mit zahlreichen Wechselwirkungen zwischen den Ebenen: ! Komplexität des Siedlungsmusters: Im Zentrum entfällt der relativ größte Bevölkerungsanteil auf Städte; das Beziehungsgeflecht zwischen Siedlungen unterschiedlicher Ebene ist hochgradig hierarchisch, die räumliche Differenzierung ausgeprägt. In der Peripherie lebt der relativ größte Bevölkerungsanteil im ländlichen Raum; die Siedlungshierarchie ist flach, das Siedlungsmuster annähernd isotrop. ! Komplexität der Sozialstruktur: Die Bevölkerung des Zentrums ist sozial stark stratifiziert; die Bevölkerung der äußersten Peripherie ist sozial ungeschichtet. ! Funktionale Komplexität: Das Zentrum ist funktional hochgradig differenziert, die äußerste Peripherie nahezu undifferenziert. ! Komplexität der Produktion: Anspruchsvolle Produktionsprozesse und Dienstleistungen werden vom Zentrum wahrgenommen, einfache Produktion von der Peripherie. Idealtypisch „produziert“ das Zentrum Dienstleistungen und hochwertige Fertigerzeugnisse, die innere Peripherie einfache Fertigerzeugnisse und Agrarprodukte, die äußere Peripherie Rohstoffe und Arbeitskräfte (Sklaven).

6

Grundlegend Wallerstein 1974 ff. Wallerstein selbst hat in jüngerer Zeit mehrfach kritisch zu Versuchen Stellung genommen, das Modell auf andere Epochen und historische Konstellationen zu übertragen. Vgl. Wallerstein 1991; Wallerstein 1993, vgl. auch Markoff 1977. Zur Universalisierbarkeit des Modells jetzt wieder Goldfrank 2000.

238

Michael Sommer

Weltsysteme sind nicht per definitionem kongruent mit Organisationen politischer Macht wie Imperien oder Nationalstaaten, mit ihren je eigenen ZentrumPeripherie-Gefügen: Ökonomische und politische Zentren können, müssen aber nicht zusammenfallen, politische Machtvakuen ebenso wie Konglomerate unterschiedlicher politischer Verbände können gleichwohl im Zentrum des Weltsystems liegen. Machtbeziehungen in Weltsystemen sind vergleichsweise wenig formalisiert, gründen nicht (oder nicht notwendig) auf physischer Gewalt und sind oft latent, aber nichtsdestoweniger strukturprägend. Hervorstechendes Merkmal ist die ökonomische Arbeitsteilung zwischen dem Zentrum und den verschiedenen Peripherieebenen, mit systemstabilisierenden Rückkopplungs- (Spin-off-) Effekten. In der Regel entwickeln Weltsysteme so eine Eigendynamik, welche die Vorrangstellung des Zentrums auf lange Dauer zementiert. Unsere Quellen erlauben uns eine zumindest umrißhafte Rekonstruktion der durch Phöniker verhandelten Waren. Sie gestatten Rückschlüsse auf die Komplexität von Fertigungsprozessen und damit wiederum allgemein auf soziale Komplexität. Die Texte geben in ihrer chronologischen Abfolge zudem Einblick in eine gewisse Dynamik des ostmediterranen Fernhandels der Eisenzeit. Beginnen wir mit der chronologisch frühesten Quelle, der Wenamun-Erzählung, um 1170 v. Chr. Zekerbaal, der König von Byblos, hat in seiner Verfügung Zedernwald und Personen, die er zum Holzeinschlag kommandieren kann, mithin Rohstoffe und Arbeitskräfte. Sein ägyptischer Handelspartner liefert im Gegenzug Gold, Silber, Rinderhäute, Tuche, Papyrus, Tauwerk, Linsen und Fisch. Die Abwicklung des Fernhandels obliegt einem Beauftragten von Pharao (Wenamun). Die von den Ägyptern gelieferten Waren sind teilweise Rohstoffe (Gold, Silber), teilweise Agrarerzeugnisse, teilweise eher einfache Fertigprodukte. Über die genaue Preisbildung verlautet nichts, unterstellt wird offenbar, daß ein „gerechter Preis“ bezahlt wird. Der Handel kommt, als gleichsam administrierter Handel, deshalb zustande, weil Ägypten akuten Bedarf an einem lokal nicht erreichbaren Rohstoff hat. Konturen eines Weltsystems zeichnen sich, wenn überhaupt, nur in groben Umrissen ab: Ägypten liefert Waren, die komplexere Fertigungsprozesse voraussetzen, Byblos ist bloßer Rohstofflieferant. Ein ganz anderes Bild vermittelt der Bericht vom Tempelbau zu Jerusalem, gut 70 Jahre später – wobei das Buch Könige vermutlich anachronistisch einen späteren Zeithorizont spiegelt. Zwar liefert auch hier die phönikische Hafenstadt Tyros einen Rohstoff, wiederum Zedernholz; doch besteht ein Großteil des Lieferumfangs diesmal aus hochkomplexen Fertigerzeugnissen und qualifizierten Dienstleistungen, die – und darin liegt die Pointe des Texts – im benachbarten Israel nicht verfügbar sind. Die Passage dokumentiert mithin, aus der Perspektive des Unterlegenen, eine Situation technologischer Ungleichentwicklung, wie sie angesichts der räumlichen Enge in der Levante auf den ersten Blick überraschend ist. Tyros erhält im Tausch Agrarerzeugnisse, namentlich Getreide und Öl, beides haltbare, lagerfähige Güter. Besondere Aufmerksamkeit verdient der Hinweis, daß Hiram auch Gold (die enorme Summe von 120 Talenten) lieferte. Da Phönikien keine Goldvorkommen hatte, kann Hiram das Gold nur von auswärts bezogen

Die Phöniker und der Fernhandel

239

haben – ein erster Hinweis auf eine Betätigung von Tyros im Transithandel. Salomo aber liefert nicht nur Öl und Getreide, er tritt auch „20 Städte“ an Hiram ab. Sind wir damit Zeugen einer merkantilen Strategie der Phöniker? So vorsichtig man mit der Deutung von Handlungen im Sinne rationalen Kalküls sein muß – es sieht so aus: Der Tauschhandel lief offenbar auf die Schaffung einer agrarischen Subsistenzbasis für die wachsende Metropole hinaus – durch Verlagerung der landwirtschaftlichen Produktion nach außen (Israel) einer-, durch Erwerb agrarisch nutzbaren Territoriums andererseits. Das alles ist im Rahmen des traditionellen „ceremonial exchange“, in dem vor allem der Austausch von Prestigegütern („low bulk, high value“) eine Rolle spielte, nicht mehr zu erklären. Erkennbar wird vielmehr, wie Fernhandel zur Existenzgrundlage einer ganzen Gesellschaft werden konnte. Der Text scheint somit Dokument eines Weltsystems in statu nascendi zu sein, in dem Tyros, als Anbieter hochwertiger Fertigprodukte und qualifizierter Dienstleistungen, eine im Vergleich zum agrarischen Israel, wo „ein jeder unter seinem Weinstock und seinem Feigenbaum“ (1 Könige 5, 5) saß, deutlich höhere Komplexitätsstufe einnahm. Diesen Eindruck verfestigt der dritte Quellentext, so verschieden er seiner Diktion nach sein mag. Die Phöniker der Eumaios-Erzählung kommen eigens auf die Insel Syria, um Handel zu treiben. Sie bringen „Tand“, also wohl Luxusgüter ohne Gebrauchs-, aber mit hohem Prestigewert (man denkt unwillkürlich an die hochwertigen Textilien und den Krater, die als Werke der Sidoner in der Ilias Erwähnung finden, oder an die nahezu im gesamten Mittelmeerbecken verbreiteten Silber- und Bronzeschalen mit szenischen Darstellungen7) und transportieren andere Güter, darunter den versklavten Eumaios, von der Insel ab, nur um sie an anderer Stelle (diesmal auf Ithaka beim Vater des Odysseus) weiterzuverhandeln. Die schiffsberühmten Phöniker der Eumaios-Passage sind Transithändler: Sie bestreiten ihren Lebensunterhalt aus der Gewinnspanne zwischen Kauf- und Verkaufswert der gehandelten Güter und nutzen das Entwicklungs- und Preisgefälle zwischen den verschiedenen Hierarchieebenen des Weltsystems. Ein Gegenstand wie der Silberkrater, den Achill als Kampfpreis aussetzte (Il. 23,741 ff.), war unter den Bedingungen eines technologisch hochentwickelten, arbeitsteiligen Handwerks leicht herzustellen; die Rohstoffe waren im weitgespannten Handelsnetz der Phöniker ohne weiteres zu beschaffen, der Absatz ebenso problemlos zu organisieren. In der noch halbbarbarischen Welt der ägäischen Dark Ages war das gleiche Silbergefäß ein hoch gehandeltes Prestigegut, das der Zirkulation in Elitenkreisen vorbehalten war. Seinen Lebensunterhalt auf diesen feinen Unterschied zu bauen, setzte das intellektuelle Verstehen elementarer Kategorien des Marktes voraus. Die Mechanik des eisenzeitlichen Weltsystems erhellt kein Dokument eindrucksvoller als die „Totenklage über Tyros, das prächtige Schiff“. Selbst wenn wir in Rechnung stellen, daß hier massiv übertrieben wurde, um den Fall von Tyros um so drastischer erscheinen zu lassen, dürfen wir doch annehmen, daß die In7

Die phönikischen Paterai erschließt Markoe 1985. Nicht Phönikien im engeren Sinn, sondern Nordsyrien hält Winter 1988 mit wenig überzeugenden Argumenten für das Ursprungsgebiet der Schalen. Als historischer Deutungsversuch jetzt Sommer 2002.

240

Michael Sommer

formationen aus einer gut unterrichteten Quelle des 8. oder 7. Jh. v. Chr. stammen.8 Die Passage (Ez. 27,4-25) listet nahe und ferne Handelspartner der Levantestadt und die Güter, die jeweils verhandelt wurden, auf. In alle vier Himmelsrichtungen, von Südarabien bis zur Ägäis, von Untermesopotamien bis Spanien, dehnt sich der geographische Rahmen des Fernhandelsnetzes, in dessen Zentrum Tyros wie eine Spinne liegt. Die Güter, die Tyros von seinen Handelspartnern bezog, geben in aller wünschenswerten Deutlichkeit, fast wie nach dem Lehrbuch, Aufschluß über den Komplexitätsgrad ihrer Gesellschaft. Am Handel haben die übrigen großen Phönikerhäfen (Sidon, Arwad und Byblos) Anteil; Fertigerzeugnisse liefern vornehmlich Ägypten und Mesopotamien (Harran, Assur, Eden), aber auch das palästinische Edom; agrarische Erzeugnisse stammen aus der syrisch-palästinischen Peripherie (Damaskus, Israel, Juda); Produkte der Viehzucht aus Kleinasien (Bet-Togarma) und Arabien; schließlich Rohstoffe und Sklaven vornehmlich aus Zypern, der Ägäis, Arabien und Spanien (s. Tabelle S.242). Damit sind nur einige wenige Tendenzen umrissen, mehr nicht. Aber es wird deutlich, daß die Phöniker Disparitäten in den natürlichen Ressourcen, im technologischen Entwicklungsstand und im ökonomisch-funktionalen Profil des Mittelmeerbeckens in ihren Dienst stellten, virtuos die Gewinnchancen aus dem Transithandel auslotend. Mehr als jede andere antike Gesellschaft, einige griechische Inselpoleis und das kleinasiatische Phokaia vielleicht ausgenommen, hingen die phönikischen Stadtstaaten in ihrer Gesamtheit vom Fernhandel ab. Niemand geringerer als Max Weber reihte die Phöniker daher treffend unter die großen „Handelsvölker“ der Weltgeschichte.

English Summary Scholars dealing with Phoenician history and economy generally suffer from an almost complete lack of direct written sources balanced only partly by the evidence deriving from other parts of the Eastern Mediterranean. Literary documents from Egypt, Israel and the Aegean reflect commercial exchange and cultural interaction between the Levantine tradesmen and the respective ruling élites, but they are written from the point of view of market-less societies lacking even the most basic concept of trade. Commerce for Egyptians, Hebrews and Greeks of the Archaic period was rather integrated – ‚embedded‘ to use Polanyi’s terminology – in a complex system of social norms, ideas and convictions. Nevertheless, the biblical tradition with Ezekiel’s prophecy concerning the decline of Tyre provides decisive information on the economic structure of the Eastern Mediterranean and the Phoenician city-states as well. The list of commodities traded by Phoenician 8

Die Entstehungsgeschichte des Textes ist komplex und nicht in allen Einzelheiten zu durchdringen. Vermutlich integrierte der im babylonischen Exil arbeitende Verfasser einen älteren Prosatext in seine Schilderung des Untergangs von Tyros, welche die Belagerung und Zerstörung der Stadt durch Nebukadnezar (585-572 v. Chr.) reflektiert. Vgl. Allen 1990, 83-88.

Die Phöniker und der Fernhandel

241

merchants clearly indicates that the Levantine coastal region lay in the centre of an economic World System stretching from the Iberian peninsula in the west to Mesopotamia and beyond in the east.

242

Michael Sommer

Waren-Tabelle

Warenkategorie Handel und Seeschiffahrt

Regionaler Entwicklungsstatus erweitertes Zentrum

Fertigerzeugnisse

innere Semiperipherie

Agrarerzeugnisse

äußere Semiperipherie

Tierprodukte

innere Peripherie

Rohstoffe/Sklaven äußere Peripherie

Herkunftsgebiete Sidon Arwad Byblos Edom Ägypten Haran Assur Eden Kanne Dedan Juda Israel Damaskus Bet-Togarma Arabien und Kedar Semir (Hermon) Libanon Edom Damaskus Bašan Kittim Rhodos, „Inseln“ Paras, Lut, Put Saba Ragma Assur Taršiš

Lokalisierung Syrien-Palästina Syrien-Palästina Syrien-Palästina Syrien-Palästina Ägypten Obermesopotamien Mesopotamien Mesopotamien Mesopotamien (?) arabische Halbinsel Syrien-Palästina Syrien-Palästina Syrien-Palästina Kleinasien arabische Halbinsel Syrien-Palästina Syrien-Palästina Syrien-Palästina Syrien-Palästina Syrien-Palästina Zypern Ägäis östliches Mittelmeer arabische Halbinsel arabische Halbinsel Mesopotamien Spanien

Die Phöniker und der Fernhandel

243

Bibliographie Carter, J. B. uns S. P. Morris, Hg. 1995. The Ages of Homer. A Tribute to Emily Townsend Vermeule, Austin: University of Texas Press Curtis, J., Hg. 1988. Bronzeworking Centers of Western Asia c. 1000-539 B.C., London/New York. Finley, M. I. 1979. Die Welt des Odysseus, München: dtv. Frank, A. G. und B. K. Gills, Hg. 1993. The World System: Five Hundred Years or Five Thousand?, London/New York: Routledge. Gehrig, U. und H. G. Niemeyer, Hg. 1990. Die Phönizier im Zeitalter Homers, Mainz: Philipp von Zabern. Goedicke, H. 1975. The Report of Wenamun, Baltimore/London: Johns Hopkins University Press. Goldfrank, W. F. 2000. „Paradigm Regained? The Rules of Wallerstein’s World System Method“, Journal of World-System Research 6, 150-195. Heinz, M. und D. Bonatz, Hg. 2002. Bild – Macht – Geschichte. Visuelle Kommunikation im Alten Orient, Berlin: Reimer. Allen, L. C. 1990. Ezekiel 20-48 (Word Biblical Commentaries, Bd. 29), Dallas: Word. Latacz, J. 1990. „Die Phönizier und Homer“, in: Gehrig/Niemeyer 1990, 11-21. Liverani, M. 1987. „The Collapse of the Near Eastern Regional System at the End of the Bronze Age: The Case of Syria“, in: Rowlands, Larsen und Kristiansen 1987, 66-73. Markoe, G. 1985. Phoenician Bronze and Silver Bowls from Cyprus and the Mediterranean, Berkeley/Los Angeles: University of California Press. Markoff, J. 1977. „The World as a Social System“, Peasant Studies 6, 2-8. Mauss, M. 1968. Die Gabe. Form und Funktion des Austauschs in archaischen Gesellschaften, Frankfurt am Main: Suhrkamp. Muhly, J. D. 1970. „Homer and the Phoenicians. The Relations between Greece and the Near East in the Late Bronze and Early Iron Age“, Berytus 19, 19-64. Polanyi, K. 1976. Ökonomie und Gesellschaft, Frankfurt am Main: Shurkamp. Rowlands, M., M. T. Larsen und K. Kristiansen, Hg. 1987. Centre and Periphery in the Ancient World, Cambridge: Cambridge University Press. Sommer, M. 2001. „Der Untergang des hethitischen Reiches: Anatolien und der östliche Mittelmeerraum um 1200 v. Chr.“, Saeculum 52, 157-176. Sommer, M. 2002. „Kunst als Ware. Bildproduktion und Fernhandel zwischen Levante und Griechenland“, in: Heinz und Bonatz 2002, 207-224. Stein-Hölkeskamp, E. 1989. Adelskultur und Polisgesellschaft. Studien zum griechischen Adel in archaischer und klassischer Zeit, Stuttgart: Franz Steiner. Wallerstein, I. 1974 ff. The Modern World System, Bde. 1-3, New York/San Francisco/London: Academic Press. Wallerstein, I. 1991. Geopolitics and Geoculture. Essays on the Changing WorldSystem, Cambridge: Cambridge University Press. Wallerstein, I. 1993. „World System versus World-Systems“, in: Frank und Gills 1993, 292-296.

244

Michael Sommer

Winter, I. 1988. „North Syria as a Bronzeworking Centre in the Early First Millennium BC: Luxury Commodities at Home and Abroad“, in: Curtis 1988, 193-225. Winter, I. 1995. „Homer’s Phoenicians: History, Ethnography, or Literary Tope?, in: Carter und Morris 1995, 247-271. Zaccagnini, C. A. 1987. „Aspects of Ceremonial Exchange in the Near East During the Late Scond Millennium BC“, in: Rowlands, Larsen und Kristiansen (1987), 57-65.

THE PHOENICIANS AND THE BIRTH OF A MULTINATIONAL MEDITERRANEAN SOCIETY* Hans Georg Niemeyer As is generally accepted, a crisis commonly (even if perhaps not quite correctly) labeled the “sea-peoples-catastrophe“ marks the end of the Bronze Age koiné in the Eastern Mediterranean, including Anatolia and the Levant. Effects are felt to the south even in Egypt. The resulting period of decline and impoverishment has been called since long the “Dark Ages”. For the Near East, this period is presently being re-evaluated. The disruption is considered to have been less complete, and, at any rate, the Phoenician city-states in the Levant (see map fig. 1), i.e. the core region between Arwad and Tyre, seem to have been spared from severe destruction found elsewhere. This is the particular historical setting in the Eastern Mediterranean at the outset of the Phoenician expansion throughout the Mediterranean, which started at the end of the 2nd millennium and continued into the early centuries of the 1st millennium BC.1 This expansion into the Mediterranean was according to all evidence we have an enormous enlargement of the range of economic interaction and an expansion of an entirely mercantile and thus generally peaceful kind, and not one based upon power-politics or aimed at conquering territories (see map, fig. 2). Before assessing the impact of this great movement on the different Mediterranean civilizations affected by it, at least some of its characteristic features need to be outlined. The Phoenicians, setting out from a couple of small city-states on the Levantine coast, first and foremost aimed at ensuring the supply of metal-ores and other raw materials needed by the skilled artists and craftsmen these cities were famous for, thus providing for economic wealth at home. The second reason were the oppressive and ever growing tributes exacted by the great power of Assyria, the neighbour to the East. Tyre seems to have played a prominent part in this chapter of history, if we trust in the few written sources agreed upon by modern research. According to Velleius Paterculus (Hist. Rom. I 2, 1-3), it is the Tyria classis, tum plurimum pollens mari, which was responsible for the founding of Gadir, the oldest settlement abroad. It has been argued that especially in the 11th/10th centuries an active expansion to the far West would not have been possible for Tyre, which allegedly was only a short time before refounded by the neighbouring city-state of Sidon. And that expansion and settlement in the Mediterranean should merely be understood *

1

This paper has been left more or less as it was read at Innsbruck, the references have been restricted, where possible, to the most recent bibliography at reach. Gunter Kopcke (New York) and Wolf Rudolph (Berlin) helped me with my English. To both I feel deeply obliged. I have dealt repeatedly with the general outlines of Phoenician expansion in the Mediterranean and may be permitted to refer to four major recent articles for full bibliographical information: Niemeyer 1999; Niemeyer 2000; Niemeyer 2002a; Niemeyer 2003, forthcoming (revised version of Niemeyer 1995).

246

Hans Georg Niemeyer

as a result of Assyrian oppression, initiated but to serve Assyria’s ever growing demand of raw materials, luxury items and precious metals. Admittedly, there is no doubt about the sometimes considerable tributes to the Assyrian king. But these tributes over a long period were paid in a climate of economical and political symbiosis, which for the ones guaranteed a certain independence from the great military power of Mesopotamia, and for the others a more or less regular supply of luxury goods, vital raw material and noble metal. The Assyrians in their turn thus avoided the necessity to build up an own economic network of international range.2 In other words, the agreement was of respective use, and it would be then out of well understood political egoism or determination to survive that the Phoenician city-states had developed into a kind of service society for Assyria. But in spite of this Tyre did become at best only in part an indirect „instrument“ of Assyrian imperialism and expansionism. Two main historic issues should be reminded here: First, the Phoenician expansion starts earlier than the Neo-Assyrian empire’s oppression, and it starts mainly for reasons which root in the circumstances in the Phoenician city-states and in their changed economical situation. It is self-evident that for the flourishing arts and crafts, for business and trade – the basic features of wealth for the Phoenician city-states – a steady supply of raw materials was indispensable, so new resources had to be discovered and safe trade routes had to be opened up as soon as possible after the breakdown of the Bronze Age world. Second, it was not earlier than the 8th century, that it obviously became necessary for the Phoenicians to establish a greater number of permanent factories for protection of the trade routes through the Mediterranean. But the reason for this is again mainly to be looked for in the Mediterranean itself, not in the Near East: It is the beginning competition with Greek colonisation in the West, which by tradition starts with the foundation of Syracuse or Naxos in 734 BC.3 In presence of an audience of specialists in the field I may be allowed to skip the particular features of Phoenician settlement in the Mediterranean as I have treated them several times in recent years.4 What matters in the present context is the specific Phoenician impact on the Mediterranean civilizations, and the specific Phoenician contribution to what Walter Burkert has called the “Orientalizing Revolution”,5 which in turn eventually became the foundations the new mediterranean koiné of Classical Antiquity was to be built upon. In view of the lack of sufficient and reliable written sources on this problem we have to turn to the archaeological record. Among the steadily increasing evidence the numerous Oriental imports found i.a. at Eretria and Lefkandi have to be listed in the first place. These luxury objects come especially from richly furnished graves of the aristocracy, later from sanctuaries as well. As time proceeds, 2 3 4 5

See the contribution of K. Radner, this volume, pp. 152 -169. In general see now Der Neue Pauly 6 (1999), 653-664 s.v. Kolonisation (W. Eder); the best survey of the period under consideration is Ridgway 1992. Niemeyer 1984, 29-56; Niemeyer 1995, 260-63. Burkert 1992.

The Phoenicians

247

intruding Oriental workshops (ivory carvers, cabinet makers, goldsmiths, metal artists, perfume cooks, etc.) apparently do establish themselves in the more important Greek communities like Eretria/Lefkandi, Knossos and other places in Crete, thus becoming enoikismoi in a foreign ambiance; the Phoenician sanctuary of Kommos on the Southern coast of Crete is an unmistakable sign for the rank as well as the endurance of such immigrant communities.6 The high quality Oriental offerings from the Idaean Cave in Crete have to be seen in this context.7 Now, when it comes to art and art forms, one would on the other hand expect the material facies of the civilizations affected to show at least a certain tinge of the leading import forces’ originality. Applied to the matter here concerned, one consequently would await particular Phoenician traits to show up on artefacts of the respective Mediterranean civilizations. This obviously requires that we know what really is Phoenician art, and here we meet an almost crucial problem. Already Donald Harden in 1962 declared that »The Phoenicians are never more elusive than in their art«.8 In the book on the Phoenician world by Gras, Rouillard and Teixidor there is no chapter on art at all,9 and Claude Baurain in 1992 felt himself obliged to plead in detail why »il serait ... injustifié de refuser l’appellation d’œuvre d’art aux diverses productions phéniciennes«.10 Glenn Markoe in his new monograph attests the Phoenicians to have specialized “in portable art”.11 Thus it is evident that there does exist at least a certain ambiguity of judgement in the scholarly world. The delicately carved panels of ivory furniture and the equally famous metalwork, thymiateria, candelabra and vessels with appliqués or without, and above all the engraved, chiselled and embossed metal-bowls with ornamental or figural design, on the one hand are regarded as masterpieces of Phoenician craftsmanship, on the other hand they are declared the output but of either egyptianizing or syrianizing workshops, and admittedly in fact they are at least dependent from the respective art styles and iconographies.12 And while Egyptian impact on arts and crafts in the Levant had a long tradition,13 in fact from the 9th down to the 7th century BC there existed in the Late-Hittite world of Northern Syria powerful metalworking centres, to which certain classes of bronze vessels and reliefs of figural design can be ascribed, the main argument being stylistic comparisons.14 Quite correctly they also have been held responsible for the syrianizing trend in Phoenician metal and ivory work. Among the minor groups of monuments, the pear-shaped metal jugs have been claimed to be of Cypriot fabric.15 6 7 8 9 10 11 12 13 14 15

For a short overview see Shaw 1998. Sakellarakis 1992; Matthäus 2000. Harden 1980, 171. Gras et al. 1989. Baurain and Bonnet 1992, 231-33. Markoe 2000, 150; cp. Niemeyer 2001, 374. Falsone 1995, 427-32; Markoe 2000, 147. 149. Markoe 1985, 17-18, 30-33, 136-38, 150-51. Rittig and Borell 1998, 3-62; Seidl 1999. Falsone 1995, 433, against Grau-Zimmermann 1978.

248

Hans Georg Niemeyer

In contrast to these classes of artefacts, which as known are not or only sporadically found in Phoenicia proper, presentational reliefs are scarce in genuine early Phoenician contexts, monumental sculpture in the round is almost deficient.16 Eric Gubel in a recent paper succeded to collect a few stelae with images of Phoenician gods, but of a restricted, if not rather poor iconography.17 The group of some 200 tombstones and -stelae which recently turned up in one of the cemeteries of Tyre clearly demonstrate a marked aversion from the anthropomorphic icon of man, which instead with preference is substituted by certain symbols as e.g. the betyl.18 As has been worked out in recent research, this obvious fact cannot be better explained than by an intrinsic and general trend of aniconism which inheres in Phoenician art and which has its parallel in the neighbouring Israelite civilization, witness being the taboo of iconolatry in the Ten Commandments (II. Mosis 20:4).19 Looking back with this in mind at the so-called minor arts of ivory carving and metal embossing, both being bent on nearly naturalistic pictorial scenes with human and animal figures, there seems to emerge a sharp antagonism of two entirely different attitudes towards pictorial art. How then are we going to reconcile them both as true and characteristic features of Phoenician civilization? One of the possible alternatives, to eliminate the output of one of the two artistic trends from the accepted corpus of Phoenician art, obviously is not a satisfying solution. I need not enlarge on this particular topic. May it suffice to recall in addition the brilliant analysis of Phoenician and Syrian art written by Henri Frankfort in his “Art and Architecture of the Ancient Orient”, in particular based on the carved ivories and engraved metal bowls.20 And if a personal remark is allowed here: the very amalgamation of art styles of different tradition - Syro-Mesopotamian and Egyptian - , combined with the well-known exquisite and gentle rendering of sometimes quasi naturalistic forms, be it anthropomorphic, zoomorphic, ornamental or phytogenic, to my opinion in fact is an own and genuine achievement of Phoenician craftsmanship. Another alternative deserves at least to be discussed here, after taking a look on the distribution maps of Phoenician luxury objects in the Ancient world. If one tries to combine them in a more general map (see fig. 3), it turns out e.g. that from among the metal bowls none has been found in Phoenicia proper.21 The same holds good for the less numerous pear-shaped jugs.22 The two classes differ only when the distribution in the East is considered, where bowls abound in Nimrud in

16 I must renounce here to discuss the well-known anthropoid sarcophagi, because they constitute a problem of its own kind (Niemeyer, forthcoming). See meanwhile Frede 2003. Lembke 2001 17 Gubel 2000. 18 Seeden 1991; Sader 1991. 19 Moscati 1990, 172-7; Mettinger 1995; cp. Uehlinger 1996. 20 Frankfort 1970, 310-31. 21 See Markoe 1985, map; Falsone 1992. 22 Grau-Zimmermann 1978, 208 (map).

The Phoenicians

249

Mesopotamia and are present in Iran, while metal jugs up till now are entirely deficient in the Near East. Even in a sketchy trial of analysis - which at most I can try here - we have to pay attention to the respective archaeological context, which is indispensable. Already such an overview reveals significant issues: in the Near East the overwhelming majority of these luxury objects - in particular the metal bowls and the prestigious ivory carvings also to be regarded - is found in the royal palaces and palace-temples, of the Assyrian king or of the North-Syrian, aramaic and Israelite princes and vassal-kings (Nimrud, Khorsabad, Sendçirli, Arslan Tash, Samaria etc.), be it as tribute or as war-booty. In the West they come from the tombs of an aristocratic élite if not right away of the local princes. In Greece quite a number turned up in sanctuaries. In all the differently classified cases they would have set up prestige to the owner or, speaking about votive-offerings, to the donor. The specific employment of these luxurious goods puts to evidence that they served the local aristocracies to define themselves as an élite. We can assume that it made no difference if the Keimelia were displayed in the private treasure, or as forming part of the tomb furniture at the funeral or as an exhibit in a sanctuarydemonstrating pride and munificence of an aristocratic dedicant. It is manifest, that these Keimelia were of highest esteem and, consequently, in great demand. But notwithstanding that, they were not the subject-matter of trade proper, were not the reason for but the result of establishing good relations in a network of farreaching interconnections. The hard-core merchandise always has been of a different, of a more substantial kind: agrarian products (cereals, wine), man-power (slaves, specialized craftsmen), industrial products (woollen and silk-tissues) and, above all, raw materials (precious ores and metals). And it was a huge amount of know-how of life sciences and techniques that came in the wake of it: i.a. writing in alphabetic script, measuring, weighing, processing of metals,23 astronomically guided navigation (stella Phoenicia), not at least banqueting etc.24 The Keimelia thus would constitute some sort of an extra, would be gifts to be exchanged between partners of trade and by which to corroborate friendly relations, to achieve better contracts and profitable deals, to provide continuity for established connections. This constituted their value within the society of the Phoenician city-states, an indirect value within a transmediterranean network of economic nature and design, within a globalized, multinational koiné of common life habits and paradigms. Is n’t it legitimate, then, that we imagine those Keimelia being produced purposely to meet the abovementioned demand and to match the specific predilections abroad? Produced in a small number of specialized workshops in the few Phoenician city-states, or acquired as merchandise from the Eastern neighbours or even carried by those themselves, in a joint-venture? And later on produced by itinerant Phoenician craftsmen and even workshops settled abroad? In other words: com-

23 24

Niemeyer 2002b. Matthäus 1999/2000.

250

Hans Georg Niemeyer

modities whose value within a multinational trade-network25 was calculated along globalized criteria in a merging mediterranean world? It is the particular permanence of corporate and cultural identity, an identity encompassing the experience of Late Bronze Age as well as of Early Iron Age, viz. the late second and the early first Millennium B.C., that enabled the Phoenician merchant venturers to develop the particular pattern of Phoenician expansion to the West so much distinguished from later Greek territorial colonisation, and shaped its bearing on European history. The eminent role played by the Phoenician city-states in the dissemination of urban civilization, in the propagation of technical innovations, in the distribution of new lifestyle paradigms and ‘modern’ economics – as is becoming manifest in the Mediterranean world after the turn from Bronze to Iron Age – can only be appreciated when taking this into account. It can hardly be overestimated.

25 Moore and Lewis 1999, 101-132; cp. Niemeyer, 2003a.

The Phoenicians

Fig. 1

251

252

Hans Georg Niemeyer

Fig. 2

The Phoenicians

Fig. 3

253

254

Hans Georg Niemeyer

Abbildungslegenden Fig. 1: : Phoenician city-states and major towns in the Levant; - : Other important towns in the East. Fig. 2: Phoenician expansion in the Mediterranean, 11th to 6th centuries BC. : Phoenician towns and city-states in the East; - !: Selected early Phoenician settlements in the West, 8th/7th century BC; - ": Towns and other sites with Phoenician enclaves, 8th to 6th centuries BC (cf. Niemeyer 1999, 157). - Areas covered by horizontal hatching: Major mining districts in the West. Fig. 3: Distribution of main ‘Phoenician’ luxury objects in the Ancient Near East and the Mediterranean (drawing by the author).

The Phoenicians

255

Bibliography Burkert, W. 1992: The Orientalizing revolution. Near Eastern influence on Greek culture in the early archaic age. (Cambridge, Mass.). Falsone, G. 1995 : Arts des métaux.! In La civilisation phénicienne et punique (ed. Krings, V.), 426-39. Handbuch der Orientalistik, part I vol. 20. Leiden: Brill. Frankfort, H. 1970: The Art and Architecture of the Ancient Orient. New York: Penguin books. Frede, S. 2000. 2003: Die phönizischen anthropoiden Sarkophage, 1: Fundgruppen und Bestattungskontexte. 2: Die Sarkophage als Zeugnisse interkultureller Kontakte (Mainz). Grau-Zimmermann, B. 1978. Phönikische Metallkannen in den orientalisierenden Horizonten des Mittelmeerraumes.! MM 19: 161-218. Lembke, K. 2001: ‘Phönizische anthropoide Sarkophage’. Damaszener Forschungen, 10. Markoe, G. E. 1985: Phoenician Bronze and Silver Bowls from Cyprus and the Mediterranean. Berkeley, University of California Press. Markoe, G. E. 2000: Phoenicians. Peoples of the Past. London, The British Museum. Matthäus, H. 1999/2000: ‘Das griechische Symposium und der Orient’. Nürnberger Blätter zur Archäologie 16, 41-64. Matthäus, H. 2000: ‘Die Idäische Zeus-Grotte auf Kreta’. Griechenland und der Vordere Orient im frühen 1. Jahrtausend v. Chr. AA, 517–47. Mettinger, T. 1995: No Graven Image? Israelite Aniconism in its Ancient Near Eastern Context. Stockholm, Almquist & Wiksell. Moore, K. and Lewis, D. 1999: Birth of the Multinational. 2000 Years of Ancient Business History – From Ashur to Augustus (Copenhagen). Moscati, S. 1990: L’arte dei Fenici. Milano Niemeyer, H. G. 1984: ‘Die Phönizier und die Mittelmeerwelt im Zeitalter Homers’. JRGZM 31, 3-94. Niemeyer, H. G. 1995: ‘Expansion et colonisation’. In Krings, V. (ed.), La civilisation phénicienne et punique. Manuel de recherche (= Handbuch der Orientalistik I. Der nahe und mittlere Osten, Bd. 20), 247-267. Niemeyer, H. G. 1999: "Die frühe phönizische Expansion im Mittelmeer. Neue Beiträge zu ihrer Beschreibung und ihren Ursachen’. Saeculum. Jahrbuch für Universalgeschichte 50, 153-75. Niemeyer, H. G. 2000: ‘The Early Phoenician City-States on the Mediterranean: Archaeological Elements for their Description’. In Hansen, M. H. (ed.), A Comparative Study of Thirty City-State Cultures. K.Danske Videnskabernes Selskab, Hist.-fil. Skrifter 21, 89–115. Niemeyer, H. G. 2002a: ‘Die Phönizier am Mittelmeer. Neue Forschungen zur frühen Expansion’. In Braun-Holzinger, E.A. und Matthäus, H. (Hrsg.), Die nahöstlichen Kulturen und Griechenland an der Wende vom 2. zum 1. Jahrtausend v.Chr. (Möhnesee), 177-95.

256

Hans Georg Niemeyer

Niemeyer, H. G. 2002b: ‘Archaeological Evidence of Early Iron Technology at Carthage and other Phoenician Settlements’, Mediterranean Archaeology (Sydney) 14, 2001, 83-94. Niemeyer, H. G. 2003: ‘Phoenician Colonisation’. In Tsetskhladze, G. R. (ed.), Greek Colonisation. An Account of Greek Colonies and Other Settlements Overseas (Leiden, forthcoming). Niemeyer, H.G., 2003a: Review of Moore, K. and Lewis, D., Birth of the Multinational. 2000 Years of Ancient Business History – From Ashur to Augustus [1999], Journal of World History 12, 2003, 90-92. Niemeyer, H. G. forthcoming: Review of Frede 2000 and 2003. In Ancient West & East. Ridgway, D. 1992: The First Western Greeks (Cambridge UP). Rittig, D. and B. Borell. 1998: Orientalische und griechische Bronzereliefs aus Olympia. Der Fundkomplex aus Brunnen 17. OlForsch 26. Berlin. Sader, H. 1991. Phoenician Stelae from Tyr#. Berytus 39, 101-26. Sakellarakis, J. A. 1992: ‘The Idaean Cave Ivories’. In Ivory in Greece and the Eastern Mediterranean Mediterranean from the bronze age to the hellenistic period (14th British Museum Classical Colloquium, London 1990), 113-40. Seeden, H. 1991. A Tophet in Tyre?’ Berytus 39, 39-82. Seidl, U. 1999. Orientalische Bleche in Olympia.! ZA 89, 269-82. Shaw, J.W. 1998: ‘Der phönizische Schrein in Kommos auf Kreta (ca. 800)’. In Rolle, R., Schmidt, K. and Docter, R.F., Archäologische Studien in Kontaktzonen der antiken Welt (Göttingen), 93–104. Uehlinger, Chr. 1996: Review of No Graven Image? Israelite Aniconism in its Ancient Near Eastern Context, by T. Mettinger. Biblica 77, 540-9.

IRON AGE CYPRUS: RECENT FINDS AND INTERPRETATIVE STRATEGIES Nancy Demand Cyprus is an island that in many ways represents the concerns of this conference. At the end of the Bronze Age, it was a vital point on east-west sea routes, with a mixed population, and thus it offered many opportunities for cultural interchange. Moreover, from the perspective of modern academic disciplines, Cyprus is very clearly interdisciplinary, not claimed by Classical Greek historians, and not being “properly” in the Levant. As is well known, Cyprus became Greek, in the sense of predominantly Greek-speaking, by reason of an influx of people from the Aegean at some point during the period of the collapse of the Bronze Age palatial states. But exactly when this occurred and whether the newcomers also introduced a political system that developed with unbroken continuity into the Cypriot states of the Archaic and Classical period are central questions in current Cypriot archaeology. In this paper, I concentrate on the second of these questions, the question of continuity. In order to put this question into context, the following brief summary provides a overview of the standard Cypriot chronology, which is based almost entirely on pottery styles that are unique to Cyprus: Late Cypriot IIC [LC IIC] – the 13th century. The acme of the island’s urbanization and prosperity; the presence of Mycenaean pottery suggests that Aegean Greeks were present in small numbers, probably as traders, perhaps even as settlers. Late Cypriot IIIA [LC IIIA] – the 12th century. During the period of the collapse of the Bronze Age palace states and the attacks of the so-called SeaPeoples, a number of sites throughout the island were destroyed, not necessarily contemporaneously. Most destructions were soon followed by rebuilding on the same site. A large influx of locally-made pottery of the Late Mycenaean IIIC:1b style (“Philistine pottery”), initially led to the conclusion that this was the time that the “Achaeans” arrived; however, this view is now disputed. Late Cypriot IIIB [LC IIIB] – 1100-1050. At this point, there were destructions again, and all the old towns were abandoned except for Kition and Palaepaphos, while new towns were established, often near the old centers. Even at Kition and Palaepaphos, new locations were chosen for cemeteries. The towns occupied at this time have been identified as the capitals of the later Cypriot kingdoms of the Archaic and Classical period, and this is the period in which many would now put the influx of Greek-speakers that Hellenized the island.1

1

This scenario is most conveniently summarized by Maria Iacovou, “Society and Settlements in Late Cypriot III,” pp 52-59 in E.Peltenburg, Early Society in Cyprus, Edinburgh: 1989.

258

Nancy Demand

Cypriot Geometric I – 1050-950. A period in dispute: according to one scenario, the collapse of urban structures into tribalism (Dark Age); according to another, existing cities and political systems continued an unbroken development into the capitals of the later kingdoms. In this paper I will first briefly describe recent finds at two archaeological sites, Idalion and Amathus, that bear upon the question of continuity; secondly, I will consider some of the political models that are popular at the moment in reconstructions of Cypriot history of the “Dark Age”. The first site that I will consider, Idalion, lies inland in a metal-rich area at the conjunction of natural routes to the two most important port sites, Salamis and Kition. According to the chronological scenario outlined above, it was one of the new towns in LC IIIB. Nonetheless, even in early excavations there were hints of earlier occupation, consisting of scattered unstratified finds on and around the acropolis hill,2 and some 13th century [LC IIC] material in a tomb.3 However, It was the discovery in 1993 of a new LBA site on the acropolis hill that most seriously disrupted the traditional chronological picture and that brings the hypothesis of a breakdown of organized life in Cyprus at this period into new question.4 At Idalion, the excavation director, Maria Hadjicosti, has identified the remains as an “industrial” quarter, and perhaps the administrative center, of Idalion, dating to the very beginning of the 12th century [LC IIIA], if not earlier. 5 Three successive building phases attest to the continuity of occupation of the site from its 12th century beginnings to at least the Cypriot Geometric period [tenth century, CG I, 1050950]. Finds at the apparently walled site cover ca. 2,000 m² including “industrial” installations or workshops; 4 ovens and at least 37 pits, some identifiable as kilns, with many more still to be explored; and slag, gossan, and pottery that has elsewhere been associated with metal working.. The size of the installations shows clearly the existence of specialized mass production, which, as Hadjicosti notes, presupposes an organized society with an effective central power, an element until this time unknown in Cyprus.

2 3 4 5

Hadjicosti 1998, 36-37 Tomb 1 of the Joint American Expedition in 1976, Stager and Walker 1989. Hadjicosti 1998; 1997. Fragments of a large pithos and “vessels of the Pictorial Style – including a fragment depicting a bull or a goat walking between bushes – date the new site to the very beginning of the Late Cypriot IIIA, if not earlier” [Hadjicosti 1997, 51]. The new site also yielded Myc IIIC:1b material, mainly skyphoi – “Sea People pottery” – (which would correspond to LC IIIA). To date, no architectural remains have been found to confirm that the settlement was established before LC IIIA, but other evidence suggests the possibility of earlier occupation. Finds from LC IIC Tomb 1, which included Levanto-Mycenaean IIIA2/IIIB pottery, provide substantial evidence for an earlier LC IIC occupation of this LBA site. Other hints at earlier occupation include unstratified sherds of earlier date [Base-Ring II, White Slip II, Myc IIIB], a fragment of a skyphos of the Rude Style with pictorial decoration, and reused ashlar blocks in the industrial quarter.

Iron Age Cyprus

259

Hadjicosti has used a Heroic Model to draw conclusions from burial goods at Idalion, relying on the discovery of antiques in two graves. The first, an antique LH III (1400-1200 BCE] three-handled jar, was found in early excavations of a nearby tomb by the Swedish Expedition.6 Hadjicosti suggested that it, “may represent not a chance event, but perhaps the consciousness of people and the reminiscence of the “heroic” past, a phenomenon clearly observed in the Greek world, which helped people to reconstruct their settlements and, in the case of Cyprus, to organize their kingdoms.”7 The second antique, a tankard of Cypriot Base-Ring I ware (LC I, probably 16th century BCE), was found in a tomb in the vicinity of Idalion in 1997-98.8 She commented that the two finds suggested, “that the Geometric community of Idalion was in contact with and followed the same ideas, and perhaps the same ideological trends, as the major coastal Geometric communities on the island... which later became the historical city-kingdoms.”9 While the finds at Idalion challenge the accepted chronological picture of late Cypriot history in occurring in the supposed gap between LC IIIA and B, the second site of new finds, Amathus, fits this scenario very well.10 No evidence of a settlement has been located as yet, but the earliest evidence for occupation dates from about 1050 BCE (the initial stages of CG IA). A group of “fewer than” ten tombs dating from ca. 1000 BCE [CG 1B], excavated in 1986 in the Western cemetery, near the Amathus Beach Hotel, is especially noteworthy. One of these, Tomb 521, contained a high percentage of imported Levantine flasks, reflecting 10th century contacts with the east.11 Another, Tomb 523, contained a large jointed obelos, or roasting spit, which combined the function of a fire-dog with the obelos itself.12 Simple obeloi as items of prestige are found fairly frequently in burials of warriors and important persons in Cyprus, but this complex type is otherwise unknown on the island. Parallels have been found in Spain and the Levantine coast, however, and the excavators concluded that the obelos was evidence that in the 11th or early 10th centuries, “new trade routes were established between the Iberian peninsula, perhaps via Sardinia, and the region of Cyprus, Palestine and Phoenicia.”13 The gap between the earliest finds, dated to ca. 1050 [the early stages of CG 1A], and these cemetery burials, dated to ca. 1000-950 [CG 1B], can arguably be filled by an isolated tomb found one mile west of the Western necropolis, which dates to the end of the 11th century [“a mature stage” of CG IA].14 Along with 6 7 8 9 10 11 12 13 14

Gjerstad et al. 1935, no. 24, pl. 89; Hadjicosti 1997b, 237, fig. 3:1. Hadjicosti 1997, 54. Tomb 19 at Eliouthkia tou Kouzourtou. Hadjicosti 1998, 39. A small ceramic deposit from the acropolis (see Iacovou 1994, 166-67; Aupert 1997, fig. 1) and a chamber tomb on the site of the later temple of Aphrodite, Hermary 1994, 204. Hermary 1999. Karageorghis and Lo Schiavo, 1989. Crielaard 1998, 191-6; Medreros Martin 1996, 101-111. There is uncertainty about the date, however. Tomb 109 Diplostrati, Hermary and Iacovou 1999.

260

Nancy Demand

other luxury grave goods, this tomb contained an antique bronze tripod. The Heroic Model slips in again in the comment of Hermary and Iacovou that this is “another XIth century grave which has been singled out by the inclusion of an antique ... an essential part of a scheme in which selected, possibly chieftain burials, were set apart”.15 The “autochthonous” city of Amathus was until the establishment of the Phoenician city of Kition in the 9th century, 16 a flourishing port that served as a central point of the east-west route between the Levant and Greece, as J.N. Coldstream convincingly argued even before the discovery of the obelos.17 It was here that the first Greek imports after the collapse of the Mycenaean palace states came to light – a Euboean Protogeometric skyphos and cup from a tomb,18 which also contained a Levantine barrel jug.19 Similar finds of Euboean pottery from Lefkandi 20 and from Tyre21 mark end points on an early Euboeo-Phoenician trade route along the south coast of Cyprus. The international connections of Amathus are brought into even clearer focus by the discovery in 1992 in the area of the Western Cemetery, during the construction of an extension of the Amathus Beach Hotel, of a Phoenician cemetery of the 8th century [LG III-Cypriot Archaic]. Rescue operations revealed a cremation cemetery with hundreds of Phoenician cinerary urns.22 230 urns of various types, and a large number of burial gifts, mostly ceramic, were uncovered. The discovery of a large number of infants among the burials of course raised the question whether this had been a Tophet. Twenty-five of the urns and their remains from two separate areas have received intensive study.23 Of these, 23 revealed human interments, 13 with human bones only, 10 with a mixture of human and faunal remains, and two exclusively faunal. The total number of human individuals in this group was 55. In one area, the record shows 3 jars with a single infant burial; one jar holding two infants, one 15 Hermary and Iacovou 1999, 160. 16 Pseudo-Skylax of Caryanda at the end of the 4th century identified the inhabitants of Amathus as autochthonous, and.... as EteoCypriot. In the 4th century, Theopompos attributed the foundation of the city to King Kinyras and his companions, expelled from Paphos by the Greeks on their way back from the Trojan War. While such traditions cannot be trusted as historical reports, it is the case that two official languages were used in the city, at least as early as the 7th century; one of them was Greek, but the other remains undeciphered. On the other hand, the material finds from the site do not differ significantly from the common Cypriot koine that appears throughout the island, suggesting that the population in this earlier period was not culturally distinctive. 17 Coldstream 1986; see also Coldstream 1989. Coldstream’s conclusions have been confirmed by the clay analysis of the vases from Cyprus, Lemos and Hatcher 1991; contra, Popham 1994, 28. 18 Coldstream 1986, 325; Desborough 1957; Gjerstad 1977, nos 1, 2. 19 Desborough 1957, 212 fig. 2a 20 Popham et al 1980, pl. 34: 1 and 3 21 Tyre Stratum IX: Bikai 1978, pl 30:3 22 Cristou 1998; Agelarkis et al. 1998. 23 Agelarkis, Kanta and Stampolides 1998.

Iron Age Cyprus

261

jar with three infants, two jars with five perinatal infants, and two jars each containing ten infants from perinatal to 12 months. In a second area, 11 jars each contained a single burial, mainly of Subadults and Adults, with one individual assessed at 4 to 5 years of age; three jars contained two individuals, including one with a perinatal infant and a male between 16 and 21 years of age. The presence of multiple contemporaneous burials in single jars were especially puzzling, raising questions about the causes of nearly simultaneous deaths, especially in the cases in which five or ten infants up to the age of 12 months were found in a single jar. The examiners all agreed, however, that substantial variations from the practices of known Tophets mean that this cemetery cannot be classified as a Tophet. What is clear is that this is evidence for a substantial Phoenician population at Amathus in the 8th century,24 despite the prior existence of an active and organized Cypriot trading community at the site. The use of cinerary urns and the concentration of infant burials, mixed with a few older individuals, contrasts with the chamber tombs found in other Phoenician cemeteries on the island,25 and suggests that this was a cemetery for those on the fringes of a stratified society. What seems most important is that the firm lines previously drawn between Phoenicians and Greeks on Cyprus no longer seem viable – the two peoples were, at least in Amathus, living side by side. Political Models These recent finds illustrate the gaps in archaeological evidence that frustrate efforts to present a coherent picture. In order to fill these gaps, archaeologists, either explicitly or implicitly, resort to the use of models. In the case of Cyprus, the favored interpretive tools used today are the “Homeric” or “Heroic” model, and various models drawn from anthropological theory. In fact, I have already cited suggestions made by excavators on the basis of the Heroic model for both Idalion and Amathus. In the remainder of this paper, I will consider recent applications of these models. The most popular and frequently used model for Iron Age Cyprus is the Homeric/ Heroic model.26 The reasons for this are strong. Most of the evidence comes from burials, and the burials that stand out often exhibit one or more characteristics that echo the descriptions of the funerals of Patroklos and Hektor in the Iliad [Patroklos Il. 23.175-82; Hector Il. 24. 790-804]. They contain cremation burials in bronze cauldrons, in which the ashes are often wrapped in a special cloth and accompanied by rich grave offerings: the sacrifice of horses, chariots, and even retainers; banqueting equipment including obeloi or roasting spits, drinking vessels, and tripod stands; luxury items and antiques; and objects that may be symbols of au-

24 Possibly the Phoenician “Kartihadast”; Hermary 1987, 378-84; Aupert 1997, 24. 25 Nicolaou 1976, 169-204; Karageorghis 1983; Yon and Callot 1987. 26 A good example is Deger-Jalkotsky 1994.

262

Nancy Demand

thority at various levels – scepters, maces, and shepherd’s crooks. 27 Moreover, a number of approximately contemporary burials in Greece that follow the same pattern also contain some link or other to Cyprus – the “hero” of Lefkandi, buried in an antique Cypriot cauldron;28 the tombs in the North Cemetery at Knossos, with a Cypriot bronze open-work four-legged stand;29 and a warrior burial in the Toumba cemetery at Lefkandi, which contained Cypriot pottery.30 Among these burial goods that are suggestive of kingly power or a heroic lifestyle one stands out – the problematic Kourion scepter, the famous gold and enamel cloisonné scepter crowned by two falcons that is exhibited in the Cyprus Museum.31 It was allegedly found in Tomb 40 at Kourion, along with the rim and handles of a bronze cauldron and two tripods. Tomb 40 was a rock cut tomb of Cypriot type (without the long dromos of typical Mycenaean chamber tombs). The tomb had been robbed; when discovered, it contained a bronze cauldron with the cremation burial of a woman, as well as two bronze tripods, a bronze ring, a spindle whorl and loomweight, nine brooches and a gold pin, as well as abundant pottery, most typical of the second half of the 12th century. Since the scepter had not been found in the tomb, but among looted remains confiscated from tomb robbers, its authenticity was naturally questioned. However, a reinvestigation of the tomb by George McFadden uncovered material that had been overlooked by the looters and that matched the looted materials, supporting his argument that the recovered objects had indeed been found in Tomb 40.32 Most scholars now accept the tomb as the provenance of the scepter.33 A factor that has been debated in regard to the authenticity of the scepter is whether the craft of cloisonné work was practiced in Cyprus at that time. However, the find in 1952 of six cloisonné rings dating to the 13th century at Kouklia/Paphos, shows that such work was present even earlier in Cyprus than this burial. 34 Was the scepter then the possession of a Mycenaean basileus, and does it (and other similar although less spectacular objects apparently signaling authority) attest to “political” continuity from the end of the LBA, to the Cypriot Geometric and ultimately to the Archaic and Classical Cypriot kingdoms? That is the optimistic view, but, even if it was actually part of the original burial equipment of a “ruler,” the scepter may have come to him as loot rather than as a legitimate possession.35 Putting it together with other, less impressive apparent symbols of authority found in other tombs, does, however, lend some weight to the argument 27 28 29 30 31 32 33

Kourou 1994. Popham et al 1980, 1993. Coldstream and Catling 1996. Popham and Lemos 1995. Buitron-Oliver 1998; McFadden 1954; Kourou 1994; Goring 1992. McFadden 1954. Buitron-Oliver 1998; Kourou 1994; Goring 1992; Buitron-Oliver rejects the skepticism of Steel 1996. 34 Maier and Karageorghis 1984, 68. 35 Catling 1994.

Iron Age Cyprus

263

that an organized and even hierarchical structure of power existed in Dark Age Cyprus. Thus Nota Kourou suggests that maceheads are too numerous to have marked kingship, and may have belonged to “a few people holding a supervisory managerial function in the metals industry”, similar to “basileis having a talasia, or allocation of bronze in the Linear B tablets”.36 Recently the Heroic model has undergone a number of transformations. Among the more radical is that created by Ian Morris, who has turned the model upside down, arguing that in Greece it is evidence, not of heroic kingly power, but of the beginnings of Greek democratic egalitarianism.37 Arguing that burials must be understood “in context, within a system of local meaning”, he differentiates the burials in Greece from those in Cyprus and the western Mediterranean. Claude Bérard and François de Polignac had earlier suggested that heroic burial transformed and shifted the power of the hero, but this shift was to the aristocracy.38 In contrast, Ian Morris argues that in Iron Age Greece rich burial was “heroic” in the special sense that the tomb of the hero was turned, not into a resource for the aristocracy, but into a communal resource [“a point of contact with higher powers, which benefited everyone”], thus neutralizing the hero “as a source of social power for any particular individuals.” In this way, burials in Greece expressed a “middling ideology,” in contrast to the “elitist ideology” of Cyprus and the west. Out of this “middling ideology” there developed the Greek principle of civic egalitarianism. This occurred, however, only after a setback in which there was “a partial fragmentation of the order of the race of iron” in which rich burials of the early 9th c., in particular, those at Lefkandi in the Toumba cemetery, may perhaps represent “attempts to turn heroic status into earthly political power”. This setback he blames on the advent of the Phoenicians bringing seductive imports. In the end, however, in his reconstruction, Greek virtue triumphed, and in the 9th century the simpler ritual order was reasserted in Greece, leading eventually to the democratic state. In Cyprus, in contrast, the Tombs of the Kings at Salamis demonstrate the triumph of “earthly political power,” and raise the specter of “oriental despotism”. Morris’ model is clearly Athenocentric, and its refutation by awkward historical actualities is prevented only by his introduction of still another model, the wicked Phoenicians, or the Oriental Despot. A recent entrant into the ring, Jan Paul Crielaard,39 offers a fresh version of the model, the World Wide Web, or Internet.40 Crielaard envisions the source of the elite grave goods in these burials not so much in terms of trade or gift exchange, but in terms of their “surfing” along a series of interacting networks in a Mediterranean-Wide Web. Along with the ob36 Kourou 1994, 214. 37 Morris 1999; in 1972 Bérard suggested that the Eretrian “hero” was the last of the “warrior princes,” buried with the antique bronze lance point that signalled his supreme power, which then passed to a broader aristocracy and a new political ideal of equality; followed by De Polignac 1995/1984. 38 Bérard 1972; 1982; de Polignac 1995/1984, 20, 140-151, power transferred to the aristocracy. 39 Crielaard 1998b, in reference to the burials of the Princes at Eretria. 40 Crielaard 1998a.

264

Nancy Demand

jects went “information exchange,” in which “ideational or ideological components” moved as well. Some of the communities involved in these exchanges were “real,” that is, in direct contact, but others may have been “virtual,” that is, not in physical proximity, but sharing similar ideas and values. Crielaard’s new model is immediately striking, but upon closer consideration, it seems disembodied. It is unclear how the objects surfing along this web could have conveyed information, apart from some sort of story that was passed along with them, and the model does not allow for stories. It is in this respect that the old heroic, or Homeric, model in my opinion still has the edge. It provides explanations for the fact that certain objects were valued and passed along, and suggests a concrete way in which information about them could have been transmitted. Turning to applications of anthropological models, perhaps the most extreme advocate of their use in Cypriot archaeology is David Rupp.41 Rejecting the picture of continuity in Cyprus from the Late Bronze Age the Geometric and Archaic periods, Rupp presents an alternative picture based on not one, but on a number of anthropological models: Tribal Chiefdoms, Heterarchy, Secondary State Formation, and Peer Polity Interaction. He starts from archaeological “facts” – a consideration of survey evidence suggesting a decline in population in the 11th century, as well as an increase in “quantity, variety, and quality” in 8/7th century burial assemblages, but he soon spins beyond these into theoretical territory. Briefly, his reconstruction goes as follows. After the upheavals of the 11th century, on the basis of the apparent decline in population, Rupp postulates a relapse into tribalism, with chieftains as local leaders. These chiefdoms formed a regional network, competing and sometimes fighting with each other [the Heterarchic Model]. That the Phoenicians were able to establish their colony at Kition shows, he argues, that there were no Cypriot states to prevent it. In fact, it was only with the stimulus of the Phoenicians that the Chiefdoms were launched into the process of Secondary State Formation, which spread throughout the island by Peer Polity Interaction. The leaders of these new states were not the heirs of a long-established tradition, but “parvenus,” who “concoct[ed] ancient heroic pedigrees” and created elaborate and imposing funerary assemblages such as the Tombs of the Kings at Salamis in order to legitimatize their rule. Rupp’s methodology leads away from attention to specific archaeological finds, focusing as it does on discussions in theoretical literature. It seems certain, however, that the recent finds outlined in this paper, as well as others, work against his bleak picture of the Cypriot Dark Age and in favor of a continuity of organized communities. To recall only one example, the evidence for a Phoenician presence at Amathus in the 8th century, after a long period of organized occupa-

41 Rupp 1998: 211. Rupp’s bibliography on this question is extensive, but his point remains the same. As the basis for this paper I have used Rupp 1998; I have not given references to the same points in other papers, which include Rupp 1985, 1987a, 1987b, 1988, 1989, 1997.

Iron Age Cyprus

265

tion by Cypriots, argues against Rupp’s claim that Phoenician settlement required a political vacuum. In conclusion, we can ask what the implications of these recent finds and various models are for the question of political continuity in Cyprus from the Late Bronze into later periods. The finds clearly support a picture of the existence of complex structured communities in Cyprus during the so-called Dark Age, but with continuity of a culture of mixed Cypriot, Greek and Phoenician elements. The more traditional uses of the Homeric/Heroic model do provide a context for these findings, but they slight the Cypriot and Phoenician elements of the mix. Of the trendier iterations of this model, Morris' democratic version with its introduction of the wicked Phoenicians adds another model, Oriental Despotism, that seems neither helpful nor justified, while Crielaard’s model of the World Wide Web, while interesting, fails to make the necessary cultural connection. It is David Rupp's complex of models that most directly challenges the hypothesis of continuity, but, even more than Crielaard’s WWW, it is removed from the realities of the archaeological and historical picture. Three forms of Bronze Age civic structure combined in Dark Age Cyprus in varying degrees in various communities: the Aegean Minoan-Mycenaean, the Cypriot, and the Phoenician. Of these, the orientalizing contribution of the Phoenician element had its counterpart in the orientalizing of the culture of Aegean Greece, but the Cypriot contribution was unique. The result was the development of idiosyncratic communities – uniquely Cypriot versions of the widespread Mediterranean city-state model.

266

Nancy Demand

Bibliography Agelarkis, A.P., A. Kanta, and N. Stampolidis 1998. “The Osseous Record in the Western Necropolis of Amathus: an Archaeo-Anthropolgical Investigation,” pp. 217-232 in V.Karageroghis and N.Stampolidis, eds. Eastern Mediterranean: Cyprus-Dodecanese-Crete 17th-6th cent.B.C. Athens. Adelman, C. 1989. “A Late Cypriot IIC Tomb: Idalion Tomb 1.76: Artifactual Remains with Some Historical Observations,” pp. 138-210 in Stager and Walker 1989. Aupert, P. 1997. “Amathus During the First Iron Age,” BASOR 308, 19-25. Bérard, C. 1970. Eretria III. Fouilles et recherches. L’Hérôon à la porte de l’ouest. Bern. Bérard, C. 1972. “Le sceptre du prince,” MusHelv 29:219-227. Bérard, C. 1982. “Recupérer la Mort du Prince: Héroïsation et Formation de la Cité,” pp.89-103 in G.Gnoli and J.-P.Vernant, La mort, les morts dans les sociétés anciennes. Paris. Bikai, P.M. 1978. The Pottery of Tyre. Warminster. Bikai, P.M. 1987. The Phoenician Pottery of Cyprus. Nicosia. Buitron-Oliver, Diana 1998. “Kourion from the 11th to the 8th Century B.C.” pp. 69-77 in Cyprus. The Historicity of the Geometric Horizon. Nicosia. Catling, H.W. 1963. “Patterns of Settlement in Bronze Age Cyprus,” OpAth 4: 129-69. Catling, H.W. 1993. “The Bronze Amphora and Burial Urn,” pp.81-96 in Popham et al 1993. Catling, H.W. 1994. “Cyprus in the 11th century B.C. – An End or a Beginning?” pp. 133-141 in V.Karageoghis, Cyprus in the 11th Century B.C. Nicosia. Catling, H.W. 1995. “Heroes Returned? Subminoan Burials from Crete,” pp. 123130 in Jane B. Carter and Sarah P. Morris, eds. The Ages of Homer. A Tribute to Emily Townsend Vermeule. Austin. Catling, H.W. 1996. “The Subminoan Phase in the North Cemetery at Knossos,” pp. 639-649 in Coldstream and Catling 1996. Coldstream, J.N. 1986. “Kition and Amathus: Some Reflections on their Westward Links during the Early Iron Age,” pp. 321-27 in V.Karageorghis, ed. Cyprus between the Orient and the Occident. Nicosia. Coldstream, J.N. 1989. “Early Greek Visitors to Cyprus and the Eastern Mediterranean,” pp. 91-95 in V.Tatton-Brown, ed. Cyprus and the East Mediterranean in the Iron Age. London. Coldstream, J.N and H.W. Catling 1996. Knossos North Cemetery: Early Greek Tombs. The British School at Athens Supp. Vol. No. 28, 1996, vol. 2. Crielaard 1998a. “Surfing on the Mediterranean Web: Cypriot long-distance Communications during the Eleventh and Tenth Centuries B.C.” pp. 187, 206 in V. Karageroghis and N. Stampolidis, eds. Eastern Mediterranean: CyprusDodecanese-Crete 17th-6th cent.B.C.. Athens. Crielaard, J.P. 1998b. “Cult and Death in Early 7th century Euboea: The Aristocracy and the Polis,” pp. 43-58 in S. Marchegay, M.-T Le Dinahet and J.-

Iron Age Cyprus

267

F.Salles, eds. Nécropoles et Pouvoir: Idéologies, practiques et interprétations. Athens, Lyon, Paris. Cristou, Demos 1998. “Cremations in the Western Necropolis of Amathus,” pp.207-215 in V.Karageroghis and N.Stampolidis, eds. Eastern Mediterranean: Cyprus-Dodecanese-Crete 17th-6th cent.B.C. Athens Deger-Jalkotzy, Sigrid 1994. “The post-palatial period of Greece: An Aegean prelude to the 11th century B.C. in Cyprus,” pp. 11-30 in V.Karageorghis, ed., Proceedings of the International Symposium Cyprus in the 11th Century B.C. Nicosia. Desborough, V.R.d'A. 1957. “A Group of Vases from Amathus,” JHS 77: 212219. Gjerstad, E.et al. 1935. The Swedish Cyprus Expedition. Finds and Results of the Excavations in Cyprus 1927-1931 II. Stockholm. Gjerstad, E. 1977. “Potters from Various Parts of Cyprus,” pp. 23-60 in Y.Calvet, M.Yon, V.Karageorghis, and J.P.Thalmann, eds. Greek Geometric and Archaic Pottery found in Cyprus. Stockholm. Goring, E. 1992. “The Kourion Sceptre; Some Facts and Factoids,” pp. 103-110 in Christine Morris, ed. Klados: Essays in Honour of J.N.Coldstream. London. BICS Supp. 63. Hadjicosti, M. 1998. “Idalion before the Phoenicians: the Archaeological Evidence and its Topographical Distribution,” pp. 35-54 in Iacoviou and Michaelides, 1998. Hadjicosti, M. 1997. “The Kingdom of Idalion in the Light of New Evidence,” BASOR 308: 49-63. Hermary, A. 1997. “Amathonte de Chypre et les Phéniciens,” pp. 375-388 in E. Lipinski, ed., Studi Phoenicia V. Phoenicia and the East Mediterranean in the First Millennium B.C. Leuven Hermary, A. 1994. “La tombe du sanctuaire d’Aphrodite à Amathonte,” RDAC: 197-210. Hermary, A. 1998, “Amathus before the 8th Century B.C.,” 55-68 in Iacoviou and Michaelides, 1998. Hermary, A. and M.Iacovou, 1999. “Amathous-Diplostrati Tomb 109,” RDAC: 151-162. Iacovou, M. 1988. The Pictorial Pottery of Eleventh Century B.C.Cyprus (SIMA LXXVIII). Göteborg. Iacovou, M. 1994, “The Topography of Eleventh Century B.C. Cyprus,” pp. 14965 in Karageorghis 1994. Iacovou, M. 1999. “Excerpta Cypria Geometrica. Materials for a History of Geometric Cyprus,” pp.141-161 in Iacovou and Michaelides 1999. Iacovou, M. and D. Michaeolides. 1999. Cyprus: The Historicity of the Geometric Horizon. Nicosia. Kanta, A. and A.Karetsou 1997. “Cypriot Connections in the Area of Arkadhes, Crete,” pp. 159-68 in Diethnes Archaiologiko Synedreio, 1995 = Cyprus and the Aegean in Antiquity: From the Prehistoric period to the 7th century A.D. Nicosia.

268

Nancy Demand

Karageorghis, J.V. 1988. “L’apport des gloses à notre connaissance du dialecte chypriote ancient,” pp 181-196 in J.V.Karageorghis and O.Masson, The History of the Greek Language in Cyprus. Nicosia. Karageorghis, V. 1983. “New Phoenician Discoveries in Cyprus,” pp. 173-77, Vol 1 in Atti del I Congresso Internazionale di Studi Fenici e Punici. Rome. Karageorghis, V. 1990. The End of the Late Bronze Age in Cyprus. Nicosia. Karageorghis, V. 1994, Proceedings of the International Symposium “Cyprus in the Eleventh Century B.C”. Nicosia. Karageorghis, V. and Iacovou, M. 1990, “Amathus Tomb 521: A CyproGeometric I Group,” RDAC:75-100. Karageorghis, V. and Lo Schiavo, F. 1989. “A West Mediterranean Obelos from Amathus,” Revista di Studi Fenici 17: 15-29. Karageorghis, V. and N. Stampolidis. 1998. Eastern Mediterranean: CyprusDodecanese-Crete: 16th - 6th cent. B.C. Athens. Kling, Barbara 1989. Mycenaean IIC:1b and Related Pottery in Cyprus. Göteborg. Koucky, F.L. and A. Steinberg, 1989. “Ancient Mining and Mineral Dressing on Cyprus,” Pp. 275-327 in L.E. Stager and A.M. Walker, eds. American Expedition to Idalion, Cyprus 1973-1980. Oriental Institute Communications 24, Chicago. Kourou, N. 1994. “Sceptres and Maces in Cyprus before, during and immediately after the llth century,” 203-27 in Karageorghis 1994. Lemos, I.S. and H. Hatcher 1991. “Early Greek Vases in Cyprus: Euboean and Attic,” OJA 10: 197-207. Maier, F.G. 1985. “Factoids in ancient history: the case of fifth-century Cyprus,” JHS 105: 32-39. Maier, F.G. 1999. “Palaipaphos and the Transition to the Early Iron Age,” pp. 7985 in M. Iacovou and D. Michaelides, eds. Cyprus. The Historicity of the Geometric Horizon. Nicosia. Masson, O. 1975, “Le mot ’ ! " “fils, fille” chez les poètes et dans les inscription”, REG 88:1-15. Markoe, Glenn 1998. “The Phoenicians on Crete: Transit Trade and the Search for Ores,” pp. 233-240 in Karageorghis and Stampolidis 1998. Matthäus, H. 1988. “Heirlooms or Tradition – Bronze Stands of the Second and First Millenniums B.C. in Cyprus, Greece and Italy,” pp. 285-300 in E.B. French and KA. Wardle, eds. Problems in Greek Prehistory. Bristol. McFadden, George H. 1954. “A Late Cypriote III Tomb from Kourion,” AJA 58:131-42. Medreros Martin, A. 1996. “La conexion levantino-chipriota. Indicios de comercio atlantico con el Mediterraneo oriental durante el Bronce Final” Trabajos de Prehistoria 53, vol.2: 95-115 Kourou, N. 1994. “Sceptres and Maces in Cyprus before, during and immediately after the llth century,” 203-27 in Karageorghis 1994. Morris, Ian 1999. “Iron Age Greece and the meanings of 'princely tombs'” pp.5780 in Les princes de la Protohistoire et l’émergence de l’État. Actes de la table ronde internationale de Naples (1994) Naples.

Iron Age Cyprus

269

Nicolaou, K. 1976. The Historical Topography of Kition. Göteborg. de Polignac, F. 1995/1984. Cults, Territory and the Origins of the Greek CityState, tr. Janet Lloyd. Chicago. Popham, M.R. 1994. “Precolonisation: early Greek contact with the East,” pp. 1134 in Tsetskhladze and De Angelis 1994. Popham, M.R., L.H. Sackett and P.G. Themelis, 1980. Lefkandi I. The Iron Age. Athens Popham,M.R., P.G. Calligas and L.H. Sackett 1993. Lefkandi II. The Protogeometric Building at Toumba. Athens Popham, M.R. and I.S. Lemos 1995. “A Euboean Warrior Trader,” OJA 151-157. Rupp, D.W.1987a. “The Canadian Palaipaphos Survey Project, 1986.” ASOR Newsletter 38:4. Rupp, D.W. 1987b. “Vive le roi: The Emergence of the State in Iron-Age Cyprus,” pp. 147-68 in D.W. Rupp, ed. Western Cyprus: Connections. An Archaeological Symposium held at Brock University, St. Catharines, Ontario, Canada. March 21-22, 1986. SIMA 77. Rupp, D.W. 1985. “Prolegomena to a Study of Stratification and Social Organization in Iron Age Cyprus,” pp. 119-30 in M. Thompson, M.Y. Garcia and F.J. Keene eds., Status, Social Organization and Stratification: Current Archaeological Reconstructions. Calgary. Rupp, D.W. 1988. “The ‘Royal Tombs’ at Salamis (Cyprus): Ideological Messages of Power and Authority,” JMA 1: 111-39. Rupp, D.W. 1997. “Constructing the Cypriot Iron Age: Present Praxis; Future Possibilities.” BASOR 308: 69-75 Rupp, D.W. 1998. “The Seven kings of the Land of Ia’, a District on Ia-ad-na-na: Achaean Bluebloods, Cypriot Parvenus or Both?” pp. 209-222 in K.J. Hartswick and M.C. Sturgeon, eds. STEPHANOS. Studies in Honor of Brunilde Sismondo Ridgway. Philadelphia. Rupp, D.W.1989. “Puttin’on the Ritz: manifestations of high status in Iron Age Cyprus,” pp. 336-62 in E.J.Peltenburg, ed. Early Society in Cyprus. Stager, L.E. and Walker, A.M. 1974, “Objectives and Procedures,” pp. 1-10 in L.E. Stager, A. Walker, and G.E. Wright, eds. Expedition to Idalion, Cyprus: First Preliminary Report: Seasons of 1971 and 1972. American Schools of Oriental Research Supplement 18, Cambridge, MA. Stager, L.E. and Walker, A.M. 1989: American Expedition to Idalion, Cyprus 1973-1980. Oriental Institute Communications 24, Chicago. Steel, Louise 1996. “Transition from Bronze to Iron at Kourion: A Review of the Tombs from Episkopi Bamboula and Kaloriziki,” ABSA 91:287-300. Tsetskhladze, G.R. and F.De Angelis 1994. The Archaeology of Greek Colonisation: Essays dedicated to Sir John Boardman. Oxford. Yon, M. and O. Callot, 1987. “Nouvelles Découvertes dans la Nécropole de Kition (Aghios Giorghios, Epoque classique),” RDAC: 149-66.

SKLAVEREI IN DER HOMERISCHEN UND ALTORIENTALISCHEN WELT. VERGLEICHENDE BETRACHTUNGEN Ingomar Weiler Der homerischen Welt hat man immer wieder einen patriarchalischen Charakter nachgesagt. Ausführlicher begründet haben diese These vor allem J. A. Lencman und H. Strasburger. Der sowjetische Althistoriker hat, so scheint es, getreu dem marxistisch-leninistischen Geschichtsverständnis eine Entwicklung für die Antike angenommen, nach der die patriarchalische Sklaverei der griechischen Frühzeit in nachhomerischer Zeit von einer Ausbeutersklaverei, die aus einer Zweiklassengesellschaft von freien Eigentümern und unfreien Produzenten bestanden habe, abgelöst wurde. Dabei nennt Lencman als Kennzeichen für das patriarchalische System, bei dem nicht der Mehrwert, sondern die „Produktion unmittelbarer Subsistenzmittel“ im Mittelpunkt stand, drei Komponenten: 1. die wirtschaftliche Selbständigkeit einiger Sklaven; 2. das Fehlen deutlicher Unterschiede zwischen Sklaven und Freien; 3. die milde Behandlung der Sklaven und die Ergebenheit der letzteren ihren Herren gegenüber.1 Die Lektüre des Buches macht an vielen Stellen deutlich, dass Lencman die homerischen Textstellen, welche von den negativen Seiten des Sklavenlebens sprechen, ebenso berücksichtigt, so dass eine Idealisierung oder Idyllisierung keineswegs im Vordergrund steht. Im übrigen ist der Autor der Auffassung, man sollte die sozialökonomische Vorstufe zur homerischen Welt, die Palastwirtschaft in Mykene oder Pylos „mit den nahöstlichen Königs- und Tempelwirtschaften“ vergleichen, denn ein solcher Vergleich sei „weitaus fruchtbarer“ als jener mit der klassischen Polis.2 Mit der epischen Schilderung der vier herrschaftlichen Haushalte von Odysseus, Alkinoos, Menelaos und Nestor habe der Dichter den Typus der Königswirtschaft geprägt wie er auch schon aus den Linear B Täfelchen abzulesen sei.3 Etwas anders verhält es sich m. E. mit H. Strasburgers Darstellung der homerischen Sklaverei.4 Bei seiner Schilderung möchte ich etwas länger verweilen. Hier sei Odysseus „mild wie ein Vater“ (path\r w(j h)/pioj), er gilt dem Autor als ein „Urbild der patriarchalischen Daseinsform“ und als „der menschliche Mittelpunkt 1 2

3 4

Lencman 1966, 294. Methodologisches zur Gesellschaftsanalyse: Ulf 2002, 324f.; 335f. Lencman 1966, 305. Der Autor unterscheidet zwischen Tempel- und Königswirtschaft und betont, dass Pylos zum Typus der Königswirtschaft, nicht zum erstgenannten Typus zu rechnen sei (Lencman 1966, 181). Nach der Einwanderung der Dorier seien die „großen Palastwirtschaften“ auf der Balkanhalbinsel verschwunden. Es ist die Auffassung von Lencman 1966, 200, dass die Königs- und Tempelpaläste des 3. und 2. Jahrtausends in Ägypten und im Zweistromland, im Hethiterreich und in Syrien bei aller Verschiedenheit einen „einheitlichen Typus einer sozialen Organisation“ repräsentierten, der auch für die mykenischen Paläste, nicht aber für die spätere griechische Welt beansprucht werden könne. Lencman 1966, 312. Strasburger: Zum antiken Gesellschaftsideal. Heidelberg 1976.

Ingomar Weiler

271

dieses Kosmos“. Und weiter heißt es: „Die Grundeigenschaften, die vom homerischen König gefordert werden, sind schnell benannt: Überragende persönliche Tapferkeit, unermüdliche Fürsorge für sein Volk, Gerechtigkeit und Milde.“5 Dazu kommt, dass Telemach den Sklaven Eumaios als ‘Väterchen’ (a)/tta), die Sklavin Eurykleia als ‘Mütterchen’ (mai=a) angeredet und Nausikaa ihr Schlafzimmer mit zwei jungen Sklavinnen geteilt habe.6 Eumaios repräsentiere den zufriedenen Sklaven, den Oberhirten, der selbst wieder über einen Sklaven verfügte und der von Laertes „‘fast’ wie ein Kind des Hauses aufgezogen“ worden sei. Schließlich sei „das eigenartigste und äußerste Beispiel, welches der Dichter ersonnen hat, um das unbedingte Treueverhältnis in der Hausgemeinschaft zu symbolisieren, [...] die Geschichte mit dem altersschwachen Hund Argos, der erst in dem Augenblick sterben kann, als er sich mit dem Herrn nach zwanzigjähriger Trennung wiedererkannt hat.“7 Die Sklaverei sei eben, so Strasburger, „natürlicher Bestandteil der Gesellschaftsordnung“ und „rechtmäßige und gottgefällige Lebens- und Wirtschaftsordnung.“8 Dem entspricht durchaus auch der Versuch, die homerischen Götter als „Wächter der menschlichen eu)nomi/h“ im Sinne eines soziomorphen Weltbildes zu interpretieren.9 In diesem sklavenfreundlichen ‘antiken Gesellschaftsideal’ möchte Strasburger eine „[...] Einheitlichkeit der Prinzipien von der Odyssee bis [...] mindestens Columella“10 erkennen. Dabei werden zwar die aus der frühen epischen Tradition bekannten Mißhandlungen von Sklavinnen und Sklaven nicht übergangen, sie gelten aber als Ausnahmeerscheinungen „entarteter Herren,“ was einer Immunisierung des Konzeptes nahe kommt. Die „durchschnittliche antike Realität,“ um deren Rekonstruktion sich Strasburger bemüht, habe anders ausgesehen.11 Etwas nüchterner wird die Einschätzung der Sklaverei in der homerischen Gesellschaft als „overall picture [...] between masters and their female domestic and male agricultural dependants“ auf der Grundlage der Odyssee von N. Fisher geschildert.12 Hier wird zwar auf der einen Seite festgehalten, dass Sklaven bei Homer nicht als bloßes Eigentum („mere property“) behandelt worden und sie in „the moral system of reciprocal giving of honour, hospitality and respect“ integriert seien, auf der anderen Seite zögert Fisher nicht, diese Abhängigen, seien sie

5 6 7 8 9 10 11 12

Strasburger 1976, 21 (Zitat: Od. 2, 47); 16; 18; 20. Od.16,13-31; 19,16; 6,18f.; alle Belege (und weitere) bei Strasburger 1976, 26-30. Strasburger 1976, 30. Ebd. 23. Ebd. 17. Ebd. 53. Ebd. 14 und 32f. Fisher 1995, 49-55; Zitat: 49. – Für die generellen soziologischen Rahmenbedingungen der frühgriechischen Welt, die allerdings die Sklavenfrage kaum berücksichtigen vgl. Finley 1968, 72-113, Ulf 1990, 213-268 (hier wird abschließend auch der Frage des Beitrages der homerischen Epen zur „Lösung der neuen gesellschaftlichen Probleme“ nachgegangen), ders.: 2002, 319-354, und Cartledge 2000, 11-22.

272

Sklaverei in der homerischen und altorientalischen Welt

nun Kriegsbeute oder Raubgut der Piraten „as essentially chattel slaves“ zu bezeichnen.13 Es geht nun im Folgenden nicht um eine Auflistung von Übelständen im Umgang mit unfreien Menschen, sondern um vier grundsätzliche Aspekte, die die Einstellungen gegenüber der Sklaverei betreffen, wie sie in der homerischen Dichtung sichtbar werden (1. Der halbe Mensch, 2. Die Freilassung, 3. Die Sklavenflucht, 4. Das Lösegeld). Im Anschluss daran soll auf der Grundlage dieser vier Punkte ein Vergleich mit der Welt des Alten Orients versucht werden. 1. Der Sklave als ‘halber Mensch’ So ist Gesinde: sobald der Herr nicht treibt und gebietet, Werden sie säumig im Dienst und gehn nicht gern an die Arbeit. Nimmt ja doch der waltende Zeus einem Manne die Hälfte Seiner Tauglichkeit (arete), sobald nur einer zum Knecht wird.14 Mit diesen vier Versen, deren Authentizität nicht unumstritten ist, haben sich zahlreiche Kommentatoren befasst. Der erste in dieser Reihe war wohl Platon, der in einer sich polarisierenden Diskussion, ob man Sklaven trauen darf, behauptete, „daß an einer Sklavenseele nichts Gesundes ist und dass ein Mann mit Verstand (no/oj / nou=j) dieser Sorte von Menschen niemals auch nur das geringste Vertrauen schenkt.“15 Als Argument dafür wird auf Zeus und „unseren weisesten Dichter“ (o( de\ sofw/tatoj h(mi=n tw=n poihtw=n) verwiesen, bei dem es heißt: Halb den Verstand raubt Zeus, der weithindonnernde Herrscher, Männern, welche der Tag der jähen Knechtschaft ereilet. Der Dichter, von dem diese Hexameter stammen, legte sie dem Sklaven Eumaios in den Mund, was m. E. den Gehalt der Aussage noch steigert. Das lässt sich der Platonstelle nicht entnehmen, die übrigens an Stelle der arete von nous spricht.16 Trotz dieser Unterschiede gibt es einen Konsens beider Zitate: „Die Abwertung eines Menschen um die Hälfte als Folge seiner Versklavung.“17 Über diese ‘Halbierung’ des Wertes eines Menschen ist, wie schon angedeutet, viel nachgedacht und geschrieben worden. Für die Genese des Begriffspaares eleutheros / doulos in der archaischen Epoche wählte K. Raaflaub bei seiner Textanalyse die Formel in der Ilias vom Raub des ‘Tages der Freiheit’ (e)leu/qeron h)=mar) als

13 Fisher ebd. 49 und 53. 14 Od. 17,320-323: Üs. J. H. Voss / E. R. Weiss. dmw=ej d¡ eu)=t¡ a\)n mhke/t¡ e)pikrate/wsi a)/naktej, ou)ke/t¡ e)/peit¡ e)qe/lousin e)nai/sima e)rga/zesqai: h(/misu ga/r t¡ a)reth=j a)poai/nutai eu)ru/opa ZeuÜ» a)ne/roj, eu)=t¡ a)/n min kata\ dou/lion h)=mar e(/l$sin. 15 Plat. leg. 776e-777a (Üs. K. Schöpsdau): h(/misu ga/r te no/ou, fhsi/n, a)pamei/retai eu)ru/opa Zeu¢j: a)ndrw=n, ou(=j a)\n dh\ kata\ dou/lion h)=mar e(/l$si. 16 Wickert-Micknat 1983, 231. 17 Bellen 2001, 13.

Ingomar Weiler

273

Ausgangspunkt und konfrontierte sie mit der oben zitierten Odysseestelle.18 Für mich liegt die Quintessenz dieser Gegenüberstellung von doulion emar und eleutheron emar in der Erkenntnis, dass die Rede auf den ‘Tag der Freiheit’ und den ‘Tag der Sklaverei’ in der homerischen Welt nur dort vorkommt, „wo das Augenmerk auf der Tatsache und dem Augenblick des Freiheitsverlustes liegt. Mit der Handlung der Ilias und den frühgriechischen Kriegssitten hängt es zusammen, dass eleutheros nur in kriegerischem Kontext und nur im Hinblick auf Frauen erscheint.“19 Im modernen Schrifttum hat als einer der letzten Altertumswissenschaftler N. Fisher diese Odysseestelle kommentiert. Seiner Ansicht nach signalisiert der Dichter mit der Versklavung einer Person deren definitiven Freiheitsverlust; Fisher nennt das „the sudden, and final, loss of one’s former social status and identity, and the beginning of a wholly new, and inferior and degrading, life.“20 Als Vergleichsbeispiele könnte man („one may [...] compare this insight ...“), so der Autor, an die Konzentrations- und Vernichtungslager des Nationalsozialismus und an O. Pattersons Gleichsetzung von Versklavung und sozialem Tod denken.21 Zuletzt hat H. Bellen diese Homerstelle zum Ausgangspunkt für seine Studie „Vom halben zum ganzen Menschen“ gewählt, in der, wie der Untertitel präzisiert, der umgekehrte Weg eingeschlagen wird: „Der Übergang aus der Sklaverei im Spiegel des antiken und frühchristlichen Freilassungsbrauchtums.“ Ohne auf die Einzelheiten hier näher eingehen zu können, verdient es unsere Aufmerksamkeit, dass Bellen eine Reihe von Belegen anführt, die den Sklaven als „halben Menschen“ einstufen. Das ist vor allem dort der Fall, wo bei gleichem Delikt Strafsummen für Freie und Unfreie verdoppelt oder halbiert werden. Genannt werden dazu das Stadtrecht von Gortyn (Wegführen einer Person: 10 bzw. 5 Statere), das römische Zwölftafelrecht (Knochenbruch: 300 bzw. 150 römische Pfund), die Catilinarische Verschwörung, wo für Anzeigen 200000 bzw. 100000 HS Belohnung gezahlt werden. Aber auch in den frühmittelalterlichen „Leges Visigothorum“ ist den Eltern eines getöteten Kindes ein Pfund bzw. ein halbes Pfund Gold als Bußgeld zu entrichten.22 Die pauschale Aussage, dass der Mann, sobald er zum Sklaven wird, nur mehr halb soviel wert sei wie früher, mag zwar angesichts der zentralen These von O. Patterson, Sklaverei und ‘social death’ seien gleichsetzbar bzw. sie sei ‘a liminal state of social death’, noch als harmlos erscheinen,23 sie kann aber nicht darüber hinwegtäuschen, dass die Unfreien in der homerischen Welt prinzipiell einen inferioren Status innehatten. Daran ändern auch noch so warmherzige Verse über Eumaios und Eurykleia und die modernen Interpretationen einer wohlwollenden Patriarchalität irgendetwas.

18 19 20 21 22 23

Raaflaub 1985, 29f. und 32. Il. 6,455; 16,831; 20,193. Raaflaub 1985, 30. Fisher 1995. 53. Fisher ebd. Nehlsen 1972, 174. Patterson 1982, 293f.

274

Sklaverei in der homerischen und altorientalischen Welt

2. Die Freilassung In der homerischen Welt ist diese Institution nicht dokumentierbar. Der Feststellung von Patterson, „slavery [...] required manumission as an essential precondition,“24 kann daher nicht vorbehaltslos zugestimmt werden. Sieht man von den nicht ganz geklärten Freilassungen im Rahmen der Hierodoulie ab,25 so reichen die frühesten Zeugnisse in Griechenland nicht in die homerische Epoche zurück. Mit Berufung auf die immer noch grundlegende Untersuchung von A. Calderini sind die Anfänge der Freilassung an das Ende des 6. Jahrhunderts zu datieren.26 Als bezeichnend für das Fehlen der rechtlichen Freilassung in der homerischen Welt hat Lencman auf den Umstand verwiesen, dass Eumaios „sich als höchste Belohnung nach langjähriger Sklaverei nicht die Freilassung vor(stellte), sondern die Erlangung ‘eines Hauses, eines Kleros und einer schönen Frau’ (oi)k = o/n te klh=ro/n te 27 polumnh/sthn te gunai=ka) von seinem Herrn.“ Noch deutlicher wird Odysseus mit seinem Versprechen, im Falle eines Sieges über die Freier seine beiden treuen Diener (Eumaios und Philoitios) zu „Freunden und Brüdern (e(ta/rw te ka28 signh/tw te) des Telemach“ zu machen. „Er verspricht ihnen aber nicht die Freiheit,“ fügt Lencman beteuernd hinzu.29 Die Erklärung, die Strasburger für dieses Verhalten vorschlägt, kann mich nicht überzeugen; sie gleicht eher einem Versuch, dem Leser ein mildes Sozialklima der patriarchalischen Gesellschaft suggerieren zu wollen. So heißt es in seinem Kommentar zum Verhalten des Odysseus: „An Freilassung im, wie auch immer modifizierten, rechtlichen Sinne, wie sie die Griechen und Römer später kennen, scheint dabei nicht gedacht zu sein [...]. Das Los eines Sklaven gilt als so befriedigend, daß nicht einmal bei ihm selbst der Wunsch nach Freiheit vermutet wird. Es hieße in diesen vorzivilisatorischen Verhältnissen ja im Regelfall auch nur, ihn aus der wirtschaftlichen und menschlichen Geborgenheit in Gefahren und womöglich Elend hinauszustoßen.“30 3. Die Flucht Im Unterschied zur rechtmäßigen Freilassung eines Sklaven ist die Flucht die zweite Möglichkeit, sich dem Zugriff seines Herren zu entziehen, was nicht bedeuten muss, dass damit der unfreie Status ein Ende gefunden habe. H. Bellen ging bei seinem Versuch, „in das Wesen der Sklavenflucht einzudringen,“ von der inhu24 Patterson 1982, 11; 27 und 201. 25 Albrecht 1978, 129-131. Ausführlich dazu Bömer 1963 und Delekat 1964. 26 Calderini 1908, 6; Garlan 1988, 73: „The practice of manumission is attested from the end of the sixth century, certainly in Chios which [...] was the scene of an early and massive increase in chattel slavery.“ 27 Od. 14,62f.; Lencman 1966, 300f. 28 Od. 21,214f. 29 Lencman ebd. 30 Strasburger 1976, 35f.

Ingomar Weiler

275

manitas aus, mit der Unfreie behandelt wurden.31 Diese Aussage zur Motivation eines Sklaven, das Weite zu suchen, bezieht sich zwar auf den vor allem durch Rechtstexte gut dokumentierten servus fugitivus in der römischen Kaiserzeit, die Hypothese anzunehmen, dass hier ein Elementarbedürfnis misshandelter Menschen vorliege, der Unmenschlichkeit durch Flucht zu entkommen, ist wohl naheliegend. In den Digesten wird der animus fugiendi angesprochen, den Bellen übrigens mit jener disease of the mind, einer ‘Gemütskrankheit’, vergleicht, die amerikanische Ärzte bei entlaufenen Negersklaven diagnostizierten.32 Hier darf wieder einmal an J. Burckhardts Konzept vom „duldenden, strebenden und handelnden Menschen“ erinnert werden, „wie er ist und immer war und sein wird.“33 Dabei sollte dem Streben und Handeln ein Vorzug gegenüber dem Dulden eingeräumt werden. Die Quellenlage ist auf diesem Sektor besonders prekär. Immerhin kennt die Odyssee bereits den technischen Ausdruck für „entlaufen“: Eumaios erzählt Telemachos, dass sein unbekannter Gast ein a)podra/j sei, ein Flüchtling, der einem Piratenschiff (thesprotischer Männer) entkommen sei.34 G. Wickert-Micknat verweist in diesem Kontext auch auf das Verbum katadei=n (festbinden, anbinden) von Gefangenen, ein Vokabel, das auch „für das Anbinden von Haustieren“ und für das Fesseln vor Hinrichtungen verwendet wird.35 4. Das Lösegeld Ein wichtiges Ergebnis der Studien zur „Unfreiheit im Zeitalter der Homerischen Epen“ von G. Wickert-Micknat betrifft die Frage des Lösegeldes und des Anfangs der griechischen Kaufsklaverei. Auf einen Satz gebracht heißt es: „Was in der Ilias kaum im Werden ist [...], erscheint in der Odyssee als Zustand.“36 Hier scheint zusätzlich zu dieser genetischen eine geschlechtsspezifische Perspektive angebracht. Ausgehend von den bekannten Iliasversen, deren Formelcharakter schon seit langem erkannt ist,37 Wie man die Männer erschlägt und die Stadt in Asche verwandelt, 31 Bellen 1971, 155f. 32 Bellen 1971, 128; die Digestenstelle: 21,1,17,8. – Bellen verweist hier auf den amerikanischen Arzt S. W. Cartwright, auf den sich auch S. L. Chorover 1979/1982, 216 bezieht: „‘Das Davonlaufen’, schrieb er [sc. Cartwright], ‘ist unseren Plantagenbesitzern und Aufsehern ebenso bekannt, wie es seinerzeit den alten Griechen bekannt war.’ Die Griechen [...] hatten sogar einen Begriff dafür, nämlich drapetes, der ‘die Tatsache des Davonlaufens’ ebenso ausdrückte wie ‘das Verhältnis, in dem der Flüchtige zu der Person stand, vor der er floh’. Mit diesem Zipfelchen Etymologie bewaffnet, verkündete Cartwright, als Wurzel und Ursache von ‘drapetes’ habe er eine ‘Krankheit des Geistes’ ausgemacht, für die er auch gleich einen Namen wußte: Drapetomanie.“ Vgl. allerdings den Einwand von Timpe 1971, 12. 33 Burckhardt 1963, 4-7. 34 Od. 16,65; 17,516. Wickert-Micknat 1983, 137. 35 Wickert-Micknat ebd. 36 Wickert-Micknat 1983, 55. 37 Kiechle 1969, 530.

276

Sklaverei in der homerischen und altorientalischen Welt

Aber die Kinder entführt und die tiefgegürteten Weiber,38 sollte es gar keine gefangenen Männer geben. Die Episode von Lykaon belehrt uns eines anderen:39 Der von Achill auf der Flucht (feu/gonti) gefangengenommene Priamossohn wurde zunächst nach Lemnos gebracht und dort zum Kauf angeboten. Den Kaufpreis von hundert Rindern (79: e(kato/mboion) bezahlte ein Sohn des Iason (41: w)n= on e)d/ wke). Ein Fremder löste ihn dann um viel (?) aus (42: cei=no/j min e)lu/sato, polla\ d’ e)/dwken). Wir erfahren dabei, dass es sich um den dreifachen Kaufpreis, also um 300 Rinder handelte (80: nu=n de\ lu/mhn tri\j to/ssa porw/n). Von dort floh dann Lykaon heimlich zum väterlichen Palast (44: e)/nqen u(pekprofugw\n patrw/ion i(k / eto dw=ma). Schon zwölf Tage später geriet er aber wieder in die Hände Achills, der beabsichtigte, ihn auf der Stelle zu töten. Flehentlich bat der Gefangene um sein Leben. Als Argument verwies er auf den Umstand, Achill habe ihn an seinem Tisch speisen lassen (77: Dhmh/teroj a)kth/n). Für den neuerlich Gefangenen scheint die Hoffnung, sich nochmals durch Flucht retten zu können, geschwunden zu sein (92: ou) ga\r o)i/w / sa\j xei=raj feu/gesqai) denn Achill hatte mit dem Hinweis gekontert, es hätte nun keinen Sinn mehr, über den Preis eines Loskaufs zu reden (99: mh/ moi a)/poina pifau/skeo mhd’ a)go/reue). Bis zum Tod des Patroklos sei das ganz anders gewesen: Ehe den Patroklos nämlich der Tag des Geschickes erreichte, War ich wohl noch im Herzen geneigt, der Troer zu schonen; Viele auch hab’ ich gefangen verkauft und am Leben gelassen.40 Daraufhin tötete er Lykaon und warf ihn den Fischen vor. Zumindest vier Aspekte dieser ‘Kurzbiographie’ verdienen im Rahmen unserer Fragestellung Beachtung. Damit ist freilich nicht gesagt, dass die „Ilias ein Geschichtsbuch“ sei, sondern nur, dass es im Umgang mit der Unfreiheit bereits gewisse Erfahrungen gegeben hat: 1. Auch Männer überlebten; 2. sie wurden in die Fremde verkauft; 3. mit Lösegeld konnten sie zurückgekauft werden; 4. Flucht der Gefangenen war bekannt. Ein zweites Beispiel, wo ein Kriegsgefangener, in diesem Fall Adrastos, seinen Bezwinger ersuchte, ihn freizulassen, indem er auf den Reichtum seines Vaters verwies, der viele Kleinodien, Bronze und Gold als Lösegeld (a)/poina) anzubieten vermochte, dokumentiert wiederum die Hoffnung, die ein Unfreier hegen konnte.41 Terminologisch darf man in der Sprache des frühen Epos noch keine Prä/ oina für Lösegeld, Entschädigung, werden zision erwarten. Neben dem Ausdruck a)p auch w)n= oj (Kaufpreis), misqo/j (Lohn, Miete) und die Verba lu/w, a)polu/ein (los-

38 39 40 41

Il. 9,593f. (Üs. H. Rupé). Il. 21,33-127. Dazu der Nachtrag von Wickert-Micknat 1983, 69. Il. 21,100-102 (Üs. H. Rupé). Il. 6,47-49. Wickert-Micknat 1983, 36.

Ingomar Weiler

277

kaufen) verwendet.42 Die Redewendungen über die Vereinbarung eines Kaufpreises (w)=non u(pi/sxesqai) verraten nach Wickert-Micknat eine „Vertragssprache,“ die auf ein Formular beim Abschluss eines mündlichen Kaufvertrags (a)/cion w)=non e)/dwke, w)n = on u(pi/sxesqai) schließen lassen: „Der Abschluss des Geschäftes im Menschenhandel wird mit Hilfe von w)n= on e(le/sqai beschrieben; der Käufer ‘gibt’ den Kaufpreis, der Verkäufer ‘ergreift’ ihn.“43 Für die Versklavung von Frauen bieten die frühen Epen wesentlich mehr Anhaltspunkte. In einem Exkurs ihrer Monographie hat G. Wickert-Micknat das Thema „Kaufsklaverei“ in der Ilias im Zusammenhang mit dem beginnenden Menschenhandel untersucht und dabei nachweisen können, auf welche Weise kretische Piraten Frauen und Kinder gefangen genommen und in die Fremde verkauft haben.44 Der Hauptunterschied zwischen den beiden Epen wird vor allem darin gesehen, dass in der Ilias die Versklavungen im Rahmen der Kriegshandlungen vorgenommen wurden, während sie im jüngeren Epos vor allem in den Händen von Piraten und Kaufleuten lag. So hat sich auch in der Welt der Odyssee „ein neues Gewerbe, die Küstenräuberei“45 entwickelt, in der eine der wichtigen Wurzeln des sich nun allmählich etablierenden Sklavenhandels gesehen wird. Über Kaufsummen und Lösegeldzahlungen von unfreien Frauen sind wir gut unterrichtet: Achill läßt Andromaches Mutter gegen Lösegeld frei (Il. 6,427); über den Wert von Sklavinnen kann man sich dort ein Urteil bilden, wo sie als Wettkampfpreis mit einer Wertangabe genannt werden wie bei den Patroklosspielen. Eine Unfreie, die zierliche Arbeiten verrichten kann, bildet zusammen mit einem Dreifuß den ersten Preis im Wagenrennen (Il. 23,263f.); eine andere Sklavin, im Wert von vier Rindern wird als Trostpreis im Ringen vergeben (tessara/boion), während auf den Sieger gleichzeitig ein großes Kochgeschirr, dessen Wert mit einem Dutzend Rinder (duwdeka/boion) angegeben wird, als Belohnung wartet (Il. 23,703-705).46 Laertes hat für Eurykleia, als sie noch ein „blühendes Mädchen“ (prwqh/bhn e)/t’ e)ou=san) war und das er „aus Furcht vor dem Zorne seiner Frau“ nie berührte, zwanzig Rinder gegeben (e)eikosa/boia).47 Diese Art der Bewertung von Menschen, die einerseits als Wettkampfpreis fungieren und nach der für Hirtenvölker 42 Wickert-Micknat 1983, 71 und 75, wo auf die Skepsis von H. J. Wolff gegenüber der Begriffsdeutung von a)/poina und timh/ hingewiesen wird. Dazu auch Ulf, 1990, 4-12. 43 Wickert-Micknat 1983, 140f. 44 Wickert-Micknat 1983, 50-55 und 144-149. Im Demeterhymnos (123-132) erzählt die Göttin ihr Schicksal: Räuber haben sie aus Kreta gewaltsam verschleppt (bi/$ d ) a)e/kousan a)na/gk$ a)/ndrej lhi+sth=rej a)ph/gagon) und fuhren Richtung Thorikos, wo sie dann zusammen mit vielen anderen Frauen (gunai=kej) an Land gingen. Während einer Rast bereitete sie ihre Flucht (la/qr$ d ) o(rmhqei=sa [...] feu=gon) mit der Begründung vor: „[...] sie sollten nicht mich verkaufen, / Nicht ein Geschäft mit mir machen, da sie mich geholt ohne Kaufpreis (o)/fra ke mh/ me a)pria/thn pera/santej e)mh=j a)ponai/ato timh=j). 45 Wickert-Micknat 1983, 55. 46 Wickert-Micknat 1983, 44. ebd. 141: „Diese Wertbestimmung könnte den realen Verhältnissen entsprechen.“ 47 Od. 1,431-433. Wickert-Micknat 1983, 141 hält diese Wertangabe für unrealistisch.

278

Sklaverei in der homerischen und altorientalischen Welt

kennzeichnenden ‘Rinderwährung’ geschätzt wurden, anderseits durch ein in Ansätzen bereits bestehendes Vertragswesen den Besitzer wechseln können, macht auch die Genese bzw. Ableitung der Sklavenbezeichnung a)ndra/poda (Sklaven) von ta\ tetra/poda (Vierfüßler) verständlich. Kriegsbeute konnten materielle Güter, Tiere und eben auch Menschen sein.48 Mit diesen vier Aspekten zur homerischen Sklaverei (der halbe Mensch, Freilassung, Flucht, Menschenhandel) soll zum einen deutlich werden, dass das Bild von der Geborgenheit des Sklaven in der frühgriechischen patriarchalischen Gesellschaft nur die eine Seite der Medaille zeigt. Das haben kompetente Althistoriker schon erkannt. Ein Beispiel: die ausführliche Gnomon-Rezension von P. A. Brunt, der meint: „There are features here of a Never-Never Land.“49 Zum anderen liefert das hier ausgebreitete Material eine Folie für den Vergleich mit den altorientalischen Verhältnissen. Einen solchen hat H. Strasburger ganz bewusst gemieden, wie die Feststellung zeigt: „Ich beschränke meinen eigenen Beitrag [...] auf dieses mein Fachgebiet [sc. die griechisch-römische Althistorie] und werde weder aus zweiter Hand vom Gruppenverhalten der Affen noch von Mittelalter und Neuzeit, geschweige denn außereuropäischen Kulturen reden.“ Auch der Alte Orient wird also exkludiert. Andere Autoren wie J. A. Lencman, G. Wickert-Micknat und Y. Garlan werfen zumindest gelegentlich Seitenblicke auf die altorientalische Sklaverei. Das gilt auch für O. Patterson, der für seine „Comparative Study“ zur Sklaverei auch zahlreiche altorientalische und ägyptologische Publikationen konsultiert.50 Ich habe daher im zweiten Teil die Absicht, mich mit der Frage zu befassen, ob jene vier ausgewählten Phänomene der homerischen Sklaverei auch im Alten 48 Wickert-Micknat 1983, 34. 49 Brunt 1979, 43-448. 50 Ohne hier eine vollständige Liste anzugeben, seien einige seiner Gewährsmänner hier mit ihren Werken genannt: A. M. Bakir: Slavery in Pharaonic Egypt. Kairo 1952 (ND1978); M. Dandamaev: Foreign Slaves on Estates of the Achaemenid Kings and Their Nobles. Moskau 1960; I. M. Diakonoff: The Commune in the Ancient East as Treated in the Works of Sovjet Researchers. In: S. P. Dunn - E. Dunn (Hg.): Introduction to Sovjet Ethnography. London 1974 (Social Science Research Station); G. R. Driver - J. C. Miles (Hg.): The Babylonian Law. Oxford 1960; I. J. Gelb: From Freedom to Slavery. In: Gesellschaftsklassen im Alten Zweistromland und in den angrenzenden Gebieten. XVIII. Rencontre assyriologique internationale. München 29.6. bis 3.7.1970. München 1972 (BAW, Philos.-histor. Klasse, Abhandlungen N.F. 75); ders.: Prisoners of War in Early Mesopotamia. In: JNES 32 (1973); E. Levy: Captivus redemptus. In: Classical Philology 38 (1943); I. Mendelsohn: Legal Aspects of the Slavery in Babylonia, Assyria and Palestine. A Comparative Study (3000-500 B.C.). Diss. Columbia University, Williamsport PA 1932; J. Rabinowitz: Manumission of Slaves in Roman Law and Oriental Law. In: JNES 19 (1960); I. I. Semenov: The Problem of the Socioeconomic Order of the Ancient Near East. In: S. P. Dunn - E. Dunn (Hg.): Introduction to Sovjet Ethnography. London 1974 (Social Science Research Station); B. J. Siegel: Slavery during the Third Dynasty (Memoirs of the American Anthropological Association, No. 66) 1947; V. V. Struve: The Problem of Genesis, Development, and Disintegration of the Slave Societies in the Ancient Orient. In: I. M. Diakonoff (Hg.): Ancient Mesopotamia. Moskau 1969; W. L. Westermann: The Slave Systems of the Greek and Roman Antiquity. Philadelphia 1955 (Memoirs of the American Philosophical Society for Promoting Useful Knowledge 40).

Ingomar Weiler

279

Orient präsent sind. Abgesehen von dem generellen Interesse an strukturellen Sozialordnungen und ihrem Wandel, was einen Vergleich der frühen griechische Sklaverei mit der altorientalischen evoziert, gehört es zu den Zielsetzungen dieser Abhandlung, einen Beitrag zur Klärung der Frage zu leisten, ob bei der Beendigung des Sklavenstatus Ähnlichkeiten zu beobachten sind und diese auch ein Grundmuster (pattern) erkennen lassen. Bestärkt fühle ich mich zu einem derartigen komparativen Unternehmen durch Analysen und Beobachtungen zur Sklaverei im archaischen Griechenland und im Vorderen Orient, wie sie durch wechselseitige Verweise von Altorientalisten auf die homerische Sklaverei bzw. von Althistorikern auf den Alten Orient gemacht wurden. 51 Auch das genannte umfangund materialreiche Werk des amerikanischen Soziologen O. Patterson stimuliert zu diesem Vorhaben. Bei einem solchen Vergleich sind jedoch zunächst einmal zumindest drei wesentliche methodische Einschränkungen zu berücksichtigen: 1. Die Unterschiedlichkeit der verfügbaren Quellenkategorien. Im Alten Orient und in Ägypten liefern vor allem urkundliche Rechts- und Wirtschaftstexte, gelegentlich auch Briefe das Fundament für das Studium der verschiedenen Formen der Beendigung des Status der Unfreiheit. Die epische Tradition beschränkt sich, soweit ich sehe, auf einige wenige Informationen im Tukulti-Ninurta Epos52 und auf Texte wie die 1983 edierte hurritsch-hethitische Bilingue (1983), die man als „Lied der Freilassung“ betitelt hat.53 2. Die zweite Einschränkung resultiert daraus, dass die homerische Sklaverei, wenn man von den Differenzen zwischen Ilias und Odyssee einmal absieht, doch eine weitgehend homogene Sozialordnung schildert, wie sie vor allem für das späte 8. und das 7. Jahrhundert in der Ägäis und in Hellas charakteristisch ist. Daran ändert auch der Tatbestand wenig, dass das ältere Epos hauptsächlich von im Krieg eroberten Sklavinnen, die Odyssee vom Anteil der Piraterie und von der Rolle der Sklaverei in der Oikenwirtschaft handelt.54 Dem gegenüber stehen altorientalische Dokumente, die sowohl zeitlich als auch geographisch aus einer heterogenen Welt stammen und thematisch große Divergenzen aufweisen. 3. Das Terminologie-Problem. Hier kann weder für die homerische, noch für die altorientalische Welt auf ein einheitliches Begriffsinstrumentarium rekurriert werden. F. Gschnitzer hat von den „großen Vier“ der griechischen Sklaventerminologie gesprochen und damit dou=loj, dmw/j, oi)ke/thj und 55 a)ndra/podon bzw. die femininen Formen gemeint. Der homerische Wortschatz unterscheidet sich von diesen ‘klassischen’ Begriffen erheblich: dou=loj kommt nur in abgeleiteten Wörtern wie doúlios (sklavisch), doulosýne (Knechtschaft) und in der femininen Form (dou/lh) vor,56 ansonsten dominie51 52 53 54 55 56

Wickert-Micknat 1983, 211; Mendelsohn 1949, bes. 4f. und 121. Malul 1988, 46. Burkert 1993, 11-30. Schumacher 2001, 44. Wickert-Micknat 1983, 93-96 („Seeraub statt Krieg“). Gschnitzer 1976, 104-115. Gschnitzer 1976, 2f. Zur Terminologie vgl. auch Brockmeyer 1979, 36f.

280

Sklaverei in der homerischen und altorientalischen Welt

ren dmwh//dmw/j sowie geschlechtsneutrale Ausdrücke wie oi)keu/j und a)mfi/poloj Nach F. Gschnitzer besteht bei Homer „offenbar Neigung, die Sklaven mit euphemistisch-zurückhaltenden Bezeichnungen zu belegen, sie etwa [...] als ‘Leute des Hauses’ (scheinbar) von den freien Familienangehörigen zu scheiden,“57 was sich zugegebenermaßen auch zwanglos in das Bild von der oben besprochenen homerischen Geborgenheit der Sklaven fügt. Weniger gut zum patriarchalischen Charakter passt das (allerdings nur einmal bezeugte) Wort a)ndra/podon, dem der beschönigende Gehalt dezidiert abgesprochen werden kann. Es bedeutet bekanntlich in Analogie zu tetra/pouj (vierbeinig) den ‘auf Menschenfüßen gehenden Teil der Kriegsbeute’, eine Bezeichnung, die Gschnitzer mit Ausdrücken vergleicht wie ‘Köpfe’, ‘Stücke’ oder ‘Körper’ (sw/mata).58 Bei I. J. Gelb findet sich allein für das frühe Mesopotamien ebenfalls eine bunte Palette von Termini, darunter arad und ir für männliche Sklaven und gemé für Sklavinnen, das Neutrum sag für ‘Kopf’ mit den entsprechenden Geschlechtsdifferenzierungen (männlich: sag-nita, weiblich: sag-SAL); ferner das unklare šubur – die meisten dieser Ausdrücke haben nach Gelb „meanings quite different from those denoting chattel slavery,“59 ausgenommen arad (‘chattelslave’). ir11 entspricht dem „domestic, patriarchal type of slavery“ im Gegensatz zu den Kaufsklaven, welche ihren Ursprung in fremden Gebieten hatten.60 Angesichts des Bedeutungswandels von gemé, das zunächst eine ‘Frau’ bezeichnet, später dann „dependent woman [...] unfree or semifree,“ verweist Gelb auch auf die Terminologie der homerischen Epen, wo – mit Berufung auf J. A. Lencman – der griechische Terminus gunh/ / gu61 nai=kej by far the most common term for slave“ sei. Dieser Auffassung 62 kann nur sehr bedingt zugestimmt werden, was aber hier nicht entscheidend ist. Entscheidend ist vielmehr, dass sowohl Gelb als auch Gschnitzer, von denen unser knapper terminologischer Exkurs ausgegangen ist, die verschiedenen Formen der Unfreiheit beide pauschal mit dem Begriff ‘Sklave’ bzw. ‘slave’ bezeichnen. Es erscheint auch aus heuristischen Gründen legitim, Vergleiche zwischen des unterschiedlichen Gesellschaftsformen unter Anwendung dieses weder in der antiken noch in der altorientalischen Welt bekannten generellen Sklavenbegriffs anzustellen. Was nämlich F. Gschnitzer für die griechisch-römische Terminologie feststellte – „Sklaven (douloi, servi) waren alle Personen, die nicht zu den Freien (eleutheroi, liberi) gehörten – das wird m. E. wohl in analoger Form auch für den Alten Orient gelten, zumal auch die Rechtslage diesen eindeutigen

57 58 59 60 61 62

Gschnitzer 1976, 111. Gschnitzer 1976, 70. Gelb 1982, 81. Gelb 1982, 88. Gelb 1982, 92. Vgl. etwa Wickert-Micknat 1983, 157, und Gschnitzer 1976, 5.

Ingomar Weiler

281

Unterschied zwischen den „verschiedenen Spielarten der Unfreiheit“ kennt.63 Nach diesen methodischen Präliminarien lenke ich die Aufmerksamkeit des Lesers nun auf den Vergleich. Wie in der homerischen Gesellschaft agieren die Sklaven auch in der Welt des Alten Orients zu keinem Zeitpunkt als die „Hauptklasse der Produzenten.“64 Wie bei Homer sind die meisten Sklaven in Privathaushalten beschäftigt.65 Wie bei Homer scheint die Zahl der Sklavinnen größer zu sein, was wohl mit der bekannten Praxis erklärbar ist, dass Männer im Krieg eher getötet als versklavt werden. Darauf haben unter anderem J. J. Gelb und J. M. Diakonoff hingewiesen und festgestellt, dass seit frühsumerischer Zeit männliche Kriegsgefangene getötet und auch in späteren Perioden in der Regel nicht als Sklaven beschäftigt wurden.66 H. Neumann betont einen Unterschied: Während man „Kriegsgefangene und Deportierte“, wenn sie überhaupt überlebten, vor allem in der Palastund Tempelwirtschaft beschäftigte, kamen einheimische Personen, die versklavt wurden, vor allem in privaten Haushalten zum Einsatz.67 Die Rekrutierung der Sklaven erfolgte aus dem Kreis der Schuldknechte, d.h. jener Personen, die entweder sich selbst oder ihre eigenen Kinder verkauften. Dazu kommen noch Deportierte und von Piraten Gefangene. Gelb hat darauf hingewiesen, dass „kiddnapping“ die wichtigste Quelle während aller Perioden der mesopotamischen Geschichte war („the main source of servile labor of ancient Mesopotamia and the Ancient Near East in general“).68 Hier zeigt sich eine Parallele insbesondere zur Odyssee. Eine kleine Sammlung von frugilegia aus der altorientalischen Sklavenliteratur soll es möglich machen, einige der Konkordanzen und Divergenzen mit der Unfreiheit in den homerischen Epen zu vergleichen. Damit soll aber weder zum Ausdruck gebracht werden, dass hier eine Einflussnahme seitens des Alten Orients auf das frühe Griechenland vorliegt, noch soll sie prinzipiell in Abrede gestellt werden. 1. Der halbe Mensch Im Codex Hammurapi zahlt, wer ein Auge oder einen Knochen eines Palastangehörigen zerstört oder zerbricht, eine Mine Silber, bei einem Sklaven die Hälfte des Kaufpreises (§§ 198, 199). Beschädigt ein Arzt mit dem Operationsmesser ein Auge, hat er ebenfalls die Hälfte des Kaufpreises zu entrichten (§ 220). Von Interesse ist auch Paragraph 225, der bestimmt, dass bei Verletzungen von Tieren mit

63 64 65 66 67 68

Gschnitzer 1999, 478. Neumann 1989, 220f. Neumann 1989, 221. Siehe Gelb 1973, 72, und Diakonoff 1974, 519. Vgl. dazu auch Patterson 1982, 121. Neumann 1989, 223. Gelb 1972, 84. Vgl. Patterson 1982, 115.

282

Sklaverei in der homerischen und altorientalischen Welt

Todesfolge als Strafsumme ein Viertel des Preises zu zahlen sei.69 In den Rechtsbüchern der Hethiter heißt es, wer einen freien Mann oder eine freie Frau erschlägt, soll dafür vier Personen stellen, bei einem Sklaven oder einer Sklavin zwei Personen (§§1 und 2). Stiehlt ein Freier Getreide, so hat er 12 Schekel Silber zu entrichten, ein Sklave die Hälfte (§§ 96 und 97. Woher soll der Sklave auch so viel Silber nehmen?). 2. Freilassung Von den zwei Hauptmöglichkeiten, den Status eines Unfreien zu beenden oder zumindest ein Leben in Unabhängigkeit zu führen, nämlich durch eine rechtlich anerkannte Freilassung oder durch Flucht, ist für die Welt Homers nur die Flucht bezeugt. Während die Quellenlage über den Kauf und Verkauf von Sklaven als günstig bezeichnet werden kann, lässt sich Gleiches von der Freilassung nicht behaupten. In den homerischen Epen findet sich, wie oben schon festzustellen war, kein Hinweis auf Freilassungen. Demgegenüber liefern die Keilschrifttexte doch eine Reihe von Urkunden mit wichtigen Einsichten.70 Im Alten Orient ist das Institut der Freilassung seit sumerischer Zeit rechtlich verankert. Der Terminus technicus hiefür lautet ama-ar-gi4 gar: „Freilassung setzen, freilassen“; dieser Ausdruck ist erstmals um das Jahr 2430 bezeugt.71 Nach Dandamaev gilt zwar grundsätzlich für die gesamte babylonische Geschichte, dass der Statustransfer von Unfrei zu Frei nahezu unbekannt („almost unknown“) war, es lässt sich aber nicht leugnen, dass die gesetzlich sanktionierten Freilassungen tatsächlich auch praktiziert wurden.72 Diesen Tatbestand untermauern jene Nachrichten, die eine Formalisierung und Ritualisierung der Manumissionsakte bezeugen. Mit den rituellen und symbolischen Aspekten der Freilassung hat sich M. Malul ausführlicher befasst. Danach lassen sich zwei Zeremonien typologisch unterscheiden: 1. Ein symbolischer Reinigungsakt, bei dem Öl auf das Haupt des Sklaven gegossen wird; 2. eine Form, bei der ein Gefäß zerschlagen wird, was Malul als „the metaphor of nullification“ interpretiert. Es kommt auch vor, dass beide symbolischen Handlungen im gleichen Freilassungsdokument erwähnt werden.73

69 Diese und die folgenden Belege aus Rechtstexten stammen aus Borger - Lutzmann - Römer von Schuler 1982. 70 Neumann 1989, 226. 71 Neumann 1989, 226f. 72 Dandamaev 1984, 648: „Throughout the entire history of Babylonia actual cases of transfer from one status to another are almost unknown. Manumission of slaves was legally permitted but actually occurred very rarely.“ Siehe auch 1982, 218. 73 Malul 1988, 40f.

Ingomar Weiler

283

Den rechtlichen Rahmenbedingungen bei den Manumissionen hat I. Mendelsohn mehrere Studien gewidmet. Dabei ist er vom Codex Hammurapi ausgegangen, wo vier unterschiedliche Möglichkeiten („four legal ways“) erkennbar sind, die einem Sklaven seine Freiheit garantieren:74 1. Frauen und Kinder, die wegen einer Schuld einem Gläubiger übergeben werden, sind nach drei Dienstjahren freizulassen; 2. das gilt auch für Kinder aus rechtsgültigen Ehen zwischen freien Frauen und Sklaven; 3. eine Sklavin, die als Konkubine lebt, und ihre Kinder erlangen mit dem Tod des Herren die Freiheit; 4. Freiheit gebührt auch einem babylonischen Sklaven, der im Ausland gekauft und nach Babylon zurückgebracht wird. H. Klengel hat zusätzlich auf das Edikt des Ammi½aduqa verwiesen, das in genereller Form Freilassungen von Schuldsklaven anordnete.75 Hier ist auch ein sumerisches Gesetz zu erwähnen, demzufolge jenen Sklaven, die von ihren Herren wegen Krankheit oder Alter ausgesetzt wurden, Freiheit als „a gift from the king“ geschenkt wird.76 Nach A. Falkenstein findet sich der „früheste Beleg“ bei Urukagina, „wonach versklavte Babylonier im Zusammenhang mit dem ‘Setzen von Recht (und) Gerechtigkeit in Sumer (und) Akkad’ durch den König freigelassen wurden.“77 Ansonsten ist aus der Frühzeit kaum etwas bekannt. Die neusumerischen Gerichtsurkunden hingegen, die dieser Altorientalist gesammelt, analysiert und publiziert hat, informieren über Einzelheiten der Rechtspraxis. Hier geht es neben anderem konkret um „zu Unrecht behauptete Freilassung“, um den Rechtsterminus für ‘freilassen’ (ama-ar-gi4-ni in-gar): „er hat seine Freilassung gesetzt“ (= akkadisch andur ršu iškun) und um „Freilassung seitens Privatpersonen als auch die durch den Palast.“ Hier wird auch deutlich, dass mit einer Freilassung die vollen Bürgerrechte erworben werden konnten, wobei die Legalisierung dieses Rechtsaktes vor dem „Stadtfürsten oder den Richtern ausgesprochen“ wurden und sowohl mit als 74 Mendelsohn 1932, 62. Zitiert werden CH §§ 117, 175, 171 und 280. 75 Klengel 1977, 220: „Hatte Hammurapi in seinen Gesetzen festgelegt, daß Schuldknechte prinzipiell nur drei Jahre im Hause des Gläubigers dienen sollten (§ 117), so verfügte Ammisaduqa nun für bestimmte Gebiete bzw. Städte seines Reiches die sofortige Freilassung der Schuldsklaven, sofern sie nicht schon vorher Sklaven gewesen waren: ‘Wenn einen freien Mann von Numchia, einen freien Mann von Emutbalum (Jamutbal), einen freien Mann von Idamaraz, einen Freien Mann von Uruk, einen freien Mann von Isin, einen freien Mann von Kisurra, einen freien Mann von Malgum eine Schuldverpflichtung gebunden hatte und er infolgedessen sich selbst, seine Ehefrau oder seine Kinder für Silber in ein Gewaltverhältnis oder als Pfand gegeben hatte - weil der König gerechte Ordnung dem Lande geschaffen hat, ist er freigelassen, seine Freiheit wiederhergestellt.’ Wir wissen nicht mit Sicherheit, warum gerade diese Orte genannt werden; immerhin fällt es auf, daß Idamaraz, Jamutbal, Uruk, Isin und Kisurra in den Jahresdaten 10 und 13 des Samsuiluna als besiegt erwähnt wurden - sollten jetzt die Bereiche eindeutig dem übrigen Babylonien gleichgestellt und in die Seisachthie einbezogen werden?“ 76 Mendelsohn 1932, 62. 77 Falkenstein 1956, 1. Teil, 93.

284

Sklaverei in der homerischen und altorientalischen Welt

auch ohne rituelle Handlungen erfolgen konnte. Der Umstand, dass der Sklavenstatus offiziell beendet und die freie Person unter die Bürger aufgenommen wurde, hat auch Anlass geboten, dieses Freilassungsverfahren mit der Verleihung der civitas Romana an ehemalige Sklaven zu vergleichen.78 Bemerkenswert sind auch Verfahren, die dem Freizulassenden Auflagen erteilten in einer Form, die an die griechischen paramoné-Bestimmungen erinnern.79 Es handelt sich dabei im Alten Orient sozusagen um Freilassungen mit aufschiebender Wirkung.80 Freilich sind diese, wie überhaupt Freilassungen, in Griechenland erst aus nachhomerischer Zeit bekannt.81 Ein neusumerisches Dokument berichtet über eine solche Freilassungskondition, die einer Sklavin bei ihrer ‘Selbstauslösung’ auferlegt wurde: „Am[mazaza], die Sklavin des A’[aduga], hat sich gegenüber A’[aduga] ausge[löst] [...]. 1/3 Mine Silber und eine al-Kuh [nach dem Herausgeber „ein ungewöhnlich hohes Lösegeld“] hat sie ihm als ihren vollständigen Kaufpreis gezahlt. Solange A’aduga und Ninabbana leben, wird sie bei deren Kindern und deren Gatten [Dienst] tun [...]. Nach dem Tode des A’aduga und der Ninabbana wird Ammazaza gehen, wohin sie will [...], niemand wird sie einklagen.“82 Die Verpflichtung für die freigelassene Sklavin, im gleichen Haushalt zu bleiben, und zwar entweder lebenslänglich oder solange der Freilasser bzw. seine Frau noch leben, begegnet unter anderem auch in den delphischen Urkunden und zählt zu den gängigsten Paramone-Bedingungen (paramonh/ von parame/nein: dabeibleiben, aushalten).83 Diese vertraglichen Vereinbarungen, die den Freigelassenen zum Bleiben im Haushalt seines Freilassers zwangen, haben im Alten Orient ebenso wie in Griechenland auch die Gerichte immer wieder beschäftigt, wozu noch Anfechtungen einer bereits ausgesprochenen Freilassung durch die Erben, wie überhaupt erbrechtliche Probleme, die aus einer Freilassung resultierten, kamen.84 A. Falkenstein hat mehrere Vindikationsprozesse von Freigelassenen dokumentiert.85 Trotz all dieser Möglichkeiten, den Status eines Unfreien zu verlassen, hat Dandamaev die Grenzen betont, die den Sklaven in seiner Abhängigkeit von seinem Herrn zeigen. Nur wenn der Herr der Freilassung zustimmt, kann sie gewährt werden: „Even the richest slave possessed no right to acquire liberty, because the 78 79 80 81 82 83

Rabinowitz 1960, 42-45. Neumann 1989, 228f. Zur kontroversen Auslegung der aufschiebenden Wirkung vgl. Neumann 1989, 228f. Falkenstein 1956, 1, 92-94. Falkenstein 1956, 1, 95. Vgl. auch die etwas abweichende Lesart von Neumann 1989, 229. Thür 2000, 319f. Diese bedingten Freilassungen konnten sich auch auf die Kinder der Sklaven beziehen. Dem unter Paramone-Auflagen Freigelassenen bot sich zuweilen auch die Möglichkeit des vorzeitigen Freikaufs oder der Stellung eines Ersatzes. Ausführliche Darstellungen zur paramone in Delphi und anderen griechischen Orten bei Bömer 1960, 38-46 bzw. 68-76; weiters siehe dazu die Monographie von Albrecht 1978. – Auch über die Berechtigung, die paramone mit der römischen Einrichtung der operae libertorum / libertarum gleichzusetzen, sind Argumente ausgetauscht worden. Vgl. dazu Waldstein 1986, 106-109. 84 Vgl. Neumann 1989, 230-232. 85 Falkenstein 1956, 2. Teil 284, 297, 344f.

285

Ingomar Weiler

right of manumission of a slave belonged exclusively to the slave’s owner. The richer the slave was, the more unprofitable it was for the master to set the slave free.“86 Abgesehen von den bisher erwähnten Möglichkeiten gab es im Alten Orient zwei weitere Formen der Freilassung, denen I. Mendelsohn besondere Aufmerksamkeit schenkt: Freilassung durch Adoption und durch Freikauf. Sie unterscheiden sich in einem wesentlichen Punkt: „In the first case, the declaration of freedom was revocable; in the latter, irrevocable.“87 Als Motiv für die Adoption sieht der Autor primär den Wunsch, sich die Arbeitskraft des Adoptierten für den Haushalt und insbesondere für die obligatorische Versorgung der Eltern sicherzustellen. Hier traten jene paramoné-Bedingungen in Kraft, von denen schon oben die Rede war. Mit dem Tod desjenigen, der die Adoption durchführte, erlöschten diese Verpflichtungen und der Sklave wurde frei. Die Bedeutung der Adoption im Alten Orient bei der Statusänderung bestätigen zahlreiche Urkunden.88 Über den Kauf der Freiheit wird gleich noch zu sprechen sein. Eine Vergleichsstatistik der Freilassungszahlen („rates of manumissions“), die O. Patterson auf der Basis der „world samples“ von G. P. Murdock89 errechnet hat, stellt einen Versuch dar, Babylonien in ein Ensemble anderer Gesellschaften einzuordnen; dabei werden je nach Häufigkeit der Freilassung drei Kategorien unterschieden, was für den Vergleich mit der homerischen Welt aufschlussreich ist, auch wenn die Griechen hier von Murdock nicht berücksichtigt wurden:90 selten

nicht ungewöhnlich

häufig

37% Herren explizit gegen Fl Maori Ashanti Comanche + weitere 15 Gesellschaften

20% Fl für ao. Sklaven Hebräer Kenuzi Nubiens Tanala + weitere 7 Gesellschaften

43% ca. 25% Fl Babylon Römer Azteken + weitere 18 Gesellschaften

3. Flucht Ein des öfteren zitiertes Beispiel von Sklavenflucht, das mehrere Facetten des Statuswechsels sichtbar macht, bietet eine Urkunde aus dem 17. Jh. (Zeit des babylonischen Herrschers Ammiditana): „Ein Sklave, der von seinem Herrn ins ‘Ausland’ verkauft worden war, flüchtete nach fünfjährigem Sklavendasein nach Babylon, wurde dort frei, obgleich er nicht losgekauft worden war, doch sollte er dafür unter die Soldaten. Er wollte jedoch lieber den Königsdienst seiner Familie 86 87 88 89 90

Dandamaev 1984, 657f. Mendelsohn 1932, 64f. Siehe Klengel 1977, 214f., Mendelsohn 1932, 66f. und Malul 1988, 41-43. Murdock 1967, 109-263. Patterson 1982, 271.

286

Sklaverei in der homerischen und altorientalischen Welt

teilen und Kronland bestellen, was ihm mit Einverständnis seiner Brüder, die an seinem früheren Sklavenstatus nicht Anstoß nahmen, auch genehmigt wurde.“91 Hier interessiert nur das Faktum der Flucht und der Umstand, dass die DreiJahresfrist für Versklavung, die der Codex Hammurapi vorsieht, irrelevant bleiben konnte. Das Fluchtmotiv spielt auch in „zahlreichen altbabylonischen Briefen“ eine Rolle. Das dokumentiert ein weiterer besonderer Fall, der von der Flucht einer Sklavin handelt, die einem Soldaten zur Aufbewahrung anvertraut worden war. In einem Brief heißt es nun, dass diese Sklavin „entflohen“ sei, worauf sich der Soldat bei seinem Vorgesetzten meldete. Klengel schildert das weitere Geschehen: „Dem Absender, dem mangelnde Aufsicht vorgeworfen wurde, erlegte man 10 Sekel als Strafe auf. 5 Sekel vermochte er sogleich zu zahlen, doch erschöpfte sich damit offenbar sein Bargeld. Er wandte sich in dem Brief nun an den Adressaten mit der Bitte, ihm die weiteren 5 Sekel zu leihen. Denn er wolle alles zahlen, um nicht in einen Prozeß verwickelt zu werden. In Anbetracht der hohen Strafen, die das Gesetz Hammurapis für das Verbergen von Sklaven oder Beihilfe zur Flucht vorsah, ist die Furcht des Absenders nur zu verständlich – die Sache konnte ihn um Kopf und Kragen bringen.“92 Noch eine Eigentümlichkeit zur Sklavenflucht ist den altorientalischen Quellen zu entnehmen: Mit der Fluchtproblematik sahen sich die Verantwortlichen in den Tempelwirtschaften besonders häufig konfrontiert. Auch hier liefert die Korrespondenz zwischen den Verwaltern und ihren Vorgesetzten indirekte Information über die Häufigkeit der Flucht. Die Administration musste nämlich zuweilen freie Arbeiter anwerben, weil wegen steigender Zahlen von flüchtigen Sklaven ein Arbeitermangel eingetreten war.93 Als Strafen für flüchtige Sklaven werden u. a. Gefängnis, in Ketten-Legen und Stigmatisierung durch Brandmal genannt.94 4. Lösegeld Um durch Loskauf Freiheit zu erlangen, musste der Sklave entweder selbst die von seinem Herrn geforderte Summe aufbringen, was eine Art von peculium oder eine Kreditgewährung seitens Verwandter oder Freunde voraussetzte, oder er wurde direkt von Gönnern freigekauft. Für den Selbst-Freikauf scheint es eine besondere Rechtslage gegeben zu haben, denn Dandamaev hat darauf hingewiesen, dass zumindest in Babylon „self-sales normally mention the right of redemption,“ und weiter heißt es: „children who had been sold into slavery could probably be redeemed with the agreement of the buyer.“95 Es sind auch Fälle bekannt, wo Kaufleute im Ausland Sklaven freikauften und dann in der Heimat dafür von ei91 Klengel 1977, 212. 92 Klengel 1977, 213f. 93 Dandamaev 1984, 651. Zur Häufigkeit der Sklavenflucht siehe auch Neumann 1989, 225 (mit Quellenverweisen). 94 Dandamaev 1984, 659; Driver - Miles 1956-1960, I, 421-425; Bellen 1971, 6. 95 Dandamaev 1984, 179.

Ingomar Weiler

287

nem Tempelpriester oder dem König selbst entschädigt wurden.96 Über Freikaufsummen informieren wiederum Urkunden. H. Klengel hat bei seinen UrkundenStudien festgestellt, dass „ein Sklave [...] meistens zwischen 10 und 30 Sekel Silber [kostete], ein Preis, der auch durch die im Hammurapi-Gesetz zugrundegelegten 20 Sekel bestätigt wird (§116). Das war ein Vielfaches dessen, was normalerweise ein Mietarbeiter pro Monat bekam, und während der alt-babylonischen Zeit zeigte der Sklavenpreis sogar eine etwas ansteigende Tendenz.“97 Es wäre nun gewiss reizvoll, hier weitere Lösegeldsummen anzuführen und diese mit den Freikauf-Konditionen in den homerischen Epen zu vergleichen. Um hier Bewertungen vornehmen zu können, wäre es jedenfalls nötig, ähnlich wie bei den griechischen Angaben, welche Wertäquivalenzen zwischen Menschen und Rindern herstellen, diese auch den Berechnungen im Alten Orient zugrunde zulegen. Wenn beispielsweise in Griechenland der Rinderpreis nach Einführung der Münzgeldwirtschaft mit 50 und 70 Drachmen (Schafe kosten 15-20, Ziegen 10-12 Drachmen) angegeben und gleichzeitig ein ‘Durchschnittssklave’ mit 200 Drachmen (jedenfalls zwischen 300-600 Drachmen) taxiert wird, so lassen sich auf dieser Grundlage auch die Höhe der in den altorientalischen Urkunden genannten Lösegeldsummen und Sklavenpreis mit jenen der griechischen Welt vergleichen.98 Aber um diese Berechnungen ausführen und darlegen zu können, wäre eine eigene Untersuchung erforderlich.

96 Thurnwald 1928, 226. 97 Klengel 1977, 77f. 98 Schumacher 2001, 47.

288

Sklaverei in der homerischen und altorientalischen Welt

Bibliographie Albrecht K. D.: Rechtsprobleme in den Freilassungen der Böoter, Phoker, Dorier, Ost- und Westlokrer. Paderborn 1978 (Rechts- und Staatswissenschaftliche Veröffentlichungen der Görres-Gesellschaft N.F. 26). Bellen H.: Studien zur Sklavenflucht im Römischen Kaiserreich. Wiesbaden 1971 (Forschungen zur antiken Sklaverei 4). Bellen H.: Vom halben zum ganzen Menschen. Der Übergang aus der Sklaverei in die Freiheit im Spiegel des antiken und frühchristlichen Freilassungsbrauchtums. In: H. Bellen - H. Heinen (Hg.): Fünfzig Jahre Forschungen zur antiken Sklaverei an der Mainzer Akademie 1950-2000. Miscellanea zum Jubiläum. Wiesbaden 2001 (Forschungen zur antiken Sklaverei 35) 13-29. Bömer F.: Untersuchungen über die Religion der Sklaven in Griechenland und Rom. Teil II: Die sogenannte sakrale Freilassung in Griechenland und die (dou=loi) i(eroi/. Wiesbaden 1963. Borger R. - H. Lutzmann - W. H. Ph. Römer - E. von Schuler: Rechts- und Wirtschaftsurkunden. Historisch-chronologische Texte. Gütersloh 1982 (O. Kaiser [Hg.]: Texte aus der Umwelt des Alten Testaments 1). Brockmeyer N.: Antike Sklaverei. Darmstadt 1979 (Erträge der Forschung 116). Brunt P. A.: Gnomon 1979 (51) 443-448 (Rez. zu H. Strasburger: Zum antiken Gesellschaftsideal). Burckhardt J.: Weltgeschichtliche Betrachtungen. Erläuterte Ausgabe (Hg. R. Marx). Stuttgart 1963. Burkert W.: Kronia-Feste und ihr altorientalischer Hintergrund. In: S. Döpp (Hg.): Karnevaleske Phänomene in antiken und nachantiken Kulturen und Literaturen. Stätten und Formen der Kommunikation im Altertum I. Trier 1993 (Bochumer Altertumswissenschaftliches Colloquium 13) 11-30. Calderini A.: La manomissione e la condizione dei liberti in Grecia. Mailand 1908 (ND Rom 1965). Cartledge P. : Greek Political Thought. The Historical Context. In: Ch. Rowe - M. Schofield (Hg. in association with S. Harrison - M. Lane): The Cambridge History of Greek and Roman Political Thought. Cambridge 2000, 11-22. Chorover S. L.: Die Zurichtung des Menschen. Von der Verhaltenssteuerung durch die Wissenschaft (engl. 1979). Frankfurt am Main - New York 1982. Dandamaev M. A.: Social Stratification in Babylonia (7th-4th Centuries B.C). In: Acta Antiqua Academiae Scientiarum Hungaricae 22 (1974) 433-444. Dandamaev M. A.: Zur Sklaverei im Neubabylonischen Reich: Gimillu, ein Tempelsklave von Eanna in Monk (6. Jh. v. u. Z.). In: JWG (1977) 3, 153-161. Dandamaev M. A. - I. Bernhardt: Sozialökonomische Texte und Rechtsurkunden aus Nippur zur Kassitenzeit. Berlin 1976. In: VDI (1979) 1, 196-199. Dandamaev M. A.: Slavery in Babylonia. From Nabopolassar to Alexander the Great (626-331 BC). Translated by V. A. Powell, edited by M. A. Powell, D. B. Weisberg, Co-Editor. Northern Illinois University Press 1984. Delekat L.: Katoche, Hierodulie und Adoptionsfreilassung. München 1964 (Münchener Beiträge zur Papyrusforschung 47).

Ingomar Weiler

289

Diakonoff J. M.: Die hethitische Gesellschaft. In: MIO 13,3 (1967) 313-366. Diakonoff J. M.: Socio-economic Classes in Babylonia and the Babylonian Concept of Social Stratification. In: BAW, Philos.-histor. Klasse, Abhandlungen N.F. 75 (1972) 41-52. Diakonoff J. M.: Slaves, Helots and Serfs in Early Antiquity. In: Acta Antiqua Academiae Scientiarum Hungaricae 22 (1974) 45-78. Driver G. R. - J. C. Miles (Hg.): The Babylonian Laws. Oxford 1956-1960. Falkenstein A.: Die neusumerischen Gerichtsurkunden. Erster Teil: Einleitung und systematische Darstellung. München 1956 (BAW, Philos.-histor. Klasse, Abhandlungen, N.F. 39. Veröffentlichungen der Kommission zur Erschließung von Keilschrifttexten. Serie A, 2. Stück, 1. Teil). Falkenstein A.: Die neusumerischen Gerichtsurkunden. Zweiter Teil: Umschrift, Übersetzung und Kommentar. München 1956 (BAW, Philos.-histor. Klasse, Abhandlungen, N.F. 40. Veröffentlichungen der Kommission zur Erschließung von Keilschrifttexten. Serie A, 2. Stück, 2. Teil). Fisher N. R. E.: Hybris, Status and Slavery. In: A. Powell (Hg.): The Greek World. London - New York 1995, 44-84. Garlan Y.: Slavery in Ancient Greece. Ithaca N.Y. - London, revised and expanded edition 1988. Gelb I. J.: From Freedom to Slavery. In: Gesellschaftsklassen im Alten Zweistromland und in den angrenzenden Gebieten. XVIII. Rencontre assyriologique internationale. München 29.6. bis 3.7.1970. München 1972 (BAW, Philos.-histor. Klasse, Abhandlungen N.F. 75) 81-92. Gelb I. J.: Prisoners of War in Early Mesopotamia. In: JNES 32 (1973) 70-98. Gelb I. J.: Household and Family in Early Mesopotamia. In: E. Lipinski (Hg.): State and Temple Economy in the Ancient Near East. Leuven 1979, 1-97. Gelb I. J.: Terms for Slaves in Ancient Mesopotamia. In: M. A. Dandamaev et alii (Hg.): Societies and Languages of the Ancient Near East. Studies in Honour of J. M. Diakonoff. Warminster 1982, 81-98. Gschnitzer F.: Studien zur griechischen Terminologie der Sklaverei. II. Teil: Untersuchungen zur älteren, insbesondere homerischen Sklaventerminologie. Wiesbaden 1976 (Forschungen zur antiken Sklaverei 7). Gschnitzer F.: Sklaverei. In: H. Sonnabend (Hg.): Mensch und Landschaft in der Antike. Lexikon der Historischen Geographie. Stuttgart - Weimar 1999, 478481. Istasse N.: La terminologie relative à l’affranchissement dans les papyrus de l’Égypte romaine. In : Chronique d’Égypte 75 (2000) 331-340. Jacobson V. A.: The Social Structure of the Neo-Assyrian Empire. In: Ancient Mesopotamia. Moskau 1969, 277-295. Kiechle F.: Zur Humanität in der Kriegsführung der griechischen Staaten (1958). In: F. Gschnitzer (Hg.): Zur griechischen Staatskunde. Darmstadt 1969 (Wege der Forschung 96) 528-577. Klengel H.: Zur Sklaverei in Alalah. In: Acta Antiqua Academiae Scientiarum Hungaricae 11 (1963) 1-15. Klengel H.: Hammurapi von Babylon und seine Zeit. Berlin 1977.

290

Sklaverei in der homerischen und altorientalischen Welt

Korosec V.: Einige Beiträge zum hethitischen Sklavenrecht. In: Festschrift Koschaker. Weimar 1939, 127-139. Lencman J. A.: Die Sklaverei im mykenischen und homerischen Griechenland. Wiesbaden 1966. Malul M.: Studies in Mesopotamian Legal Symbolism. In: K. Bergerhof - M. Dietrich - O. Loretz (Hg.): Alter Orient und Altes Testament. Neunkirchen Vluyn 1988 (Alter Orient und Altes Testament. Veröffentlichungen zur Kultur und Geschichte des Alten Orients und des Alten Testaments 221) 40-79. Mendelsohn I.: Legal Aspects of the Slavery in Babylonia, Assyria and Palestine. A Comparative Study (3000-500 B.C.). Diss. Columbia University, Williamsport Pa. 1932. Murdock G. P.: Ethnographic Atlas: A Summary. In: Ethnology 6 (1967) 109-263. Nehlsen H.: Sklavenrecht zwischen Antike und Mittelalter. Germanisches und römisches Recht in den germanischen Rechtsaufzeichnungen. I. Ostgoten, Westgoten, Franken, Langobarden. Göttingen - Frankfurt - Zürich 1972 (Göttinger Studien zur Rechtsgeschichte 7). Neu E.: Knechtschaft und Freiheit. Betrachtungen über ein hurritisch-hethitisches Textensemble aus Hattuša. In: B. Janowski - K. Koch - G. Wilhelm (Hg.): Religionsgeschichtliche Beziehungen zwischen Kleinasien, Nordsyrien und dem Alten Testament. Göttingen 1993 (Orbis Biblicus et Orientalis 129) 329-361. Neumann H.: Bemerkungen zur Freilassung von Sklaven im alten Mesopotamien gegen Ende des 3. Jahrtausends v. u. Z.: In: Altorientalische Forschungen 16 (1989) 220-233. Neumann H.: Sklaverei (Alter Orient). In: DNP 11 (2001) 621-622. Otto E.: Kirenzi und derôr in der hurritisch-hethitischen Serie ‘Freilassung’ (par tarnumar). In: G. Wilhelm (Hg.): Akten des IV. Internationalen Kongresses für Hethitologie. Würzburg, 4.–8. Oktober 1999. Wiesbaden 2001 (Studien zu den Bo azköy-Texten 45) 524-531. Patterson O.: Slavery and Social Death. A Comparative Study. Cambridge Mass. London 1982. Raaflaub K.: Die Entdeckung der Freiheit. Zur historischen Semantik und Gesellschaftsgeschichte eines politischen Grundbegriffs der Griechen. München 1985 (Vestigia 37). Rabinowitz J.: Manumission of Slaves in Roman Law and Oriental Law. In: JNES 19 (1960) 42-45. Schumacher L.: Sklaverei in der Antike. Alltag und Schicksal der Unfreien. München 2001 (Beck’s Archäologische Bibliothek). Snell D. C.: Flight and Freedom in the Ancient Near East. Leiden 2000. Strasburger H.: Zum antiken Gesellschaftsideal. Heidelberg 1976 (Abhandlungen der Heidelberger Akademie der Wissenschaften, Philos.-histor. Klasse 4). Thurnwald R.: Sklave. In: M. Ebert (Hg.): Reallexikon der Vorgeschichte. Berlin 1928, Band 12, 209-228. Thür G.: Paramone. In: DKP 9 (2000) 319f. Timpe D.: Alte Geschichte und die Fragestellung der Soziologie. In: HZ 213 (1971) 1-12.

Ingomar Weiler

291

Ulf Ch.: Die homerische Gesellschaft. Materialien zur analytischen Beschreibung und historischen Lokalisierung. München 1990 (Vestigia 43). Ulf Ch.: Herkunft und Charakter der grundlegenden Prämissen für die Debatte über die historische Auswertung der homerischen Epen. In: Klio 84,2 (2002) 319-354. Waldstein W.: Operae libertorum. Untersuchungen zur Dienstpflicht freigelassener Sklaven. Wiesbaden - Stuttgart 1986 (Forschungen zur antiken Sklaverei 19). Wickert-Micknat G.: Unfreiheit im Zeitalter der homerischen Epen (zwei Teile in einem Band). Wiesbaden 1983 (Forschungen zur antiken Sklaverei 16).

VII. HELLAS UND ACHÄMENIDEN, PARTHER, SASANIDEN UND ROM/ GREECE AND ACHAEMENIDS, PARTHIANS, SASANIANS AND ROME

„PERSIEN, DER FASZINIERENDE FEIND DER GRIECHEN“: GÜTERAUSTAUSCH UND KULTURTRANSFER IN ACHAIMENDISCHER ZEIT1 Josef Wiesehöfer I. Unter all den Kulturen, mit denen die griechische(n) im Laufe der Antike in Kontakt trat(en), spielen die iranischen bis heute eine besondere, weil oft mißverstandene, Rolle. Bis heute erscheint es einer breiteren gebildeten Öffentlichkeit nämlich so, als ob die Beziehungen zwischen Griechen und Iranern vornehmlich kriegerischer, unfriedlicher Natur gewesen seien. Geschichtsmächtige Schlagworte wie „Marathon“, „Salamis“, „Issos“, „Barbaren“ oder „orientalische Despotie“ haben in Europa jahrhundertelang die Vorstellung genährt, in der Antike hätten Griechen und Iraner, so sie denn in Nachbarschaft zueinander lebten, kaum zu wirklicher Verständigung und zu friedlichem Austausch finden können. Dem europäischen Betrachter des 19. und beginnenden 20. Jahrhunderts, gleich welcher Herkunft, war es dabei in der Regel ganz selbstverständlich, die griechische Zivilisation als autochthon und vorbildlich anzusehen, die iranische als fremdartig und gegensätzlich, die griechische Kultur als schöpferisch und befruchtend, die orientalischen Kulturen als in erster Linie rezeptiv; es verwundert deshalb nicht, daß Iran (wie die anderen Kulturen des antiken Nahen Ostens) im europäischen Geschichtsbild kaum über den Status einer ‚Randkultur‘ hinauskam, und, nach antikem Vorbild, eher als ‚Außen’-‚ oder gar ‚Gegenwelt‘ wahrgenommen und bewertet wurde. Diese Antinomie wurde letztlich auch nicht dadurch aufgehoben, daß man die Verwandtschaft zwischen den iranischen (arischen) und den germanischen Sprachen erkannt hatte und es bald darauf auch zur Annahme eines kulturell besonders hochstehenden indogermanischen Urvolks und einer vor allem auch charakterlich-wesensbestimmten Nähe der indogermanischen Völker zueinander gekommen war. Die daraus resultierende insgesamt positivere Bewertung der Perser des Altertums hob diese nun zwar aus der Gemeinschaft der übrigen Völker des Orients heraus, änderte aber nichts an der weiterhin deutlichen Stellungnahme für den griechischen (d.h. zumeist athenischen) Weg der Entwicklung von Kunst, Kultur und ‚Staat’, der fast immer als vertraut empfunden und als geradlinig in die eigene Zeit führend verstanden wurde. Unterbrochen, in Teilen aber auch verstärkt, wurde diese Traditionskette in Deutschland für zwölf Jahre durch die national-sozialistische Überzeugung, die tieferen Ursachen für den Niedergang Irans eruieren zu können. Man fand sie vornehmlich in den rassischbiologistisch bestimmten negativen Einflüssen des ,semitischen’ Orients auf die ,arischen’ Perser, wobei die Abwertung des ,Semitischen’ kein ausschließlich deutsches Phänomen war. Nach dem Kriege wurde – übrigens ebenfalls nicht nur in Deutschland – für einige Jahrzehnte wieder die These vom unüberbrückbaren Gegensatz zwischen persischem Despotismus und griechischer Freiheitsliebe be1

Der Verf. möchte seinen Freunden Peter Bedford (Perth) und Robert Rollinger (Innsbruck) für vielfältige Anregung und Kritik danken.

296

Josef Wiesehöfer

müht. Erst in den letzten beiden Jahrzehnten schien sich in den Altertumswissenschaften – eingebettet in umfassendere Diskurse und begünstigt durch inter- und transdisziplinäre Formen gelehrter Zusammenarbeit – ein grundlegender Wechsel in der Beschäftigung mit den nahöstlichen Kulturen anzubahnen; allerdings sind gerade in letzter Zeit – ausgelöst durch den Streit um die Relevanz altertumskundlicher Bildungsinhalte und durch die Suche nach gesamteuropäischer bzw. okzidentaler Identität – erneut Tendenzen der Engführung und eurozentrische Konstruktionen kultureller Kontinuitäten zu erkennen, die das wirkliche und gerade heute höchst aktuelle Vermächtnis griechischer Kultur – die politische Theorie und Praxis - zuweilen in den Hintergrund treten lassen. Im Bereich der materiellen Kultur ist in diesem Zusammenhang an – noch immer nicht verschwundene - Tendenzen in den Grenzgebieten der Klassischen und Vorderasiatischen Archäologie zu erinnern, den griechischen Anteil an Kulturkontakten besonders zu betonen: Das mag dann etwa dazu führen, nur griechischen Schöpfern oder Kunden von Kunstprodukten ‚guten Geschmack‘ zuzutrauen und Iranern rechtes Interesse an und Verständnis für griechische Kultur abzusprechen. Der Orient wird so „als Schuldner Griechenlands entlarvt und (ist) nur dadurch von Relevanz, da(ß) er‚unserer hellenistisch-europäischen Entwicklung‘ teilhaftig geworden ist“ (Hauser). Andererseits: Bei dem Bemühen, der ‚Orientalismus’- bzw. ‚Eurozentrismusfalle’ zu entgehen und den iranischen Anteilen an Kulturkontakten und kulturellen Neuschöpfungsprozessen die ihnen gebührende Beachtung zukommen zu lassen, besteht die Gefahr, nun seinerseits den griechischen Anteil an diesen Begegnungen, die Attraktivität seines Angebots für iranische wie indigene Eliten zu unterschätzen. Nur durch sorgfältige Analyse, die Quellen- und Kunstgattungsspezifika ebenso beachtet wie unterschiedliche soziale und kulturelle Milieus und Adressaten, kann es etwa gelingen, iranisch-imperialen Einfluß und regionale Traditionen in achaimenidischer Zeit in ein rechtes Verhältnis zueinander zu setzen. Ebenso sollte man es begrüßen, daß Hellenismusforscher mit einem Standbein im Osten nun ihrerseits zur Überprüfung der Tragfähigkeit eigener weltanschaulicher (postkolonialer) Prämissen angehalten werden. 2 Daß historische Mythen als sinnstiftende Bestandteile eines kollektiven Gedächtnisses nicht nur ein Phänomen europäisch-westlicher Gesellschaften sind, sondern sich auch in Asien auf Identitätssicherung angelegte Geschichtsdarstellungen solcher Mythen bedienen, ist schon häufig betont worden. In Iran wurde dabei der – letztlich vergebliche - Versuch gemacht, einen Mythos (den des 2500jährigen Bestehens eines iranischen Kaiserreiches) autoritär durchzusetzen.3 ‚Nationaliranische’ Interpretationen griechisch-persischer oder arabisch-persischer Beziehungen, die – wie ihre westlichen (etwa griechischen) Pendants – ethnische, kulturelle und ‚nationale’ Identitäten in eins setzen, erfreuen sich dagegen bis heute in Iran und in exiliranischen Kreisen großer Beliebtheit. Die vorangegangenen Bemerkungen verweisen, was unser Thema angeht, auf weitere Schwächen vergangener (und wieder aktueller?) Geschichtsbetrachtung: 2 3

Vgl. zusammenfassend Wiesehöfer 2003. Eine zusammenfassende Darstellung iranischhellenischer Kulturkontakte in der Antike durch den Autor ist in Vorbereitung. Wiesehöfer 1999.

Persien, der faszinierende Feind

297

1. Der Bezug auf Begriffe wie ‚Iran’ oder ‚Griechenland’, ‚iranische’ oder ‚griechische Kultur’ verdeckt oft genug die Vielfalt der politischen und kulturellen Ausdrucksformen, die sich in der Antike in Ost wie West beobachten lassen: So gab es im antiken Hellas zwar einerseits einen Schatz allgemein anerkannter und identitätsstiftender kultureller und politischer Gemeinsamkeiten, andererseits aber auch eine Fülle höchst eigentümlicher und räumlich wie zeitlich spezifischer (nicht zuletzt auch von außen übernommener und gegebenenfalls transformierter) Traditionen und Erfahrungen, war die Geschichte Griechenlands zudem in nicht unerheblichem Maße durch den Gegensatz von Partikularismus und Hegemoniestreben bestimmt. Und auch das antike Iran, das weit mehr als die Territorien des heutigen Nationalstaats umfaßte, war nie eine kulturell homogene Größe. Zu bedenken ist ferner, daß sich selbst in den großen militärischen Konfrontationen der Perserkriege und des Alexanderzuges ja nicht nur Griechen und Iraner gegenüberstanden, sondern zugleich auch Griechen und Griechen, Makedonen und Griechen, Griechen und Angehörige der unterschiedlichsten großköniglichen Untertanenvölker. Muß man zudem nicht, was die Richtung, die Bedeutung und die Art und Weise des Kulturtransfers angeht, für unterschiedliche Bevölkerungs‘klassen’ und unterschiedliche Kulturelemente zu unterschiedlichen Ergebnissen kommen? Und was ist von antiken transkulturellen Prozessen und ‚synkretistischen’ Strömungen (als Beispiel sei hier nur die achaimenidische Reichskunst angeführt) zu halten, bei denen etwas noch nie Dagewesenes entstand? 2. Der Umstand, daß die iranischen Großreiche der Antike polyethnische und multikulturelle Gebilde waren, ist nie ernstlich bestritten worden (auch wenn man, wie betont, die Konsequenzen dieses Faktums oft zu wenig berücksichtigte). Man kann sich allerdings des Eindrucks nicht erwehren, als ob heutige Betrachter (nach je eigener Einstellung zu ähnlichen Phänomenen unserer Zeit) die ethnische Vielfalt und das Nebeneinander heterogener sozialer und kultureller Muster in einer Gesellschaft zumeist entweder als Geburtsfehler und als Bürde oder als ausgesprochenen Vorzug dieser Imperien anzusehen geneigt sind. Der Historiker sollte sich allerdings darauf beschränken, die oft komplizierten Mechanismen antiker Identitätskonstitution in einer multikulturellen Gesellschaft zu beschreiben und dabei zwischen kollektiver Identität (etwa einer ethnischen oder religiösen Gruppe) und individueller Identität (innerhalb einer solchen Gruppe) unterscheiden. Nur beiläufig sei erwähnt, daß während der Zeit des Nationalsozialismus in Deutschland die Aufgabe des „völkischen Prinzips“ bzw. der Verzicht auf das – der Antike gänzlich unbekannte – „Nationalstaatsprinzip“ neben der „Rassenmischung“ als Wurzel allen Übels, d.h. von Dekadenz- und Niedergangserscheinungen, angesehen wurde (der Vergleich antiker Imperien mit modernen Nationalstaaten hielt sich im übrigen bedeutend länger). 3. Daß wir die griechische Sicht der „barbarischen“ Nachbarn griechischen Autoren verdanken, ist verständlich, daß die Beziehungen zwischen Persern und Griechen in der Zeit vom 6. bis zum 4. Jh. v.Chr., ob kriegerischer oder friedlicher Art, fast nur in der griechisch-literarischen Überlieferung thematisiert werden, ist aufschlußreich, daß sich aber auch nahezu alle persischen Griechenbilder griechischen Versionen persischen Nachdenkens über Griechen verdanken, ist

298

Josef Wiesehöfer

‚bedenklich’; die griechisch-persischen Beziehungen zur Achaimenidenzeit erschließen sich deshalb nur durch a) eine genaue Analyse der griechischen Zeugnisse aus ideen- und mentalitätsgeschichtlicher Perspektive und im syn- wie diachronen Vergleich, b) die Berücksichtigung auch nichtliterarischen und auf dem bzw. im Boden des Perserreiches gefundenen Materials (vor allem epigraphischer und archäologischer Zeugnisse), c) die Aufdeckung von – z.T. geschichtsmächtigen – literarischen Topoi und historischen Mythen. II. Lassen Sie uns nun den Zusammenhang von Politik, Handel und Kulturaustausch innerhalb der griechisch-persischen Beziehungen näher betrachten, unser eigentliches Thema. Zur Erinnerung: Das Achaimenidenreich war das bei weitem größte der nahöstlichen Großreiche und umfaßte auf seinem Höhepunkt alle Territorien von den Grenzen Makedoniens bis zum Indus, vom Syr-Darya im heutigen Usbekistan bis nach Elephantine in Südägypten. Durch Inkorporierung aller iranischen Territorien, des neubabylonischen, des lydischen und des Saitenreiches war es nicht nur zum Herrn über Myriaden von Ethnien und Sprachgruppen, unterschiedlich politisch verfaßten und kulturell spezifischen Gemeinschaften geworden, sondern hatte es auch mit einer Vielzahl unterschiedlicher ökonomischer Entwicklungsstufen und unterschiedlicher Wirtschaftsformen zu tun. Was die allgemeinen demographischökonomischen Parameter des Reiches angeht, so sind diese quellenmäßig am ehesten für die drei alten – untereinander deutlich geschiedenen – Kulturlandschaften Südmesopotamien (Babylonien), Nordmesopotamien (Assyrien und die Gebiete westlich des Euphrats) und Syrien-Palästina zu erschließen, während etwa für das stärker durch Oralität geprägte Iran vielfach entsprechende Zeugnisse fehlen. Wirtschaftshistorische Untersuchungen der letzten Jahrzehnte4 legen nahe, daß die Perserzeit durch Bevölkerungswachstum und die Steigerung der landwirtschaftlichen Produktion sowie durch Verbesserungen im institutionellen Sektor gekennzeichnet gewesen ist. Allerdings erlaubt uns die Überlieferung zumeist zwar, diese Entwicklungen festzustellen, läßt uns jedoch bei der Quantifizierung dieser Veränderungen im Stich. Für den Handel gilt das gleiche: Man geht von einer deutlichen Steigerung des Volumens aus, doch bleibt – aus Überlieferungsgründen – vieles unklar. Daß etwa Hinweise auf Fernhandel und Fernhändler in den Zeugnissen jener Zeit ausgesprochen dürftig sind, ist sicher auch eine Folge von Überlieferungsausfall und –zufall, in erster Linie jedoch dadurch bedingt, daß sich die Schriftzeugnisse, so sie denn auf überregionale Verbindungen Bezug nehmen, auf den politisch-militärischen Bereich, etwa auf die Nutzung von Straßen und Wasserwegen durch Truppen, Boten oder diplomatische Gesandtschaften, konzentrieren. Die elamischen Tontäfelchen aus Persepolis wiederum oder die Archive der sog. Bankhäuser der Egibis und Murashus aus Mesopotamien kennzeichnet ihr deutlich regionaler Bezugsrahmen. Archäologische Fundstücke schließlich, eine weitere wichtige Überlieferungsgattung, bedürfen vielfach der 4

Vgl. dazu zusammenfassend demnächst Bedford (im Druck).

Persien, der faszinierende Feind

299

Bestätigung durch Schriftzeugnisse, um sie als eigentliche Handelsgüter und nicht etwa als diplomatische Geschenke, Kriegsbeute, ‚Mitbringsel’ bzw. Streufunde klassifizieren zu können. Welche Indizien hat man nun für die steigende Bedeutung des Fernhandels und des überregionalen Warenaustausches in achaimenidischer Zeit angeführt? Zum einen das Argument, politische Integration dieses Ausmaßes fördere den Warenaustausch. Nun ist sicher richtig, daß dadurch in der Regel Vereinbarungen besser um- und durchgesetzt und daß Geschäftskosten gesenkt werden können, daß sich nicht zuletzt auch für die regional spezialisierte Landwirtschaft und das regional spezialisierte Gewerbe durch den Wegfall politischer Grenzen bei gleichzeitigem Ausbau der Infrastruktur, wie wir ihn etwa für das achaimeniden-zeitliche Straßenwesen beobachten können, größere Absatzchancen ergeben. Allerdings besitzen wir zur Verifizierung dieser Thesen nur ausgesprochen wenig Quellenmaterial. Mit dem Faktor politische Integration und den zu ihrer Sicherung angewandten Zwangs- und Kontrollmaßnahmen ist auch das Argument verbunden, die lange Periode kaum ernsthaft gefährdeter pax Achaemenidica habe den regionalen wie überregionalen Warenaustausch begünstigt. Drittens sollen auch die bislang nicht gekannte Raffinesse und Exklusivität großköniglichen und aristokratischen Lebensstils während der Perserzeit den Fernhandel, der – abgesehen von strategischen Gütern - auch in der Perserzeit vorrangig ein Handel mit Luxusgütern war, begünstigt haben. Viertens schließlich ist an die nicht abgeschlossene Diskussion zu erinnern, ob die Einführung des Münzgeldes ein Faktor für die Steigerung des Warenaustausches im Perserreich gewesen ist. Wenn Händlerkorrespondenz und Handelsarchive überregionaler Provenienz, wenn statistisch auswertbares Material weitgehend fehlen, ist – zur Überprüfung dieser Thesen – dann allerdings der genaue Blick auf die Einzelurkunde, auf den beiläufigen Hinweis in der griechischen Literatur, auf den lokalen Grabungsbefund gefragt. Hier stehen wir erst am Anfang unserer Untersuchungen. Zuletzt seien noch einige Bemerkungen zu den Formen des Warenaustausches, der uns hier ja vor allem als Medium des Kulturaustausches beschäftigen soll, gestattet. Zunächst: Zwar verliert am Übergang von der Bronze- zur Eisenzeit der Palast als bestimmender Wirtschaftsfaktor an Bedeutung5, doch dürften im Fernhandel Vorderasiens nach wie vor Agenten, die für die Krone und ihre Funktionäre und Würdenträger bzw. große Organisationen, wie etwa die babylonischen Tempel, tätig wurden, eine nicht unwesentliche Rolle gespielt haben. Der Palast war im übrigen nicht nur wichtig als Endabnehmer von Waren und Rohstoffen, die etwa von den phoinikischen Händlern im Austausch erworben worden waren, letztlich dann aber – z.T. in verarbeiteter Form – nicht zuletzt in Form von Tributen in die großköniglichen Schatzkammern flossen. Er spielte auch eine große Rolle bei der Organisation des Umtausches der Naturalabgaben oder Naturalrationen in solche in Edelmetall- oder gar Münzform, der lokale Märkte voraussetzt. Weiterhin ist festzuhalten, daß unter den Austausch-, Verteilungs- und sozialen Integrationsmechanismen der persischen Zeit weniger solche geregelten Markt5

S. Sherratt / A. Sherratt, The Growth of the Mediterranean Economy in the Early First Millennium BC, in: World Archaeology 24 (1993) 361-378.

300

Josef Wiesehöfer

austausches, als vielmehr solche reziproker und redistributiver Art die entscheidende Rolle spielten; letztere sind quellenmäßig natürlich vor allem für die achaimenidische Herrscherrepräsentation, die persische Administration und die Bewirtschaftung der großen Güter in Babylonien nachgewiesen. Da uns hier jedoch nicht nur der an den Handel, sondern der an wirtschaftliche Transaktionen insgesamt angebundene Kulturaustausch beschäftigen soll, ist auch an die – z.T. schon angesprochenen – anderen Formen überregionalen Güteraustausches zu erinnern, die gewaltsame oder tributäre Aneignung von Ressourcen unterworfener Länder durch die Großkönige etwa, die herrscherliche Sorge um das eigene Wohlergehen und das der Untertanen, die sich im Import von Luxusgütern, aber etwa auch in der reichsweiten Verbreitung von Früchten oder Tieren manifestieren konnte, oder den bereits erwähnten diplomatischen Güteraustausch. Die Bemühungen des Großkönigs und der Eliten des Reiches um den Import und die reichsinterne wie grenzüberschreitende Vermittlung und Nutzung von Waren und Kulturgütern stießen dabei zu allen Zeiten, selbst denen politisch-militärischer Auseinandersetzungen, auf Interesse auch außerhalb des Reiches. Im folgenden soll an drei Beispielen der Zusammenhang von Güter- und Kulturaustausch in den griechisch-persischen Beziehungen aufgezeigt werden: am Handel zwischen Ägypten, Ionien und Phoinikien nach den Perserkriegen, wie ihn die berühmte Zollurkunde aus dem Nildelta dokumentiert, an der ‚Perserie’ athenischer Aristokraten in den 30er und 20er Jahren desselben Jahrhunderts, und an der griechischen Bewunderung und z.T. auch Nachahmung persischer Gartenkultur. III. 1993 veröffentlichten B. Porten und A. Yardeni einen aramäischen Text aus Elephantine, der – als Palimpsest des berühmten Ahiqar-Papyrus – Auszüge aus den Aufzeichnungen eines achaimenidischen Zollpostens wohl an der Mündung des kanopischen Nilarms (Thonis?) bietet.6 Behandelt sind dort u.a. die Kontrolle, Registrierung und Besteuerung von 36 sog. „ionischen“ (vielleicht phaselischen) und von 6 phoinikischen (vielleicht sidonischen) Schiffen, die Waren nach Ägypten transportiert hatten und dasselbe mit ägyptischer Fracht wieder verließen. Uns sollen hier die Institution und das Procedere der Warenverzollung, die sich im übrigen an denen der Saitenzeit orientierten und noch auf der Nektanebosstele aus dem 4. Jh. nachzuweisen sind, ebensowenig interessieren wie die technischen Details der Schiffe oder die im Text nicht erwähnte Art und Weise des Verkaufs der Waren in Ägypten (in Naukratis ? in Memphis ?). Wichtiger sind für unseren Zusammenhang andere Informationen: zum ersten die Angabe der – übrigens regelmäßig eingeführten7 – Waren (Wein, Hölzer, Metalle, Wolle, Ton, Oliven- und 6 7

Porten und Yardeni 1993, C.3.7. – Einen ausführlichen Kommentar zu diesem Zeugnis legten Briant und Descat 1998 vor. An ihm orientiert sich die folgende Darstellung. Das beweisen die wenigen Aufzeichnungen, die aus dem 10. Jahr vorliegen (Briant und Descat 1998, 73).

Persien, der faszinierende Feind

301

Parfümöl als Importgüter, Natron als Exportgut), die die Ladungen der Schiffe als gehobene Gebrauchs- und z.T. wohl auch strategische Güter kennzeichnet; inwieweit der Handel im achaimenidischen Ägypten nicht nur durch die Schiffsregistrierungen und die Zollerhebung staatlich kontrolliert war, sondern auch bestimmte Waren von den staatlichen Autoritäten nachgefragt wurden, läßt sich mit unseren Zolldokumenten nicht entscheiden. Interessant sind zum zweiten die Namen der Schiffsführer der „ionischen“ Schiffe, unter denen griechische Namen ebenso erscheinen wie ein iranischer. Drittens trägt die Zollzahlung in Gold und Silber durch die Ioner vielleicht dazu bei, einen Teil der griechischen Münzhortfunde im achaimenidischen Ägypten zu erklären. Viertens schließlich ist in unserem Zusammenhang von Bedeutung das Datum der Urkunden (11. Jahr eines Achaimenidenherrschers), als das entweder das Jahr 475 v.Chr. (11. Jahr des Xerxes) oder das Jahr 454 (11. Jahr Artaxerxes’ I.) vorgeschlagen wird. Das Datum 475 allerdings, wie geschehen8, durch die These zu rechtfertigen, daß es zwischen ca. 475 und 450 im Rahmen der Auseinandersetzungen zwischen dem attisch-delischen Seebund und dem Achaimenidenreich zu einem Zusammenbruch der Handelskontakte zwischen der griechischen Ägäiswelt und dem persisch dominierten Orient gekommen sei, verbietet sich9: Die neuen Grabungsbefunde aus Gordion in Phrygien und Daskyleion im hellespontischen Phrygien mit ihrem Nachweis unverminderten Imports feiner attischer Keramik nach 480 v.Chr.10 sprechen ebenso dagegen wie neuere historische Untersuchungen, die die Grenze zwischen den Territorien der Seebundstaaten und des Perserreiches in Westanatolien eben gerade nicht als eine Art ‚eisernen Vorhang’, sondern als eine Zone intensiven Kulturkontaktes und diplomatischer Netzwerke zum Zwecke der Aufrechterhaltung des lokalen Friedens zu erweisen in der Lage waren.11 Die Keramikfunde aus Phrygien haben im übrigen darüber hinaus verdeutlichen können, daß der Überlandhandel – zumindest für strategische und Luxusgüter - bedeutend wichtiger gewesen sein muß, als man bisweilen angenommen hat.12 Auch wenn die berühmten Fernstraßen des Perserreiches vor allem für militärische Zwecke sowie die Nachrichtenübermittlung genutzt wurden, so ist ihre Funktion bei der zivilen Verlegung von Menschen, Tieren und Waren doch nicht zu unterschätzen. Ein interessantes Beispiel für die Nutzung eines regelrechten Land- und Wasserwegeverbundes ist der von Dareios I. in seiner ‚Burgbauinschrift’ aus Susa (DSf 30-5) geschilderte Transport von Zedernholz vom Libanongebirge nach Susa zum Zwecke des Palastbaus ebendort: Man nutzt dafür zunächst den Landweg bis nach Thapsakos, transportiert die Stämme dann auf dem Wasserwege euphratabwärts nach Babylon und bis zum Persischen Golf, um sie dann Karun und Eulaios aufwärts nach Susa zu befördern.

8 Bresson 2000, 67-73. 9 Briant 2001, 132 n. 275. 10 Gordion: Zusammenfassend behandelt in: Briant 1997, 23-4, 85; Daskyleion: Tuna-Nörling 1998 [1999]. 11 Balcer 1985; Miller 1997, 89-108; Whitby 1998. 12 De Vries 1997, 453-4; Henrickson, in: Voigt et al. 1997.

302

Josef Wiesehöfer

IV. Daß politischer Antagonismus und Abbruch kultureller Beziehungen nicht zwei Seiten ein und derselben Medaille sein müssen, daß die Perser für die politische Identität einer Gemeinschaft geradezu „archetypische Gegner“, für die kulturelle jedoch „in mancher Hinsicht (sogar) Vorbilder“13 sein konnten, verdeutlicht nicht nur das Beispiel des westlichen Kleinasiens der ersten Hälfte des 5. Jh., sondern auch das des Athen der dritten Generation „nach Marathon“14. In dieser Zeit, in der der Orient kulturell manchem jungen vermögenden Athener nicht länger als Gegen-, sondern als ideale und faszinierende glückliche Außenwelt erschien, änderten sich nicht nur gesellschaftliche Ideale und Verhaltensmuster, trafen nicht nur im Mythos aktive Vertreter griechischer Kultur wie Orpheus auf orientalische „’Partner’ mit offenen Ohren“15; der Wandel von Lebensführung und Weltbild war vielmehr verbunden mit dem Import von östlichen Produkten oder der lokalen Nachahmung orientalischer Luxusgüter.16 Manche dieser Güter wechselten zweifelsohne als diplomatische Geschenke den Besitzer, waren ‚Mitbringsel’ von Gesandten, Kunsthandwerkern und ehemaligen Söldnern des Großkönigs, Beutestücke oder Besitz der in Athen lebenden Orientalen; die ‚Perserie’ athenischer Aristokraten, das hat die vorzügliche Arbeit von Margaret C. Miller nachgewiesen, setzt allerdings auch Handel mit und den Import von Luxusgütern voraus. Neben Münzen aus dem Achaimenidenreich, vor allem Dareiken und kyzikenischen Stateren, wurden auch wertvolles Glas, bunte und bestickte Textilien, chinesische Seidenund indische Baumwollstoffe (einschließlich ihrer Bildmotive) sowie Schmuck aus achaimenidischen Territorien nach Attika importiert; auch die athenische Bekleidungsmode nahm Anregungen aus dem Perserreich auf, indem sie etwa den Kandys oder den Ependytes in das Trachtrepertoire einführte. Als Kriegsbeute, aber auch durch Handel und Austausch, gelangten auch Sklaven aus achaimenidischen Territorien nach Griechenland, vor allem Lyder, Phryger und Syrer; literarische Zeugnisse, Inschriften, aber etwa auch Grabstelen bezeugen diesen ‚menschlichen Faktor’ im Austausch zwischen Orient und Hellas, einen Faktor, der die Athener in nicht unerheblichem Maße auch mit Sitten und Gebräuchen der Länder des Ostens vertraut gemacht haben dürfte.17 Zwei Importe geben – das hat Margaret Miller besonders anschaulich zeigen können – einen Einblick in die Formen und Metamorphosen orientalischgriechischen Kulturaustausches in achaimenidischer Zeit: der Sonnenschirm (gr. skiadion) und der Pfau (gr. taôs; auch: medikos ornis).18 Wie in den Reichen des Alten Orients so war auch in Griechenland, in das er im Gefolge der Perserkriege Einzug hielt, der Sonnenschirm Standessymbol und Würdezeichen; während er im Osten jedoch vor allem den männlichen Herrscher und wohl auch kleinasiatische 13 14 15 16 17 18

Hölscher 2000, 313. Ib., 308. Ib., 310. Dazu grundlegend: Miller 1997, 135-258. Bäbler 1998. Sonnenschirm: Miller 1997, 193-8; Pfau: Miller 1989; 1997, 189-92.

Persien, der faszinierende Feind

303

Aristokraten auszeichnete – über die ‚Beschirmung’ edler Frauen ebendort wissen wir nichts –, wurde der von einer Sklavin getragene Schirm in Athen zum Erkennungs- und Unterscheidungsmerkmal vermögender athenischer Bürgerinnen – männliche ‚Beschirmung’ galt dagegen als Zeichen der Verweichlichung –; als weibliches Standessymbol schied er dann etwa auch beim Panathenäenfest die bürgerlichen Kanephoren, denen er zustand, von den metoikischen Bediensteten, die ihn für die Bürgerinnen trugen. Die ersten in Athen nachgewiesenen Pfauen waren vermutlich ein persisches diplomatisches Geschenk an Pyrilampes, den Sohn des Antiphon, einen aristokratischen Freund des Perikles und Verwandten Platons, der sich als athenischer Diplomat oft im Orient aufgehalten hatte.19 Pyrilampes und sein Sohn Demos nutzten die Tiere zum Aufbau einer in ganz Hellas berühmten – überaus wertvollen - Pfauenzucht, die sie gegen Eintrittsgeld der Öffentlichkeit zugänglich machten, und die von J.K. Davies als „sophisticated transfiguration“ der antiken Rennpferdezucht charakterisiert wurde20; war die Pferdezucht zumindest potentiell auch von militärischem Nutzen, so waren die wertvollen Vögel zu nichts anderem nütze als zu ihrer Zurschaustellung. Diese besondere Form der ornithotrophia, die in Athen – das zeigen der Begriff „medischer Vogel“ und die Kritik des Aristoteles (hist. an. 1,1,488b 23-4) an seiner Eitelkeit – mit persischer tryphe assoziiert wurde, bedurfte nicht nur spezifischer baulicher Voraussetzungen, sondern auch des Einsatzes geschulten Personals, das gleichfalls aus dem Orient, wahrscheinlich aus Babylonien oder Indien, ‚importiert’ wurde. V. Der aus Indien über Babylonien und Iran nach Hellas gelangende Pfau schlägt die Brücke zum dritten Teil unserer Beobachtungen: der griechischen Bewunderung und z.T. auch Nachahmung persischer ‚Gartenkultur’.21 Ausgangspunkt unserer Überlegungen ist ein Reliefgefäß des Töpfers Xenophantos aus dem frühen 4. Jh. – jetzt in der Eremitage –22, auf dem er „eine fabulöse Jagd auf Wildschweine, Hirsch und Löwengreifen, wie man sie sich in den persischen Wildgehegen vorstellen mochte“23, schildert. Mit ihm sind wir zugleich in die Zeit zurückgekehrt, in der der Orient als ideale glückliche Welt erscheint. Jäger sind Kyros und Dareios, Bruder und Sohn des regierenden Großkönigs, sowie Abrokomas, der Satrap von Syrien. Warum erschien einem griechischen Künstler bzw. seinem Auftraggeber damals die Jagd im paradeisos als Innbegriff der Glückseligkeit? Besucht man heute die großköniglich-achaimenidischen Residenzen in Südwestiran, dann kann 19 Zu Pyrilampes und seiner Bezeugung in den Quellen vgl. Davies 1971, Nr. 8792 VIII-XI, besonders pp. 329-30. 20 Ib., 335. 21 Vgl. dazu bald auch Wiesehöfer (in Vorbereitung). 22 Miller 2003, 44, sieht die Bilderwelt des Gefäßes “as part of a wider pattern of mythicisation (rather than demonisation) of Persians in Attic art in the later fifth century”. 23 Hölscher 2000, 307.

304

Josef Wiesehöfer

man, trotz der immer noch imposanten Ruinen, die Pracht und den Zauber ihrer Paläste und Parks, die etwa Xenophon im Oikonomikos (4,13) den Sokrates beschreiben läßt, höchstens erahnen. So lag damals etwa Pasargadai, Residenz Kyros’ d.Gr. und Platz der Königsinvestitur, – ganz anders als heute – in einer faszinierenden Gartenlandschaft, die, von Bewässerungskanälen durchzogen und gespeist, schattenspendende Bäume, exotische Pflanzen und Früchte ebenso aufwies wie Brunnen, Springbrunnen und Wasserbassins.24 Heute weiß man, daß unter den Achaimeniden versucht wurde, die die Paläste umgebende Landschaft „durch optisch-ästhetische Bezüge in die Architektur einzubinden; die Landschaft und in ihr der kunstvoll gestaltete Garten wurden (so) zur Staffellage, der Bau zur Bühne“25. Und so verwundert nicht, daß der Großkönig sich in Wort und Bild in der Figur des ‚guten Gärtners’ wiederzufinden sucht, der sein Reich wie einen Garten pflegt, alles in ihm zum Wachsen und Blühen bringt und Krieg und Teuerung von ihm abwendet.26 Daß der königliche Gärtner (wie der königliche Reichsadministrator und Reichsfeldherr) dabei auch regelmäßige Kontrollen anordnet oder durchführt, sei nicht verschwiegen (vgl. Xen. oik. 4,8). Lokalautonomie und strenge Aufsicht durch die Zentrale sind schließlich ja auch die beiden Kennzeichen achaimenidischer Herrschaftspraxis; ihr Zusammenspiel war die Grundlage der Stärke des Perserreiches bis zu seinem Ende. Und wie der Großkönig gleichsam den Reichsgarten versorgt, so der Satrap, der Provinzstatthalter, – in seinem Auftrag – den Provinzgarten.27 Kunst und Pracht der realen Satrapengärten stehen dabei sinnbildlich für die Wohlgeordnetheit und den Reichtum des jeweiligen Reichsteils. Wie treffend und der Zeit angemessen dieses Bild ist, zeigt die berühmte, gleichfalls von Xenophon überlieferte, Episode von der Begegnung zwischen dem spartanischen Flottenbefehlshaber Lysander und dem persischen Prinzen und karanos Kyros d.J., seinem Gastfreund (Oik. 4,20-24), in der Kyros sich selbst als Architekt der eindrucksvollen Gartenanlagen in Sardeis zu erkennen gibt. Wenn der Satrap Pharnabazos in einer anderen xenophontischen Rede (hell. 4,1,15.33), beklagt, die ihm von seinem Vater vererbten Paläste und Parks voller Bäume und jagdbarem Wild seien von den Griechen zerstört worden, dann möchte er demnach damit nicht nur auf den konkreten materiellen Verlust hinweisen, den er erlitten hat, sondern zugleich darauf, daß er sich als ‚schlechter Gärtner’ erwiesen hat und das Erbe des Vaters nicht zu schützen in der Lage gewesen ist. Nicht zuletzt deshalb verwarfen die Satrapen Dareios’ III. den Plan des griechischen Söldnerführers Memnon nach der Niederlage gegen Alexander d.Gr. am Granikos, die Taktik der ‚verbrannten Erde’ anzuwenden, um

24 Stronach 1989; 1993; Boucharlat 2001. 25 So H. Klinkott (Tübingen) in seiner noch unveröffentlichten Dissertation zum achaimenidischen Satrapen. 26 Fauth 1979; Stähler 1997; Briant 2002, 232-4. 27 Zu den persischen paradeisoi vgl. zusammenfassend: Kawami 1992; Tuplin 1996, 80-131; Uchitel 1997; Debord 1999, 45-7.118.185.247; Bremmer 1999.

Persien, der faszinierende Feind

305

dem Makedonen die Versorgungsgrundlagen zu entziehen (Arr. an. 1,12,9-10; Diod. 17,18,2-4; vgl. (später) Curt. 7,4,3-4).28 Wie das Beispiel des Pharnabazos beweist, machten nicht nur einheimische und exotische Pflanzen und Bäume, d.h. agri- und hortikulturelle Experimente, den Reiz der Gärten aus, sondern auch wilde Tiere, die in großen Gehegen gehalten und zu bestimmten Gelegenheiten gejagt wurden. So trat schon sehr früh im Achaimenidenreich neben das Bild des Königs als eines ‚guten Gärtners’ das des Herrschers als eines mutigen und geschickten Jägers, und die Bewährung des Königs auf der Jagd wie im Kriege wurde gleichsam zu einem Bestimmungsfaktor königlichen und aristokratischen Lebens in Iran und weit über Iran hinaus.29 In einer seiner beiden Grabinschriften (DNb 5-21.40-5) führt Dareios I. aus, was ihn und seine Herrschaft auszeichnet: Gerechtigkeit, Selbstbeherrschung, Großzügigkeit und militärische Tüchtigkeit. Mit dem altpersischen Wort aruvasta spielt Dareios darauf an, daß die persönliche Bewährung (auf der Jagd und im Kampf) einen guten und legitimen König auszeichnet, und dieser Gedanke hat denn auch, im Zusammenspiel mit dem der sog. ‘Wahrheitsliebe’ des Königs, in die nichtiranischen Teile des Reiches ausgestrahlt und ist, etwa von Herodot (1,136), zum Kennzeichen persischer Erziehung erklärt worden. Mit diesen persönlichen Vorzügen und bereitwilliger untertäniger Unterstützung - sowie göttlichem Schutz - ist der König in der Lage, die Gefahren für das Reich abzuwehren und sich so als Verteidiger der Bauern und Fluren zu erweisen (DPd 15-8). Als herausragender Krieger vermag er Invasoren abzuwehren (und die persischen Fluren zu schützen), als Vermittler zwischen der Welt der Götter und der Menschen kann er göttlichen Beistand und Segen erflehen und als guter Landwirt (und Gärtner) trägt er selbst zum Wohlergehen des Landes bei. Zurück zu den Gärten und Wildparks: Das altpersische Wort für Garten, *paridaida-, von dem sich der griechische Terminus paradeisos und unser Wort Paradies ableiten, bedeutet eigentlich „das Umzäunte, Ummauerte“. Persische paradeisoi sind daher am ehesten als botanische Gärten mit umzäunten Wildgehegen zu beschreiben, Gärten, in denen man gleichsam en miniature alle Pflanzen und Tiere des Reiches kennenlernen konnte. Zu den von den Königen selbst durchgeführten und an ihren Satrapen geschätzten agri- und hortikulturellen Meliorationsmaßnahmen zählte denn nicht umsonst der Import nützlicher oder erquickender Pflanzen; so wuchs etwa der an der großköniglichen Tafel kredenzte chalybonische Wein, ursprünglich im Osten des Reiches beheimatet, später auch in der Gegend von Damaskus, wo ihn die Griechen kennenlernten (Poseid. FGrH 87 F 68), fanden in achaimenidischer Zeit auch andere Pflanzen als dieser Wein und andere Tiere als der Pfau den Weg nach Westen (etwa der Reis30 oder das Huhn31). Es 28 Dies schließt nicht aus, daß auch die vom Großkönig vorgegebene Strategie sowie die Siegeszuversicht des Arsites und sein Wunsch, seine Feldherrenqualitäten unter Beweis zu stellen, eine Rolle gespielt haben (vgl. Briant 2002, 820-3). 29 Für die achaimenidische Zeit: Briant 2002, 230-2. Zur Jagddarstellung auf Siegeln s. Kaptan 2003, vol. 1, 74-99. 30 Marione 1992. 31 Schweizer 1961; Grabow 2003.

306

Josef Wiesehöfer

verwundert demnach nicht, daß Xenophon, der als Söldnerführer Kyros d.J. in dessen Krieg gegen den Bruder Artaxerxes II. solche paradeisoi kennengelernt hatte, nach seiner Rückkehr nach Hellas auf seinem Besitz in Skillos, 20 Stadien von Olympia entfernt, einen Garten persischer Art anlegen ließ (Xen. an. 5,3,1113)32, und es wird auch verständlich, warum das Wort *paridaida- als pardes in die hebräische Bibel Eingang fand und als paradeisos in der Septuaginta dann sogar auf den Garten in Eden bezogen wurde (Gen. 13,10 u.ö.).33 In Iran selbst schließlich haben zu allen Zeiten Motive aus der Wasser- und Gartenkultur der Achaimenidenzeit die Bilderwelt bestimmt: vor allem auf Teppichen, Stoffen und keramischen Objekten angebracht, sind sie ihrerseits zu Importgütern geworden und haben die östlichen wie die westlichen Kulturen nicht unmaßgeblich mitgeprägt.34

VI. Fassen wir zusammen: Obgleich nur höchst unzureichend belegt, kann der überregionale Güteraustausch in achaimenidischer Zeit doch aus einer Fülle von Indizien erschlossen und – angesichts der Ausdehnung des Perserreiches und der nicht nur ideologischen, sondern größtenteils auch faktischen pax Achaemenidica – als, in Qualität und wohl auch Quantität, bis dahin unerreicht charakterisiert werden. Fernhandel, aber etwa auch diplomatischer Verkehr, militärische Expeditionen, tributärer Zwang, großkönigliche Anordnung, untertänige Imitation und individuelles Grenzgängertum waren dabei dafür verantwortlich, daß Waren wie Ideen Provinz-, ja selbst Reichsgrenzen überschreiten konnten. Beim Großkönig waren der Wunsch, aber auch die ideologische wie faktische Notwendigkeit, die eigene Macht und die Wohlgeordnetheit des Reiches nach innen und außen zur Schau und unter Beweis zu stellen, ausschlaggebend für sein Interesse an Güter- und Kulturaustausch. Dabei konnte er, was das Procedere des Güteraustausches, aber auch die Formen der Statusanzeige angeht, auf eine Fülle von Anregungen aus den Vorgängerreichen zurückgreifen; die besondere Leistung des Dareios und seiner Nachfolger bestand dann allerdings darin, aus allem spezifisch achaimenidische Formen von Herrscherideologie und Herrschaftsrepräsentation auf Reichs- und regionaler Ebene entwickelt zu haben, Formen, die ihrerseits den provinzialen Eliten die Möglichkeit boten, einheimische Traditionen, Anregungen von außen, großkönigliches Vorbild und eigene Vorstellungen zu etwas Neuem, Eigenständigem zusammenzuführen. Auch auf Seiten der athenischen Elite bestimmte in nicht unerheblichem Maße das Verlangen nach externen Statusanzeigern das Interesse an Güter- und Kulturaustausch; dazu war man sogar bereit, den politischen Antagonismus hintanzustellen. Als diese Statusanzeiger sich dann jedoch, während 32 L’Allier 1998. 33 Bremmer 1999. 34 Zum persischen Erbe vgl. zusammenfassend Boardman 2000.

Persien, der faszinierende Feind

307

des Peloponnesischen Krieges, zunehmend zu ‚demokratisieren’ begannen, suchte mancher athenische Aristokrat seine Anregungen nun eher beim spartanischen Gegner.35

35 Miller 1997, 255-6.

308

Josef Wiesehöfer

Literatur Bäbler, B. 1998. Fleißige Thrakerinnen und wehrhafte Skythen: Nichtgriechen im klassischen Athen und ihre archäologische Hinterlassenschaft. Beiträge zur Altertumskunde, 108. Stuttgart: Teubner. Balcer, J.M. 1985. „Fifth Century Ionia: A Frontier Redefined.“ Revue des Études Anciennes 87: 31-42. Bedford, P. (im Druck). „The Persian Near East.“ In The Cambridge Economic History of the Greco-Roman World, edited by R. Saller and I. Morris and W. Scheidel. Cambridge: Cambridge University Press. Boardman, J. 2000. Persia and the West. London: Thames & Hudson. Boucharlat, R. 2001. „The Palace and the Royal Achaemenid City: Two Case Studies – Pasargadae and Susa.“ In The Royal Palace Institution in the First Millenium B.C., edited by I. Nielsen, 113-24. Monographs of the Danish Institute at Athens, 4. Aarhus: Aarhus University Press. Bremmer, J.N. 1999. „Paradise: from Persia, via Greece, into the Septuagint.“ In Paradise Interpreted. Representations of Biblical Paradise in Judaism and Christianity, edited by G.P. Luttikhuizen, 1-20. Themes in Biblical Narrative. Jewish and Christian Traditions, 2. Leiden: Brill. Bresson, A. 2000. La cité marchande. Scripta Antiqua, 2. Paris: de Boccard. Briant, P. 1997. „Bulletin d’Histoire Achéménide I.“ In Topoi, Suppl. 1: 5-127. Briant, P. 2001. Bulletin d’Histoire Achéménide II. Persika, 1. Paris: Thotm. Briant, P. 2002. From Cyrus to Alexander. A History of the Persian Empire. Winona Lake: Eisenbrauns. Briant, P., und R. Descat 1998. „Un registre douanier de la satrapie d’Égypte à l’époque achéménide.“ In Le commerce en Égypte ancienne, edited by N. Grimal and B. Menu, 59-104. Bibliothèque d’Étude, 121. Le Caire: Institut français d’archéologie orientale. Davies, J.K. 1971. Athenian Propertied Families, 600-300 B.C. Oxford: Clarendon Press. Debord, P. 1999. L’Asie Mineure au IVe siècle (412-323 a.C.). Bordeaux: Ausonius. De Vries, K. 1997. „The Attic Pottery from Gordion.“ In Athenian Potters and Painters, edited by J.H. Oakley et al., 447-55. Oxbow Monograph, 67. Oxford: Oxbow. Fauth, W. 1979. „Der königliche Gärtner und Jäger im Paradeisos. Beobachtungen zur Rolle des Herrschers in der vorderasiatischen Hortikultur.“ Persica 8: 1-53. Grabow, E. 2003. „Der Hahn - Haustier oder Dämon? Frühe Hahnbilder auf griechischen Vasen.“ Griechische Keramik im kulturellen Kontext. Akten des Internationalen Vasen-Symposions in Kiel vom 24. bis 28. 9. 2001 veranstaltet durch das Archäologische Institut der Christian-Albrechts-Universität zu Kiel, hg. v. B. Schmaltz und M. Söldner, 140-1. Münster: Scriptorium. Hauser, S.R., „Der hellenisierte Orient. Bemerkungen zum Verhältnis von Alter Geschichte, Klassischer und Vorderasiatischer Archäologie“, in: Kühne, H.

Persien, der faszinierende Feind

309

et. al. (Hg.), Fluchtpunkt Uruk: Archäologische Einheit aus methodischer Vielfalt. Schriften f. H.J. Nissen, Rahden (Westfalen) 1999, S. 316-341. Hölscher, T. 2000. „Feindwelten – Glückswelten: Perser, Kentauren und Amazonen.“ In Gegenwelten zu den Kulturen Griechenlands und Roms, hg. v. T. Hölscher, 287-320. München und Leipzig: Saur. Kaptan, D. 2003. The Daskyleion Bullae: Seal Images from the Western Achaemenid Empire, vol. 1. Achaemenid History, XII. Leiden: Nederlands Instituut voor het Nabije Oosten. Kawami, T.S. 1992. „Antike persische Gärten.“ In Der Garten von der Antike bis zum Mittelalter, hg. v. M. Carroll-Spillecke und L. Brubaker, 81-100. Mainz: Zabern. L’Allier, L. 1998. „Le domaine de Scillonte: Xénophon et l’empire perse.“ Phoenix 52: 1-14. Marione, N. 1992. Il riso nell’ antichità greca. Bologna: Patron. Miller, M.C. 1989. „Peacocks and tryphe in Classical Athens.“ Archaeological News 15: 1-10. Miller, M.C. 1997. Athens and Persia in the Fifth Century B.C.: A Study in Cultural Receptivity. Cambridge: Cambridge University Press. Miller, M.C. 2003. „Art, Myth and Reality: Xenophantos’ Lekythos ReExamined.” In Poetry, Theory, Praxis. The Social Life of Myth, Word and Image in Ancient Greece. Essays in Honour of William J. Slater, edited by E. Csapo and M. C. Miller, 19-47. Oxford: Oxbow. Porten, B., und A. Yardeni. 1993. Textbook of Aramaic Documents from Ancient Egypt, III: Literature, Accounts, Lists. Jerusalem: Hebrew University Press. Schweizer, W. 1961. Zur Frühgeschichte des Haushuhns in Mitteleuropa. Phil. Diss. München. Stähler, K. 1997. „Der Gärtner als Herrscher.“ In Religion und Gesellschaft. Studien zu ihrer Wechselwirkung in den Kulturen des antiken Vorderen Orients 1, hg. v. R. Albertz und S. Otto, 104-14. Alter Orient und Altes Testament, 248. Altenberge: Ugarit-Verlag. Sherratt, S./ Sherratt, A., The Growth of the Mediterranean Economy in the Early First Millennium BC, in: World Archaeology 24 (1993) 361-378. Stronach, D. 1989. „The Royal Garden at Pasargadae – Evolution and Legacy.“ In Archaeologia Iranica et Orientalis. Miscellanea in honorem L. Vanden Berghe, edited by L. DeMeyer and E. Haerinck, vol. 1, 475-502. Gent: Peeters. Stronach, D. 1993. „Parterres and Stone Watercourses at Pasargadae: Notes on the Achaemenid Contribution to Garden Design.“ Journal of Garden History 14: 2-12. Tuna-Nörling, Y. 1998 [1999]. Attische Keramik aus Daskyleion. Arkeoloji Dergisi, VI. Izmir: Ege Üniversitesi. Tuplin, Ch. 1996. Achaemenid Studies. Historia-Einzelschriften, 99. Stuttgart: Steiner. Uchitel, A. 1997. „Persian Paradise: Agricultural Texts in the Fortification Archive.“ Iranica Antiqua 32: 137-44. Voigt, M. et al. 1997. „Fieldwork at Gordion: 1993-1995.“ Anatolica 23: 1-59.

310

Josef Wiesehöfer

Whitby, M. 1998. „An International Symposium? Ion of Chios fr. 27 and the Margins of the Delian League.“ In Ancient Iran and the Mediterranean World, edited by E. D!browa, 207-24. Electrum, 2. Kraków: Jagiellonian University Press. Wiesehöfer, J. 1999. „Kyros, der Schah und 2500 Jahre Menschenrechte. Historische Mythenbildung zur Zeit der Pahlavi-Dynastie.“ In Mythen, Geschichte(n), Identitäten: Der Kampf um die Vergangenheit, hg. v. S. Conermann, 55-68. Asien und Afrika, 2. Hamburg: EB-Verlag. Wiesehöfer, J. 2003. „Iraner und Hellenen: Bemerkungen zu einem umstrittenen kulturellen Verhältnis.“ In Studia Eurasiatica. Kieler Festschrift für H. Kulke zum 65. Geburtstag, hg. v. S. Conermann und J. Kusber, 497-524. Asien und Afrika, 10. Hamburg: EB-Verlag. Wiesehöfer, J. (in Vorbereitung). Les Iraniens et les Hellènes. Paris.

ÜBER MODELLE ANTIKER GELDVERKEHRSSYSTEME Burkhard Meißner I. Einleitung Da die moderne Volkswirtschaft, gestützt auf raffinierte Dokumentationen und Statistik, sich schwertut, quantifizierende Modelle und präzise zeitindizierte Prognosen zu erstellen, scheint es zunächst nicht selbstverständlich, daß von der Wirtschaft der lückenhaft dokumentierten und brüchig überlieferten Antike Funktionsmodelle oder gar quantifizierende Modelle ihres Umganges mit der Knappheit von Geld und Gütern aufgestellt werden können. Die Erneuerung nämlich von Polanyis und Max Webers Skeptizismus gegenüber der Existenz währungsbasierter volkswirtschaftlicher Systeme in der Antike durch die Schule Moses Finleys richtete sich gegen die Voraussetzung, moderne Modelle wirtschaftlicher Zusammenhänge ließen sich, ggf. in modifizierter Form, auf antike Sachverhalte übertragen1. Folgte man diesem Skeptizismus, der auch Karl Büchers Position in der sog. Bücher-Meyer-Kontroverse bestimmte2, könnte Wirtschaftsgeschichte der Antike nichts anderes sein als eine historische Wirtschaftssoziologie oder Wirtschaftsethik, die nicht Systeme und Quantitäten betrachtet, sondern den Gebrauch des Geldes als Symbol, seine kommunikative Funktion, Rituale der Reziprozität usw. Dies ist eine fruchtbare Perspektive, und sie hat hat auf die Wirtschaftswissenschaften zurückgewirkt: Die Institutionenökonomik floriert, auch die Wirtschaftsethik, und Schefold begründete eine wirtschaftliche Kulturwissenschaft und bestimmte deren Gegenstand mit dem aus Kunstgeschichte und Klassischer Archäologie entlehnten Begriff des Wirtschaftsstiles3. Die Möglichkeit volkswirtschaftlicher Analyse und Modellbildung hatte Finley verneint, weil der Antike der Begriff der Wirtschaft als eines eigengesetzlichen Zusammenhanges gefehlt und weil die Antike die Wirtschaft nicht quantifizierend betrachtet habe; für die Antike seien daher die begrifflichen und mathematischen Instrumente zur Beschreibung ökonomischer Rückwirkungsrationalität unangemessen4. Finleys Überlegung setzt voraus, daß die Akteure einer Volkswirt1

2 3

4

Zur Forschungs- und Dogmengeschichte vgl.: M.de Cecco, Monetary Theory and Roman History, in: AAVV, Atti dell'Accademia Romanistica Costantiniana, XII in onore di Manlio Sargenti, Napoli (1998) 433-456, bes. 445-447; S.v.Reden, Money in the ancient economy: A survey of recent research, Klio 84 (2002) 141-174. Helmut Schneider, Die Bücher-Meyer-Kontroverse, in: W.M.Calder III u. A.Demandt (Hsg.), Eduard Meyer: Leben und Leistung eines Universalhistorikers, Leiden (1990), 417-445. Eine solche Disziplin beschreibt die kulturell vermittelten Regeln, Standards und Normen wirtschaftlichen Handelns; sie kann die Entwicklung des wirtschaftlichen Denkens, also den Fortgang des eigenen Faches, als Entwicklung wirtschaftlicher Denkstile selbst historisch erfassen. Vgl. B.Schefold, Wirtschaftsstile I-II, Frankfurt/M. (1994-1995). M.Finley, Die antike Wirtschaft, München (21980) 12ff.; M.Finley, Aristotle and Economic Analysis, Past & Present 47 (1970) 3-25; M.Finley, Aristotle on Exchange, Opus 6/8 (1987/1989) 295-302. Ökonomische Analyse kann Finley zufolge nur betrieben werden, wo Ökonomie als besonderes System prästabilisierter oder durch den Staat stabilisierter Harmo-

312

Burkhard Meißner

schaft sich dessen bewußt sind, Akteure eines volkswirtschaftlichen Wechselwirkungssystems zu sein, um ihren eigenen Nutzen mehren zu können. Um betriebswirtschaftlich zu handeln, muß man volkswirtschaftlich denken und den Begriff einer Volkswirtschaft haben. Dieser aber habe der Antike gefehlt, und dies erklärt deren nur begrenzten Drang zu ökonomischer Rationalität. Man kann nun aber durchaus der sprichwörtliche dumme Bauer sein und wird doch davon ausgehen, daß große Kartoffeln besser sind als kleine und mehr besser als weniger. Auch mit nur diffusen Ahnungen vom Marktgeschehen wird sich ein Interesse an betrieblicher Rationalisierung und rationalem Verhalten am Markt verbreiten: Gerade darin besteht eine Pointe des Marktmodells, und ein solches Interesse bedient etwa die römische Landwirtschaftsliteratur. So sind ungeachtet der Skepsis Finleys tatsächlich Modelle antiker Wirtschaftssysteme und Wirtschaftsrationalität vorgelegt worden. In diesen Modellen spielt, um anachronistische Perspektiven zu vermeiden, der Staat eine prominente Rolle, weil nämlich die Gedankenfigur einer automatisch prästabilisierten Harmonie der Märkte eine ganz neuzeitliche ist. Aristoteles' Markt- und Geldtheorie kennt diese Idee beispielsweise nicht: Ihr zufolge bestimmen Angebot und Nachfrage auf Märkten die Preise; Geld vermittelt zwischen den Akteuren als Zwischenware, Wertaufbewahrungsmittel und Rechnungseinheit; auch seine Kaufkraft unterliegt dem Schwanken aller Knappheit (• • • •• •),•und • • •Aristoteles’ Marktmodell hat in dieser Tatsache des Schwankens seine Pointe, nicht in einer Selbststabilisierung der Märkte5; weniger dadurch, daß in Aristoteles’ Vorstellungen von Wirtschaftssystemen die Interessen der Marktbeteiligten als illegitim betrachtet würden, unterscheidet sich sein Modell von modernen Modellen, sondern6 durch das Fehlen von Smith’s invisible hand. Die Antike rechnete nämlich mit Reziprozitätsphänomenen als irrationalen Größen, als Rache der Götter, Kontingenz der Politik u.ä.; der systematische Ort für regelhafte Rückwirkungs-, Kompensations- und Gleichgewichtssysteme war die Staatstheorie, aus der sie der

5

6

nie besteht: Moderne Ökonomie und moderne Wirtschaftswissenschaften bedingen einander, vgl. Joseph Alois Schumpeter, History of Economic Analysis, London (1954 ND 1997). Arist., EN 1133a19-1133b28, insbes. 1133b6-10. Vgl. 1133b13-14: • • • • • ••••••• µ•• • • • • • •• •• •••• • • • • • • • •• •••• • • • •· •••••• • • • • • • •••• •• • • • • • • • • • •••••••• · • •µ• •••• • • • • • • • • • ••••••••• µ• • • •• • µ• • • • • • • •. •Vgl. ••• S.Meikle, Aristotle and the Political Economy of the Polis, JHS 99 (1979) 57-73; S.Meikle, Aristotle on Equality and Market Exchange, JHS 111 (1991) 193-196; S.Meikle, Aristotle on Business, Classical Quarterly 46 (1996) 138-151; S.Meikle, Modernism, Economics, and the Ancient Economy, Proceedings of the Cambridge Philological Society 41 (1995) 174-191; S.Meikle, Aristotle's Economic Thought, Oxford (1995). L.Houmanidis, Aristotle on value and price, Archives of economic history. 6,2 (1995) 7-22. Aristoteles' einfaches Marktmodell betrachtet nicht, wie Schefold meint, die individuellen Eigeninteressen von Anbietern und Nachfragern als illegitim. Der Aufwand der sokratischen Schule zur begrifflichen Einhegung der durch die Sophisten freigesetzten Egoismen belegt, wie sehr die philosophische Position die einer Minderheit war: Eigene Interessen auf Märkten zu verfolgen, galt als Regelfall. Vgl. B.Schefold, Aristotle and pre-Aristotelian Economic Thought, in: B.B.Price, Ancient Economic Thought, London, New York (1997) ND (1999) 99-145. Mathematische Rationalität und das Bewußtsein für das Wirken des Systems der Bedürfnisse (Hegel) sind nur ein Teil wirtschaftlicher oder praktischer Vernünftigkeit, R.Bubner, Handlung, Sprache und Vernunft, Frankfurt/M. (1982).

Modelle antiker Geldverkehrssysteme

313

Empirismus für seine politische Ökonomie entnahm. Ein Modell der Selbststabilisierung etwa stellt die Mischverfassung7 dar. Modelle können (1) Maximen und Regeln der praktischen Erfahrung verallgemeinern (steigt das Angebot, sinkt ceteris paribus der Preis); verfügt man über den Funktionenbegriff, kann man (2) Angebot, Verkaufszahlen und Preise als Funktionen der Zeit darstellen und zwischen ihnen Korrelationen anschaulich machen; mit Mitteln der Regressionsanalyse kann man (3) die Einflußfaktoren auf Preis- und Kursbildung quantitativ modellieren; dies macht man, um Marktvorgänge zu erklären. Man setzt solche Modelle aber auch ein, um (4) Marktvorgänge zu antizipieren und dann spekulativ zu unterlaufen, aber solche zeitnahe Analyse ist eine Sache erst des Zeitalters der Massencomputerisierung. Die antike Wirtschaft kannte nur Modelle und Wissen unserer Stufe (1). Innerhalb der Grenzen einer Mathematik ohne Statistik ging ihre Rationalität immerhin bis zu detaillierten Abrechnungen und Preiserhebungen: Das epigraphische, papyrologische und literarische Material ist reichhaltig. Modelle stellen vereinfachende Abstraktionen der Wirklichkeit dar; sie sind nicht richtig oder falsch, sondern mehr oder weniger erklärungskräftig, stimmig und plausibel. Von Modellen, die den antiken Geldverkehr quantitativ betrachten, wird man erwarten, daß sie Meß- oder Schätzgrößen angeben, die in die Variablen der sog. Quantitätstheorie des Geldumlaufes eingesetzt werden können. Diese Quantitätstheorie8 bestimmt apriorisch, wie wir uns Tauschverkehr gegen Geld immer schon vorstellen. Die Theorie in der Formalisierung Irving Fisher's behauptet die Äquivalenz von Geld- und Güterumsatz in einer Volkswirtschaft pro Zeiteinheit: M·V=P·T In der Gleichung bezeichnet M die Geldmenge (gezählt als Vielfaches einer Geldeinheit); V ist die durchschnittliche Umlaufgeschwindigkeit dieser Geldmenge, d.h. die durchschnittliche Zahl der Tauschvorgänge jeder Geldeinheit pro Zeiteinheit; analog bedeutet T das reale Handelsvolumen (die Menge gehandelter Güter), P den durchschnittlichen Warenpreis. Selbstverständlich bezieht sich diese Gleichung nur auf den Tausch von Gütern gegen Geld; der in der Antike wichtige Naturaltausch bleibt außerhalb der Betrachtung. Kurzfristig schwanken Gütermenge und Geldumlaufgeschwindigkeit tatsächlich wenig; daraus folgt eine Pointe dieser Theorie in ihrer monetaristi-

7

8

Aristoteles Konzeption der Mischverfassung: Arist., Pol. 1265b18-1266a30; 1269a291269b12; 1272b24-1273b26; 1293a35-1294b41; 1295b1-1296a21; 1296b13-1297a13. Das Gleichgewichtsverhältnis nennt Aristoteles • • • • • • •• •, 1296b25. • • • • • • • Vgl. Plat., Leg. 712d-713a. Polybios’ Theorie der römischen Ordnung: Polyb. VI 11-18. Dazu vgl. W.Nippel, Mischverfassungstheorie und Verfassungsrealität in Antike und früher Neuzeit, Stuttgart (1980); B.Meißner, • • • • • • • •• • •••• •• ••••••• •:• Polybios •• •• •• • • über • den Zweck pragmatischer Geschichtsschreibung, Saeculum 37 (1986) 313-351, bes. 334ff. Vgl. F.Beyer, Geldpolitik in der römischen Kaiserzeit, Wiesbaden (1995) 88ff.; de Cecco (wie Anm. 1).

314

Burkhard Meißner

schen Interpretation: Inflation besteht in einer Ausweitung der Geldmenge9. Im folgenden will ich zunächst moderne, dann antike Wirtschaftsmodelle vorstellen, die alle eine quantifizierende Perspektive eröffnen (analog Goldsmith10 Modell für Athens Bruttosozialprodukt), die aber den Geldverkehr beschreiben. II. Aperghis Modell des Geldverkehrs in Mesopotamien Ein Modell des seleukidischen Geldverkehrs in Mesopotamien hat Aperghis vorgelegt11. Es betrachtet Bevölkerungszahl, Güterproduktion (v.a. landwirtschaftliche), Steuererhebung und Münzprägung. Die Schätzung der Bevölkerungszahlen erfolgt aufgrund von Siedlungssurveys, Schätzungen der Bevölkerungsdichte für den vorindustriellen Vorderen Orient und den wenigen Hinweisen der literarischen Überlieferung über militärische Mannschaftsstärken: ca. 5-6 Mio. Menschen12. Literarisch überlieferte Summen von Steuern und Abgaben sowie der Vergleich mit dem Achämenidenreich führen zu einer in Geld gerechneten Abgabenhöhe von ca. 1 Talent pro 1000 Einwohnern. Aus den astronomischen Tagebüchern von Babylon lassen sich Preise u.a. für Gerste, Datteln, Sesam und Gartenkresse ermitteln. Aufgrund der geschätzten Einwohnerzahlen ergibt sich der Gegenwert von ca. 10.000 Talenten jährlich als landwirtschaftlicher Subsistenzbedarf13. 1/3 - 1/2 dieser Produktion, ca. 4000 Talente, dürfte direkt dem königli9

10

11

12 13

Bei konstanter Güterproduktion und Tauschfrequenz sind Inflation und Geldmengenwachstum identische Prozesse. Eine weitere Folgerung aus der Quantitätstheorie ist, daß der Umsatz einer Volkswirtschaft in Gütern, multipliziert mit ihren Durchschnittspreisen, oder in Geldeinheiten, multipliziert mit deren durchschnittlicher Tauschfrequenz, angegeben werden kann. Die Aussagen der Theorie gelten unabhängig davon, ob es um gemünztes Edelmetall, Scheidemünzen, Papiergeld oder Giralgeld geht. Betrachtet werden nur die Durchschnittspreise aller gegen Geld gehandelter Waren. Ein Steigen oder Fallen der Preise weniger, auch elementarer Güter, wie Brot, Getreide oder Gold, kann ein Indiz für eine Ausweitung der Geldmenge sein, beweist diese aber noch nicht. Erst ein Anstieg der Durchschnittspreise aller Transaktionen vergrößert die Geldmenge und bedeutet Inflation. Diese sicher zu diagnostizieren bedarf einer dichteren Preisdokumentation als sie für die Antike meist zur Verfügung steht. R.W.Goldsmith, Premodern Financial Systems, Cambridge (1987). Das Modell geht von mehr oder weniger plausiblen Schlüssen und Hypothesen über Athen aus: ca. 300.000 Einwohner; 1/2 Bürger, 1/5 Freigelassene, 1/3 Sklaven. Kalkuliert für das Bruttosozialprodukt wird nur das, was für den Markt produziert wird, also nicht Selbstversorgung oder Arbeit im Haushalt. 1/2 der Staatsausgaben wurden demnach für religiöse und politische Zwecke ausgegeben. Das Kreditwesen im klassischen Athen war wenig entwickelt, doch Pachtgeschäfte und Landkredite gab es, und als einzige bedeutende Kreditform für produktive Zwecke den See- bzw. Schiffskredit, vgl. B.Schefold, Aristotle and pre-Aristotelian Economic Thought, in: B.B.Price, Ancient Economic Thought, London, New York (1997) ND (1999) 99-145. M.Aperghis, Population-Production-Taxation-Coinage. A Model for the Seleucid Economy, in: Z.H.Archibald, J.Davies, V.Gabrielsen, G.J.Oliver (Hsgg.), Hellenistic Economies, London, New York (2001) 69-102. Mesopotamien wird als relativ abgegrenzte Region betrachtet. Für das gesamte Seleukidenreich schätzt Aperghis die Bevölkerung auf 20-25 Mio. Für den Handel wird kein solcher Wert angegeben: Den größten Umfang erwartet Aperghis vom lokalen Handel.

Modelle antiker Geldverkehrssysteme

315

chen Haushalt zugute gekommen sein und die gesamten königlichen Einkünfte aus Mesopotamien etwa 6000 Talente betragen haben. Die Kasse des Königs münzte ihre Edelmetallbestände in Tetradrachmen aus, um Bedienstete und Anschaffungen zu bezahlen; sie zog diese Münzen andererseits als Abgaben ein. Untersuchungen zu Verlust und Abnutzung der Münzen und Prägestempel (nach Mørkholm)14 führt zur Schätzung, pro 1 Mio. Einwohner dürften 1000-2000 Talente Silber im Umlauf gewesen sein. Die Größenordnung dieser Zahl entspricht derjenigen der Steuererhebung in Geld: Dem Modell zufolge zirkulierten die Tetradrachmen folglich fast ausschließlich für Transaktionen mit der königlichen Kasse. Nichtmonetäre Geschäfte dürften im Alltag demnach sehr umfangreich gewesen sein. Ähnliche Überlegungen hatten Samuel zu ganz gleichartigen Schlußfolgerungen für das Ptolemäerreich geführt15. Das Modell des Geldverkehrs in Mesopotamien beschreibt also den Geldkreislauf einer königlichen Verwaltungswirtschaft; darin liegt seine Pointe: Die seleukidische Geldprägung diente in Mespotamien im wesentlichen der finanziellen Interaktion mit der königlichen Kasse. III.

Modelle des kaiserzeitlichen Geldverkehrs

Im römischen Kaiserreich ist ein höherer Grad der Monetarisierung der Wirtschaft zu erwarten als in den hellenistischen Monarchien. Keith Hopkins' Modell der durch Geld integrierten Provinzen des römischen Reiches erklärt und erhärtet diese Annahme: Demnach floß von den Gebieten mit wenig öffentlich Bediensteten und denen mit einem hohem Bestand an Militär und Personal, also hohem Geldbedarf, ein steter Geldstrom, der entsprechende Warenströme zur Folge hatte. Ähnlich wie Aperghis erschließt Hopkins den Umfang des Geldumlaufes aus der Zusammensetzung von Hortfunden sowie Plausibilitätserwägungen zum Bedarf und Nachschub an Münzgeld für die Finanzierung von Heer und Verwaltung16. Wie andere Modelle, die die Zusammensetzung von Hortfunden als Indikator für den Grad der Vernetzung regionaler Wirtschaftssysteme betrachten, ist Hopkins’ 14 Aperghis schätzt einen Ersatzbedarf von ca. 1% der umlaufenden Edelmetallmünzen pro Jahr in Friedenszeiten und vermutet, daß für 1 Mio. Einwohner (30.000 Münzen, 20 Talente) jährlich ein Rückseitenstempel abgenutzt wurde. 15 A.E.Samuel, The Money-Economy and the Ptolemaic Peasantry, Bull. Amer. Soc. Papyrol. XXI (1984) 187-206. Die ptolemäische Verwaltungswirtschaft hat McClellan in ein Entwicklungsmodell hellenistischer Wirtschaftssysteme hineingestellt: Von der bewässerungsgestützten Agrarwirtschaft des späten Pharaonenreiches mit kontrolliertem Außenhandel (Naukratis) über die Erwirtschaftung stetiger Überschüsse für Tribute und Abgaben unter persischer Herrschaft bis zur königlichen Verwaltungswirtschaft des Hellenismus mit ihren Monopolen in Ägypten, M.C.McClellan, The Economy of Hellenistic Egypt and Syria: An Archaeological Perspective, in: B.B.Price, Ancient Economic Thought I, London, New York (1997 ND 1999) 172-187. Dieser ging es um die Verstetigung der königlichen Einkünfte, nicht deren marginale Maximierung; ein Ziel war wohl auch die Verstetigung der Versorgung mit Gütern des elementaren Bedarfs (Öl, Salz, Gewürze, Bier, Linsenbrei, usw.). 16 K.Hopkins, Taxes and Trade in the Roman Empire (200 B.C. - A.D. 400), Journal of Roman Studies LXX (1980) 101-125.

316

Burkhard Meißner

Modell auf numismatisch begründete Skepsis gestoßen17: Zwischen der Zusammensetzung von Horten und antiken Handelsströmen bestehen nur indirekte kausale Zusammenhänge. Allerdings lassen auch indirekte Zusammenhänge bei entsprechender Vorsicht und im Vergleich mit dem übrigen Quellenmaterial Schlüsse auf den Geldumlauf zu, und so hat man, um die quantifizierenden Modelle raffinierter zu gestalten und sicherer zu fundieren, vor allem die Dokumentationsgrundlage verbreitert. Ein quantifizierendes Modell der kaiserzeitlichen Geldverkehrswirtschaft beschrieb Beyer18: Sein Modell des Geldverkehrs soll zeigen, daß es zwischen 23v.Chr und 193 n.Chr. kaum nennenswerte Inflation gab und daß dies seine Ursache darin hatte, daß den für die Geldpolitik Verantwortlichen der quantitätstheoretische Zusammenhang zwischen Geldmenge, Geldumlaufgeschwindigkeit und Warenumsatz intuitiv bewußt gewesen sei19. In den ersten beiden nachchristlichen Jahrhunderten lagen die kurzfristigen Preisschwankungen im Römischen Reich nämlich immer erheblich höher als alle langfristigen Preisveränderungen. Saisonale Unterschiede bestimmten also stärker als ein säkulares Inflationsgeschehen die Preisbildung, und dies dürfte mit Produktionsschwankungen zu erklären sein. Über ca. 200 Jahre hinweg ergibt sich eine durchschnittliche Preissteigerung von jährlich ca. 0,32%20. Dieser geringen jährlichen Preissteigerung standen temporäre Preisschwankungen von mehreren 100% gegenüber21. Diese auffällige Stabilität des kaiserzeitlichen Geldsystems trotz Ab-

17 Vgl. C.Howgego, Geld in der Antiken Welt, Darmstadt (2000) 101-127; v.Reden (wie Anm. 1) 160-164. 18 F.Beyer, Geldpolitik in der Römischen Kaiserzeit, Von der Währungsreform des Augustus bis Septimius Severus, Wiesbaden (1995). 19 Das Verhalten der Beteiligten in den Finanz- und Kreditkrisen während der Catiliniarischen Verschwörung (63 v.Chr.), während des Bürgerkrieges 49 v.Chr. und nach dem Sturz Seians 31 n.Chr. belegt Beyer zufolge das Bewußtsein der Verantwortlichen für die Bedeutung der Geldumlaufgeschwindigkeit, Beyer, aaO. 34. Zu den Krisen von 49 v.Chr. und nach 31 n.Chr. vgl. M.Frederiksen, Caesar, Cicero and the Problem of Debt, Journal of Roman Studies LVI (1966) 128-141. 20 Drexhage errechnete Weizenpreise von 8,82 Drachmen pro Artabe für das erste, 12,02 für das 2. und 16,80 für das dritte Jahrhundert. Daraus errechnet sich eine durchschnittliche jährliche Preissteigerungsrate von 0,32%, vgl. H.-J.Drexhage, Preise, Mieten/Pachten, Kosten und Löhne im römischen Ägypten bis zum Regierungsantritt Diokletians, Vorarbeiten zu einer Wirtschaftsgeschichte des römischen Ägypten I, St. Katharinen (1991) 20. Duncan-Jones hat eine Preissteigerung zwischen ca. 100 und 220 n.Chr. von jährlich 0.85% auf der Basis verschiedener Preise errechnet, R.Duncan-Jones, Money and Government in the Roman Empire, Cambridge (1994) 28, für die jedoch vor allem die hohe Preissteigerung Anfang des 3. Jhdt.s verantwortlich ist. 21 Nachfrageinduzierte Inflationen bei Vollauslastung der Produktionsfaktoren mögen hinter saisonalen und krisenhaften Preisschwankungen stehen, sind jedoch so schwer wie Angebotsinflationen aus der Preisdokumentation der römischen Kaiserzeit sicher abzuleiten. Auch für eine langfristige importierte Inflation durch dauerhaften Exportüberschuß fehlen Indizien; Beyer setzt vielmehr eine negative Leistungsbilanz des Römischen Reiches voraus: Hätte es eine längerfristige Inflation gegeben, wäre sie, wie seit Beginn des dritten Jahrhunderts, als Geldmengenwachstum zu erklären.

Modelle antiker Geldverkehrssysteme

317

nahme des Silberfeingehaltes der Münzen auf ca. 1/222 erklärt Beyer mit einem monetaristischen Modell. Im Unterschied zu einem Modell nach Keynes, das wie Aristoteles Marktstabilität als politische Leistung vom Staat erwartet, betrachtet der Monetarismus den Staat selbst als die wesentliche Störgröße für das Marktgleichgewicht. Neben dem Staat agierte auf den Märkten ein Privatbankensystem mit Ansätzen zu einem Giroverkehr, der ohne Börsen, wie anzunehmen ist, v.a. auf der Verknüpfung von Netzwerken des Vertrauens im sozialen Nahraum aufruhte und dadurch Schuldverschreibungen und Forderungen als Giralgeld transferierbar machte23. Einen zweiten Puffer neben den Banken, der staatliche Störwirkungen auf das wirtschaftliche Gleichgewicht dämpft, sieht der Monetarist in den Kassen der einzelnen Marktteilnehmer, die bei geänderter Geldversorgung über Mehrausgaben oder Konsumverzicht für eine Restabilisierung auf geändertem Niveau sorgen24. Ein dritter Puffer lag in der Untermonetarisierung der römischen Wirtschaft und der Möglichkeit zum Naturaltausch25. Schätzungen des Staatsbudgets, die Beyer noch anmahnte, hat Duncan-Jones vorgelegt und so das Modell vervollständigt: Um 150 n.Chr. bei jährlich ca. 900 Mio. Sesterzen, stieg es bis 215 auf ca. 1500 Mio. Sesterzen. Die Umlaufgeschwindigkeit der Münzen war geringer als etwa im 19. Jahrhundert; die umlaufende Geldmenge schätzt Duncan-Jones auf den Gegenwert von ca. 20,5 Milliarden Sesterzen, die jährliche Produktion auf 355 Millionen Sesterze26. Diese Neuproduktion umfaßte also nur einen Bruchteil des Staatsbudgets, die umlaufende Geldmenge machte ein Vielfaches des Staatsbudgets aus.

22 Beyer, aaO. 89ff. 23 Vgl. F.Preisigke, Girowesen im griechischen Aegypten, Strassburg (1910); Kiessling, RE Supl. IV, 696-709, s.v. Giroverkehr; J.Andreau, Banking and Business in the Roman World, New York (1999); R.Bogaert, Banques et banquiers dans les cités grecques, Leyden (1968); P.Drewes, Die Bankdiagraphe in den gräko-ägyptischen Papyri, Diss. Freiburg/Br. (1970); H.v.Freyberg, Kapitalverkehr und Handel im römischen Kaiserreich, 27 v.Chr. - 235 n.Chr., Schriftenreihe des Instituts für Allgemeine Wirtschaftsforschung der Albert-LudwigsUniversität XXXII, Freiburg/Br. (1989). 24 Für das Wirken dieser Puffer fehlt allerdings weitgehend die mikroökonomische Dokumentation; die wenigen erhaltenen Betriebsarchive erlauben es nicht, das Wirken dieses Massenphänomens zu beschreiben. 25 Beyer, aaO. 89ff. Der Geldschöpfung der Banken entsprach eine Ausweitung der Geldmenge durch Geldverschlechterung, zuweilen auch außerordentliche Schuldenerlässe etc. In modernen Volkswirtschaften übernimmt das Bankensystem die Funktion eines Puffers für die aggregierten Risiken, vgl. N.Luhmann, Soziologie des Risikos, Berlin, New York (1991) 187199. Unter antiken Bedingungen haben wir uns diese Funktion des vertrauensabhängigen Kredit- und Girogeschäftes als vielfältiges soziales Netzwerk, das die jeweiligen sozialen Nahräume kommunikativ und merkantil überspannt, vorzustellen; über derartige Netzwerke als Risikopuffer vgl. ebda. 201-215. Tatsächlich darf man die Pufferwirkungen nicht überschätzen: Der Feingehalt des Denars verringerte sich von Augustus bis Septimius Severus auf ca. 2/3, d.h. durchschnittlich um 0,175 Prozentpunkte (oder 0,2 %) pro Jahr, also im Bereich der Größenordnung der langfristigen Inflation. 26 R.Duncan-Jones, Money and Government (wie Anm.20) 45; 106ff.; 163-170; 167 tab. 11.1 (errechneter Durchschnitt).

318

Burkhard Meißner

Dem Modell zufolge diente die Geldversorgung im Römischen Reich in deutlich geringerem Maße nur den Bedürfnissen der Staatswirtschaft als im Seleukidenreich; es handelte sich bei der Wirtschaft des Kaiserreiches demnach um eine vergleichsweise entwickeltere Geldwirtschaft mit nahezu flächendeckendem Bankensystem27. Monetaristisch erklärt wird durch Beyers Modell die relative Stabilität des Geldsystems; das Verhalten des Staates, saisonale Schwankungen von Produktion und Nachfrage, sowie politische und außenwirtschaftliche Faktoren betrachtet das Gleichgewichtsmodell des Geldumlaufes als externe Störfaktoren. Die Sorge um Stetigkeit scheint ein wesentliches Charakteristikum antiker Geldverkehrssysteme gewesen zu sein, gerade weil die Güterpreise kurzfristig erheblich schwankten. Der monarchische Staat agierte in diesen Systemen mit dem Ziel der Verstetigung seiner Einkünfte und wohl weniger mit dem Ziel einer Maximierung marginaler Profite; die Geldverkehrssysteme leisteten die Pufferung kurzfristiger Schwankungen. IV.

Antike Modellbildung

Genau dieses Ziel der Stabilität und Verstetigung wird nun auch dort als ein Zweck wirtschaftlicher Rationalisierung angegeben, wo griechisches Wirtschaftsdenken sich selbst Modelle machte, die Funktionen beschreiben und quantifizierbare Größen benennen, auch wenn die statistischen Instrumente weitgehend fehlten, die empirische volkswirtschaftliche Quantifizierungen erst ermöglichen. Dennoch gilt: Es gibt antike Denkmodelle von wirtschaftlichen Zusammenhängen und Geldverkehrssystemen, die u.a. einige wesentliche der hier angesprochenen Größen und Funktionen beschreiben. Diese Denkmodelle zur Anregung und Leitlinie moderner Modellbildung zu nehmen, erscheint lohnend, insbesondere dann, wenn über ein Gleichgewichtsmodell hinaus Modelle wirtschaftlicher Entwicklung formuliert werden, oder wenn die Funktion von Handel und Geldverkehr für Kommunikation, Kulturkontakt und zivilisatorischen Wandel in der Antike dargestellt werden sollen. Man kann antiken Selbstreflexionen auf das Wirtschaften unter systematischem Aspekt nämlich entnehmen, welche Funktionen den Handelnden selbst als wichtig, welche Quantitäten als prinzipiell zu benennende, meß- und kalkulierbare Größen angesehen und daher als optimierbar behandelt wurden. 27 Beyer, aaO. 115. Inflation konnte in dieser Wirtschaft nur schwer entstehen, weil einer Ausweitung der Kaufkraft enge Grenzen gesetzt waren: Der Staat konnte sich nicht einfach verschulden, und eine Erhöhung seiner Einkünfte aus Abgaben etc. führte ggf. nur zur Erniedrigung der Privatkaufkraft, Beyer, aaO. 125: Bis zu Septimius’ Severus’ Münzverschlechterung zur Bürgerkriegsfinanzierung blieb dieses System stabil. Im Außenhandel nimmt man überwiegend eine ausgeglichene Handelsbilanz an, teilweise abgewickelt durch Naturaltauschgeschäfte (barter). Der Handel mit China und Indien in Luxuswaren aber führte zu einem stetigen Kapitalexport, der bis zur Mitte des 2. Jhdt. stieg, um dann zu sinken. Auch Subsidien und Tribute an benachbarte Herrscher und Völker bewirkten einen Kapitalabfluß, der vielleicht deshalb das Preisniveau kaum beeinflußte, weil mit dem Geld teilweise römische Waren gekauft wurden.

Modelle antiker Geldverkehrssysteme

319

a) Platon: Das Funktions- und Entwicklungsmodell eines Stadtstaates und der ihn prägenden Wissenskultur konstruieren die Gesprächspartner in Platons Politeia, um eine Theorie praktischen Geltens28 gedanklich zu erproben. Vergesellschaftung ist darin Resultat menschlicher Bedürftigkeit (• • • •• •):• Die • • • Menschen sind Mängelwesen, darum brauchen sie den Tausch. Für die im Anschluß dargelegte Staatstheorie bedeutet die Bewältigung der Folgelasten jener Kompensation der Knappheit durch Arbeitsteilung und Tausch das Kernproblem29. Tausch, Handel und Verkehr sind in Platons Gedankenmodell die primären Formen auf Dauerhaftigkeit angelegten menschlichen Kontaktes. Kauf und Verkauf sind also gemeinschaftsstiftende Tätigkeiten; Arbeitsteilung und Spezialisierung lassen alles mehr, schöner und leichter gelingen, maximieren folglich offenbar die Ergebnisse menschlichen Handelns in quantitativer wie qualitativer Hinsicht und minimieren die Aufwendungen30. Handel und handelbare Überschüsse entwickeln sich in diesem Modell technisch-wirtschaftlicher Differenzierung ebenso wie ein System des Geldes, das Platon als Wertaufbewahrungsmittel, Zwischenware und Kommunikationsmittel deutet, als Wertzeichen für den Tausch (• • µ• • • • • • • • •• • ••••• • • • • • • • •••••••• • • • • • •)31 • •. Das • • Modell beschreibt einen Vorgang des Prosperierens, der Entstehung von Luxus und raffinierter Kultur32, im Laufe dessen der durch keine Schranke begrenzte Gelderwerb33 schließlich Konkurrenz und Konflikt provoziert sowie die Notwendigkeit, einen professionellen Kriegerstand einzurichten34. Ohne handelbare Überschüsse, ohne Nah- und Fernhandel, gibt es also keine Polis, so Platon. Die Marktmechanismen führen nach Platons Modell aber zur Differenzierung von Lebensstilen und Sozialniveaus, und dies gleicht nicht ein Markt aus, sondern Krieg und Gewalt. Dieses Selbstzerstörungsszenario soll die Notwendigkeit der Wächter als politischer Institution mit Erzwingungsgewalt demonstrieren, die dort Stetigkeit garantieren, wo sonst Konjunktur und Krise herrschten. Die Dynamik von Arbeitsteilung und Konkurrenz bedarf institutioneller Einhegung, weil von

28 Plat., Resp. 369b-373d. Der Gegenstand des Dialoges (Gerechtigkeit) wird in einem ersten Zugriff als Eigenschaft an den Transaktionen der Menschen bestimmt, als etwas, das Verkehr und Handel der Einwohner zukommt, Plat., Resp. 371e-372d. 29 Plat., Resp. 369b5ff.; 371b. 30 Jeder betreibt eine andere • •• • • •, •und • • •diese verrichtet er als Spezialist besser als ohne Arbeitsteilung. Vgl. Plat., Resp. 370c: • • • • • • • • • • • • • • • • • •••• • ••• •• • ••• • • • • • •• • •••••• • ••••••••• • • •••• • • • • •• • ••••• •••• • •• •••• ,• • • • • •••••••• • • • • ••• • • • • •• •• •• •• • •• •• •••• • •• • ••• • •• • •, • ••••• • • • •••• • • •• • • • • ••• •• • •• •, • • • • • • • • • •. • • • • • 31 371a-b. Für den Binnenhandel: Markt, Kleinhändler. Plat., Resp. 371b: • • • • • • •••••••••µ•• • •••• •••• • • •µ•• • •µ•• •• • •µ•• • • • • ••••••••• • •• • • • • • •••••••• • • • • • •••••• •• •• • • • •••••••••• •• •••• • • • • •. • • • • • 32 Kunstgewerbe, Schauspiel, Musik, Tanz, Medizin, vgl. Plat., Resp. 373b-d. 33 Plat., Resp. 373d (• • • •µ•• • • • •••••••• •••••••• • • • •• • •••••••• ). 34 373e-374d.

320

Burkhard Meißner

der Wirtschaft nicht prästabilisierte Harmonie, sondern katastrophale Antagonismen und politische Destabilisierung erwartet werden müssen35. b) Aristoteles: Auch Aristoteles behandelt die Ökonomie als Teil der politischen Philosophie in der Erwartung, nicht wirtschaftsinhärente, sondern politische Kompensations- und Kontrollmechanismen hätten wirtschaftliche Ungleichgewichte zu kompensieren. Aristoteles unterscheidet zwei Arten der Erwerbskunst: die verbreitete, für die Solons Zitat steht: Die Menschen kennen kein ausgesprochenes Maximum des Reichtums36, und eine den Gelderwerb nur als Mittel betrachtende Regierungslehre des Haushalts als Lebenskunst für den Oikosvorstand. Geld führt Aristoteles als Recheneinheit ein und als Mittel zur Transaktionskostenminimierung. Dank seiner kann der Handel ein Beruf, ein Metier von Spezialisten werden. Es bildet den Anlaß, durch Akumulation und Verarbeitung von Erfahrung (• • • • •• •• •)•••technische •••••• Methoden der Gewinnmaximierung im Interesse einer Kunst der Mehrung des Vermögens – wie für adlige Häuser charakteristisch – zu entwickeln37. Daher müßte anscheinend jedes Streben nach Reichtum eine Grenze besitzen; schauen wir jedoch auf die praktische Erfahrung, so beobachten wir das Gegenteil: Alle Wirtschaftssubjekte vermehren ihr Geld ins Unendliche38. Reichtum wird als höchstes Gut betrachtet: Sie machen aber alle Beschäftigungen zu Formen einer Erwerbskunst, die ihren Zielen alles andere unterordnet39.

35 Platon bringt nicht einen technisch-ökonomischen Skeptizismus zum Ausdruck, denn die Idee durch Gesetze beschränkter und darum lebensunfähig gemachter Techniken und Gewerbe ist den Interlokutoren des Politik ein Gräuel, Plat., Politic. 299b-e. 36 Arist., Pol. 1256b33f: • • • • • • • • • ••' ••• •• •• •• • • • • •µ•• • • • • • • •µ•• • •• ••• • •• • • • • •••••••• • • •• • ••••••• . Zur • • • • •• • •im • • Sinne • • • • einer grenzenlosen, nicht den Zwecksetzungen der Haushaltsführung unterworfenen Erwerbskunst: 1256b40ff. 37 Geld ist transportabel, gestempelte Münzen entheben den Händler der Notwendigkeit des Nachwiegens (Transaktionskostenminimierung), Arist., Pol. 1257a41-1257b6. Wertschwankungen des Geldes (Inflation, Deflation) werden en passant notiert, Arist., EN 1133b13-15. Der Vermögensmehrungslehre stellt Aristoteles die Vorstellung einer auf die Erfordernisse des Haushaltsregimentes relativierten praktischen Wirtschaftsklugheit gegenüber. Arist., Pol. 1257b10ff. Um des Lebens begründet, soll die menschliche Gemeinschaft das gute Leben befördern, 1257b41-1258a1: • • • •-•••• •••• • •. • • 38 Arist., Pol. 1257b32-34: • •• ••••••µ•• • ••• • •• • • • ••••••••• • • • • • • •• • •••••• •• ••••••• ••• •• • • • ••••••• • • • • • • • ••• • •• • ••••••• ,• • • •••• • • • • • • • • ••• • •µ•• • • • • • • • •µ•• ••• • • µ• • • • •• • • • • • • • • • • •• • ·• ••••• •• ••••••••••• • •••• • • • ••••• • • • • •• • • • • • • • • • • • •• • • •• •••••• • • • • •µ••• • •• • •µ•• • • •••••• • • •••• •µ•• • •µ•• •. Aristoteles beschreibt hier nicht die Maximierung marginaler Gewinne, sondern eine Tendenz zur grenzenlosen Vermögensmehrung durch permanente Erwirtschaftung von Überschüssen. 39 Arist., Pol. 1258a12-14: • •••• •••• • • • •••••• • • •• • • •••••••• • • • •µ•• • •• • •• • •••••••••• , • •••• • • • • ••••• • ••••••••• • • ,• • • • ••••• • • •••• ••••• • •••••• • • • • • • •••••• • ••••• •• • • • • •. • • • • • •

Modelle antiker Geldverkehrssysteme

321

Hier geht es40 um eine Kritik der sich entwickelnden Haushaltslehre: Einer ihrer Theorien zufolge gilt es nämlich als Prinzip, das Vermögen von Betrieb und Haushalt unter allen Umständen zu vermehren41. Diese Maxime sei, so Aristoteles, legitim in der Theorie, aber zu einfach zur Bewältigung des praktischen Lebens42. Zu dessen Anleitung buchstabiert er nur Teile jener Theorie durch; er skizziert dafür typische landwirtschaftliche Unternehmens- und Geschäftsformen, aber auch solche des Kreditgeschäfts sowie von Handel und Gewerbe, wie die am Seehandel beteiligten Schiffseigner, Lastenträger und Standverkäufer43. Ihre Geschäfte bezieht Aristoteles auf ein Marktmodell. Dies zeigt sich daran, wie er sie bewertet: Die Geschäftstypen unterscheiden sich voneinander darin, daß die einen größere Sicherheit bieten, die anderen aber mehr nach Zugewinn streben44. Es gilt also das Marktgesetz der Proportionalität von Risiko und Gewinnerwartung. Es kann rational sein, marginale Profite zu maximieren, doch von höchster technischer Raffinesse seien diejenigen Geschäftstypen, in denen Zufall die geringste Rolle spiele45: Von Wissen, Methode und der entstehenden Fachliteratur erhofft man sich eine Verstetigung von Risiken. Daher die Empfehlung für die Bereicherungstechnik (• • • µ• • • • •• • •• • •),• sich • • • •um • • ein Monopol (µ• • • • • • •• •) •zu •••••• 40 Es geht Aristoteles auch um die Begründung reichtumsunabhängiger Kriterien sozialer Stratifizierung: Der Vorsteher eines großen Hofes steht im Ansehen über dem Fernhändler, und dieser wiederum über dem Bankier. Nach dem Kriterium des Reichtum könnte diese Skala umgekehrt sein, Arist., Pol. 1258a19-1258b8. 41 Arist., Pol. 1257b36-40: Der einen Form des Erwerbs geht es um den Gebrauch, und zwar nicht an und für sich, sondern gerichtet auf ein weiteres Ziel; der anderen dagegen geht es um Vermehrung des Vermögens. Daher scheint einigen in dieser Vermehrung die Aufgabe der Hauswirtschaft zu liegen, und sie verleihen fortwährend der Ansicht Ausdruck, man solle das Geldvermögen bis ins Unendliche bewahren oder vermehren. Aristoteles besteht darauf, daß Vermögenswerte im praktischen Leben keine Selbstzwecke, sondern Mittel zur Verwirklichung eines guten Lebens seien und dazu gebraucht werden müßten. 42 Zur Anleitung der Praxis rekapituliert Aristoteles die Fülle aller Topoi der entstehenden Hausvaterliteratur; daher schneidet er die rein theoretisch-begriffliche Behandlung des Gegenstandes ab. Ein Durchmodellieren von Systemen verteilter Nutzenmaximierung unterbleibt daher. Arist., Pol. 1258b9-11: Da wir aber hinreichend denjenigen Teil unseres Gegenstandes abgegrenzt haben, der zum Bereich reiner Kenntnis gehört, soll konsequenterweise im folgenden derjenige behandelt werden, der sich auf den praktischen Gebrauch bezieht. Alle diese Phänomene besitzen im Zusammenhang der Theorie eine Vielzahl von Freiheitsgraden, unterliegen in der Praxis aber vielfältigen Zwängen. 43 Arist., Pol. 1258b22-23. 44 • •• • • • • ••••••••• • • • • • • • • • • • • •••• •• • • •••• • •• • • • • •• •••• • µ•• • • • • • • • • • • • • • • • •• • •• ••••••• ,• •• • • • • • • • • •• • • • • • • • • •• • •• •••••••••••••••••• • • • •• • ,• •Arist., • • • • •Pol. • • • 1258b23-25. Aristoteles kennt also ein Verhalten, das Gewinnmargen zu maximieren sucht, als eine Form wirtschaftlicher Rationalität; daneben gibt es die von ihm bevorzugte Bemühung um eine Begrenzung von Risiken. 45 Zu den sozialen Rangkriterien für Geschäftstätigkeiten gehört als einzig positiv formuliertes der Umgang mit dem spekulativen Risiko: Als sklavisch gilt, was nur physische Kraft beansprucht; vulgär ist, was den Körper schädigt, unehrenhaft, was der • • • • • •keinen • • • • Raum gibt: Arist., Pol. 1258b35-39: • •• ••••• • • • • • • • •• • • • • • ••••••••••••• µ•• • • • • • • • • • • •• • • • • • • • •••• • • •• • • • • • • • • • • • • • • • • •••••• , • • • • • • • • • • • ••••••••••••• • •' • • •••••••• • • •••• •µ•• • • •••••• • • • • ••••••••• µ• • •• • • •, • •• ••••••• • • • • • ••••••••••••• • • •••• • • • • • • • • • ••••• •µ•• • • ••••• • • • •• • • ••••••••• • • • • • ••••••••• , • • • • • •• • • • • ••••••••••••• • • •••• • • •••••••• •• • • • ••••••••• •• • •••••••• • • • • • • ••••••• .

322

Burkhard Meißner

bemühen46. Ein Wirtschaftssystem, in dem Risikobegrenzung Inbegriff wirtschaftlicher Rationalität ist, erwartet saisonale Konjunkturschwankungen, die größer sind als alle mittelfristigen Prosperitätsgewinne (s.o. III). Insofern ist das Verhalten, das Aristoteles empfiehlt, vernünftig im Sinne einer Kompensationsrationalität. c) Pseudo-Aristoteles: Im Anschluß an eine Einordnung der Hauswirtschaft in die Typologie der Herrschaftsformen zeichnen die pseudoaristotelischen Oeconomica Modelle je zweier klein- und großräumiger Wirtschafts- und Geldsysteme, um abschließend eine Sammlung anekdotischer Berichte über wirtschaftliche Strategeme gerade der Art zu bieten, die in den Politica des Aristoteles bereits angesprochen wurde47: Verbreitete Sammlungen ökonomischer Strategien und Rezepte, die nicht systematisch und geordnet, sondern als Wiedergabe verschiedenartiger praktischer Erfahrungen aus verstreuten Quellen zusammengetragen sind. Vier ökonomische Modelle unterscheidet der Autor also: die großkönigliche Zentralwirtschaft und als deren Relat die Wirtschaft der Satrapen; die Wirtschaft eines Stadtstaates und dazu passend den privaten Einzelbetrieb48. Das Modell beschreibt Entscheidungen auf Betriebsebene und Interaktionen zwischen KönigSatrap und Stadt-Betriebe, sowie deren Gemeinsamkeiten und Unterschiede49. Die vier Typen bzw. Modelle beschreiben zwei wirtschaftliche Systeme und deren Hierarchieebenen in vereinfachender Perspektive: Persien und Griechenland. Als Akteure betrachten die Modelle jeweils eine zentrale staatliche Einheit und die mit ihr interagierenden kleineren bzw. abhängigen Einheiten. Staat (Polis) und Nichtstaat (Betrieb) einerseits sowie König und Nichtkönig (Satrap) andererseits werden jeweils in einem System zusammengedacht.

46 Monopole seien zuweilen auch zur Staatsfinanzierung nützlich, Arist., Pol. 1258b39-1259a36. Selbst in spekulativer Absicht, d.h. auf Kredit, soll dies offenbar gelten. Auch Polybios lobt, wenn er Geschäftserfolge preist, eine Verstetigung der Einnahmen: durch den ptolemäischen Administrator Polykrates (XVIII 55,6), in den römischen Silberbergwerken bei Cartagena (XXXIV 9,8-11). 47 Arist., Pol. 1259a3-6: Auch die verstreuten Berichte darüber, wie einige bei der Maximierung ihrer Gewinne besonderen Erfolg gehabt haben, sollte man sammeln. Dieses Material ist nämlich insgesamt sehr nützlich für diejenigen, die die Kunst des Gelderwerbs hochschätzen, wie etwa die Geschichte über Thales von Milet. [Arist.], Oec. 1346a25-31: Das, was die Wirtschaft und deren Teile betrifft, haben wir dargelegt. Welche Anstrengungen aber einige früher unternahmen, um Geld zu verdienen, sofern sie auf technisch raffinierte Weise ein Geschäft betrieben: Was wir davon für erwähnenswert halten, haben wir zusammengestellt. Wir halten nämlich eine solche Forschung nicht für nutzlos. 48 [Arist.], Oec. 1345b13f.: • •• • • • •µ•• • • •••• • •• •• ••••• ••••• • • • • • • • ••••••••• , • •••• • •••• • • •• ••••• •• • • • •••••••••• (• • •••• •••••• • • • • •••••• • •••••• • • • • • •••µ •••• •• • • • • • •••••••••• • • • • • • •µ•• • •)·• • • • • •• •• • •, • • • • •• •• •• •• • •, • • • • •• • •••• • •, • • • • • • • •• •• • •• • •. •Zur • • •Charakterisierung ••• der Typen: Die großkönigliche Wirtschaft sei einheitlich und zentralisiert; vielgestaltig sei die Wirtschaft der Polis und die Bedürfnisbefriedigung in ihr anstrengungsarm; klein und sehr vielgestaltig seien die Privatbetriebe, [Arist.], Oec. 1345b14-16. 49 1345b16-18.

Modelle antiker Geldverkehrssysteme

323

Vier Geschäftsvorgänge (• •• • •) •kennt • • die großkönigliche Wirtschaft: Münzprägung (wieviele Münzen wann in welchen Stückelungen auszugeben sind); Einziehung von Ressourcen von den Satrapen, Verteilung von Gütern an sie, sowie Kauf und Verkauf auf dem offenen Markt50. Beschrieben werden administrative Entscheidungen spekulativer und investiver Natur über Quantitäten. Auf der Ebene der Satrapienwirtschaft unterscheidet der Autor 6 Geschäftsfelder nach Einkunftsarten: Tribute aus landwirtschaftlicher Produktion; Bergbau; Handelseinkünfte; Einkünfte aus Abgaben und Zöllen; Viehweide; Steuern und Zehntabgaben51; autonome Entscheidungen über Ausgaben sind in einem solchen Modell einer abhängigen Verwaltungswirtschaft vernachlässigbar. Der Satrap entscheidet als Teil eines Distributionssystems nur über wenige Investitionen; vor allem zieht er Gelder und Informationen ein, leitet weiter, usw. Unternehmerische Entscheidungen dagegen trifft die Zentrale. Auch im Modell der Stadtwirtschaft (• • • •• •• • •) •gibt • • •Pseudo-Aristoteles ••• nur Haupteinnahmequellen an: Bergbau und Metallgewinnung auf Staatsland, Marktabgaben, Transitzölle, jährlich verpachtete Steuern (1346a5-8). Als Einzelbetrieb wird eine Mannigfaltigkeit kleiner Organisationen betrachtet52, die alle, so der Autor, das Prinzip verfolgten, ihre Ausgaben nicht größer als die Einnahmen werden zu lassen. Er rechnet offenbar nur mit einem kleinen Kassenpuffer und geringen Möglichkeiten zur Kreditüberbrückung von Unterschüssen bei einem solchen Betrieb. Für Satrapie und Polis formuliert der Text Geschäftsmaximen und Optimierungsaufgaben: Zunächst sei festzustellen, ob die genannten Einkunftsarten verfügbar sind und genutzt werden können, sodann, welche möglicherweise verfügbar gemacht werden können, welche vergrößert werden können und welche Ausgabenarten schadlos verringert werden können53: Maximen für eine Modell-Stadt und einen Modell-Satrapen mit nur geringer unternehmerischer Funktion. Es gibt eine Asymmetrie in den beiden Doppelmodellen: Verstetigung der Einkünfte ist Maxime der Polis, also der großräumigeren Ordnung, aber auch der Satrapie, also der kleineren. Unternehmerische Entscheidungen schreibt das Modell dem Großkönig zu, also der großräumigeren Organisation, andererseits aber dem Einzelbetrieb. Platon modelliert also einen autonomen Differenzierungsprozeß, an dessen Ende ein Bedürfnis nach Schutz und Frieden steht, das jener Prozeß verletzt und dessen Erfüllung politischer Einhegung der Wirtschaft bedarf; Aristoteles model50 1345b19-28. 51 [Arist.], Oec. 1345b28-1345a5. 52 1346a8-16, bes. 9-10: Diese Wirtschaftsform ist verschiedengestaltig, weil sie nicht nur auf ein einziges Ziel hin wirtschaften kann. 53 1346a17-24: Nachdem wir die Klassifikationen unserer Gegenstände angegeben haben, müssen wir anschließend in Erfahrung bringen, ob die Satrapie oder die Polis, mit denen wir es zu tun haben, alle oder die wichtigsten Einkunftsarten, die wir aufgeführt haben, einbringen kann... Anschließend geht es darum, welche Einkünfte, die zur Zeit gar nicht existieren, man möglicherweise erzielen kann, und welche kleinen Einkünfte man potentiell vergrößern kann, und welche Ausgaben unter den gegenwärtigen Aufwendungen in welcher Höhe entfallen können, ohne daß Schaden im ganzen eintritt.

324

Burkhard Meißner

liert das durch Erfahrung und Technik optimierbare Verhalten von Akteuren auf Güter- und Kreditmärkten und sieht in Risikominimierung die entscheidende Optimierungsaufgabe. Stetige Einkünfte und die Bemühung um Ausgabenminimierung schreibt Ps.-Aristoteles Poleis und Satrapen zu, spekulative Entscheidungen dem persischen Großkönig und jedem kleinen griechischen Privatbetrieb. Das pseudoaristotelische Modell überhöht den Gegensatz zwischen Griechenland und Persien als Gegenstand der ökonomischen Theorie. Die Pointe der Modelle liegt zunächst in der sokratischen Technik- und Sophistenkritik: Technisierung und Verwissenschaftlichung wirtschaftlichen Handelns führen zu Arbeitsteilung, Effizienz und Gewinnmaximierung, nicht aber zur Autonomie gegenüber den irrationalen Antagonismen der egoistischen Akteure des Wirtschaftslebens. Zwischen den Wirtschaftssubjekten vermittelt nicht nur ein Marktmechanismus, sondern letztlich der politische Austausch im Medium der Sprache: In Tausch und Handel begründete Konflikte und Ungleichgewichte behebt nicht das Wirtschaftssystem selbst; über sie wird politisch und rechtlich entschieden54. Andererseits erfassen Platon, Aristoteles und der unter seinem Namen die Wirtschaft behandelnde Autor modellhaft und generalisierend verschiedene Einheiten des Wirtschaftens sowie deren Entscheidungen über Geld und Güter. Eine Mentalität stetiger Bereicherung setzen sie als Tatsache voraus und als Bedingung funktionaler Differenzierung und zivilisatorischen Fortschrittes, um das Konzept einer praktischen Lebenskunde zur Einhegung der Welt des Wirtschaftens zu entwerfen, weil diese Autoren eine autonome Bereicherungstechnik als Realität, aber zugleich als Gefahr betrachten. Weit jedoch davon entfernt, nur statische und gewinnfeindliche Vorstellungen zu artikulieren, bezeugen sie das fieberhafte Durchdenken der Ökonomie im 4. Jahrhundert, dem offenbar enorme Bereicherungserwartungen entsprachen. Sie geben die quantitativen Bezugsgrößen für Entscheidungen der Akteure ihrer Modelle an, ohne diese Bezugsgrößen am empirischen Material aber durchzurechnen: Dafür fehlten die Voraussetzungen einer modernen Wirtschaftsstatistik. Pseudo-Aristoteles’ zwei Modelle der Wirtschaft einer griechischen Stadt (Staat-Betrieb) und des persischen Königreiches (König-Satrap) geben ein Beispiel dafür, wie im Medium der Wirtschaftstheorie kulturelle Differenzen und unterschiedliche Lebensformen modellhaft überzeichnet werden. Die zwei Modellsysteme mit ihren vier Modellakteuren überhöhen den Gegensatz zwischen Orient und Okzident zum Gegensatz zwischen wirtschaftlicher Selbst- und Fremdbestimmung. In dem dem frühen Peripatos noch direkter verpflichteten ersten Buch des pseudonymen Werkes heißt es, eigeninteressierte Selbstbestimmung sei effizienter als verwaltungswirtschaftliche Fremdbestimmung55, und 54 R.Bubner, Polis und Staat. Grundlinien der politischen Philosophie, Frankfurt/M. (2002) 5260. 55 [Arist.], Oec. 1344b30-1345a1: Aller Besitz sollte genau klassifiziert sein, und es sollte mehr produktives als unproduktives Kapital vorhanden sein, und Investitionen sollten so vorgenommen werden, daß wir nicht alles auf einmal riskieren. Für Lagerhaltung und Besitzsicherung sind die persischen oder spartanischen Systeme sinnvoll. Die attische Betriebswirtschaft aber

Modelle antiker Geldverkehrssysteme

325

dafür gelten das Überwundensein des persischen Systems und die Effizienz attischer Kleinbetriebe als Belege. Einerseits Apologie der Überlegenheit der griechischen Freiheit und des Marktes, beschreiben Pseudo-Aristoteles’ Modelle andererseits zutreffend wesentliche Kategorien für die Entscheidungen der Wirtschaftssubjekte, die in quantifizierenden Modellen zu berücksichtigen sind: Einnahmen des Staates an Sachen und Geld sowie Kassenhaltung der Betriebe; Einziehung von Sachmitteln und Geld durch den König von den Peripherieinstanzen, Zuweisung von Sachmitteln an sie, Ausmünzen von Edelmetall sowie Kauf und Verkauf auf dem Markt durch den König. VI.

Zusammenfassung

Dieser Beitrag hat auf Modelle antiker Geldwirtschaft hingewiesen, weil sie zeigen, daß es bei aller Hypothetik lohnend sein kann, Funktionen und Quantitäten antiker Wirtschaften anhand von Modellen zu beschreiben. Es wurde außerdem auf Modellvorstellungen für komplexere Wirtschaftstatbestände bei Platon, Aristoteles und im Peripatos hingewiesen, um zu zeigen, daß diese Anregungen geben können für eine Bestimmung der Bezugsgrößen und Maximen derjenigen Entscheidungen, die Funktionsmodelle oder quantifizierende Modelle von den wirtschaftlichen Akteuren voraussetzen müssen. Antike Wirtschaftslehren können, wo sie Regeln wirtschaftlichen Handelns und ökonomischer Rationalität reflektieren, zur Präzisierung oder Bereicherung moderner Modelle beitragen, auch wenn jene den Anforderungen moderner Wirtschaftstheorien nicht genügen und die Wirtschaft insgesamt nicht als abgeschlossenes, sich selbst stabilisierendes System betrachten. Wirtschaftliche Teilsysteme (Betrieb, Staat, königliche Verwaltungswirtschaft) und wesentliche Aspekte ihrer Interaktion und Entwicklung werden gleichwohl abstrakt beschrieben. Die allgemeine Überzeugung von einem im 4. Jahrhundert v.Chr. in Griechenland verbreiteten Bereicherungsstreben, Ps.-Aristoteles' Überlegungen zur Kassenhaltung attischer Kleinbetriebe oder die Entscheidungen von König/ Satrap über Geld- und Warenwirtschaft, aber auch die Eigen- und Fremdwahrnehmung als Wirtschaftssubjekt oder -objekt und die Vorstellung von der Kontakt und Gemeinschaft begründenden Funktion des Handels bieten dann wichtige Anregungen, wenn nicht modernistische gegen primitivistische Modelle ausgespielt, sondern wirtschaftlicher Austausch unter der Perspektive kultureller Interaktion betrachtet werden soll, wie im Rahmen des Melammu-Projektes.

ist effizient: Man kauft unmittelbar mit den Erträgen seiner Verkäufe, und die kleinen Betriebe betreiben keine Kassen- oder Lagerhaltung. Zum persischen System dagegen gehörte es, daß der Unternehmer selbst alles anordnete und überwachte, so wie Dion es betreffs Dionysios bemerkte. Niemand verwaltet fremden Besitz mit derselben Sorgfalt wie eigenen: Daher sollte, soweit möglich, jeder persönlich für seine eigenen Angelegenheiten verantwortlich sein.

326

Burkhard Meißner

Summary The paper describes some recent attempts at modelling hellenistic and Roman economies und a quantitative perspective. There has been much argument about the validity of such modelling, when it comes to the ancient world. However, it is held that they can, and in fact do contribute to our knowledge of ancient economic systems. The circulation of money in particular, can be understood much better with the help of models like the one which Aperghis has outlined for Seleucid Mesopotamia and Beyer for the Roman Empire. In its second part, the paper studies some ancient Greek models of economic systems and economic development. It is argued that some of these contemporaneous representations of ancient economic systems can contribute to our knowledge of the ancient economy in that they allow to identify those functions, quantities, developments and interactions which the agents were themselves conscious of.


    

 


    
  

   

   



   
   
    !"

 )UGHQU|PLVFKHQ2VWKDQGHOGHUKRKHQ.DLVHU]HLWLQVEHVRQGHUHGHV-KVQ &KUZDUGLH5HJLRQDP0LWWOHUHQ(XSKUDWXPGLH6WDGW'XUD(XURSRVYRQKHU DXVUDJHQGHU%HGHXWXQJ 'HQQGLHVHV*HELHWVWHOOWHHLQH =RQHGDULQGHU HLQXQ PLWWHOEDUHU.RQWDNW]ZLVFKHQ5RPGHPYRQ5RPDEKlQJLJHQ3DOP\UDXQGGHP 3DUWKHUUHLFK]XVWDQGHNDP$EHLQHPEHVWLPPWHQ3XQNWLQQHUKDOEGLHVHV$UUHDOV YHUOLH‰HQGLH+lQGOHUVFKHLQEDUU|PLVFKHV±RGHUYRQ5RPPLWWHOEDUNRQWUROOLHU WHV±7HUULWRULXPXPGXUFKSDUWKLVFKHV*HELHW]XGHQ6WlGWHQ9RORJHVLD6HOHXNHLD %DE\ORQVRZLH]XGHQ+lIHQGHU&KDUDNHQH6SDVLQX&KDUD[XQG)RUDWZHLWHU]X UHLVHQYRQZRHLQH6FKLIIVYHUELQGXQJPLWGHQ+lIHQ,QGLHQVJHJHEHQZDU  'HU +DQGHOGHURIIHQEDUHLQH%OWH]HLWXQWHUGHQ.DLVHUQ+DGULDQXQG$QWRQLQXV3LXV HUOHEWH   VFKHLQW ZHLWJHKHQG GXUFKSDOP\UHQLVFKH +lQGOHU RUJDQLVLHUW XQG DEJH ZLFNHOWZRUGHQ]XVHLQLQGHUHQ+lQGHQDXFKGHU:HLWHUWUDQVSRUWGHULQGLVFKHQ :DUHQDQV0LWWHOPHHUJHOHJHQKDEHQGUIWH   hEHU GLH 5RXWHQ GLH GLH SDOP\UHQLVFKHQ .DXIOHXWH HLQVFKOXJHQ LVW OHLGHU ZHQLJ EHNDQQW 9RQ JUR‰HU %HGHXWXQJ VFKHLQW GHU :HJ YRQ 3DOP\UD GXUFK GDV :ƗGƯ ¬DXUƗQ QDFK +ƯW DP (XSKUDW JHZHVHQ ]X VHLQ Ã6GURXWHµ  'LHVHU VWHOOWH ]ZDU GLH JHRJUDSKLVFK ÃGLUHNWHµ 9HUELQGXQJ LQ 5LFKWXQJ DXI GLH &KDUDNHQH GDU ZDU DEHU JOHLFK]HLWLJ GHU OlQJVWH :HJ GXUFK GLH :VWH ]XP )OX‰ (LQH ]ZHLWH NU]HUH9HUELQGXQJ]XP(XSKUDWVFKHLQWHV]ZLVFKHQ3DOP\UDXQG'XUD(XURSRV 73

37

73

73

37

37

73

37



 (LQH HUZHLWHUWH 9HUVLRQ GHV DQOl‰OLFK GHU ,QQVEUXFNHU 0HODPPX7DJXQJ YRUJHVWHOOWHQ %HL WUDJHVNRQQWHLFKDPLPDOWKLVWRULVFKHQ)RUVFKXQJVNROORTXLXPDQGHU+XPEROGW 8QLYHUVLWlW]X%HUOLQ]XU'LVNXVVLRQVWHOOHQ0HLQKHU]OLFKHU'DQNJLOWGHQ9HUDQVWDOWHUQXQG 7HLOQHKPHUQEHLGHU9HUDQVWDOWXQJHQLQVEHVRQGHUHGHQ+HUUHQ3URIHVVRUHQ55ROOLQJHU&K 8OI - :LHVHK|IHU XQG : 1LSSHO VRZLH +HUUQ 'U 8 +DUWPDQQ +HUUQ 'U 0 +HLO XQG +HUUQ3URI(.HWWHQKRIHQGDQNHLFK]XGHP IUKLOIUHLFKH .ULWLNDXIEULHIOLFKHP:HJH$OOH KLHUYRUJHEUDFKWHQ$QVLFKWHQVLQGPHLQHHLJHQHQ  9JOGLHhEHUVLFKWEHUGLHSDOP\UHQLVFKHQ.DUDZDQHQLQVFKULIWHQGLHZLFKWLJVWH4XHOOHQJUXS SHEHL*DZOLNRZVNLXQG*DZOLNRZVNL%DE\ORQ3$7YRQQ&KU 6HOHX NHLDXQNODULVWZHOFKH6WDGWKLHUPLWJHPHLQWLVWP|JOLFKHUZHLVHGLHSDUWKLVFKH5HVLGHQ]DP 7LJULV 3$7YRQQ&KU )RUDWLP-K YJO3$7'LH3DOP\UHQHUEH VD‰HQRIIHQEDUHLJHQH6FKLIIHGLH]ZLVFKHQGHU&KDUDNHQHXQGÄ6N\WKLHQ³1RUGZHVWLQGLHQ  SHQGHOWHQ9JO3$7YRP0lU]3$7  1HEHQ GHU 9LHO]DKO GHU SDOP\UHQLVFKHQ .DUDZDQHQLQVFKULIWHQ DXV GLHVHU =HLW *HEKDUGW  VSULFKWKLHUIUDXFKGLH$XVIRUPXQJYRQ=ROOEHVWLPPXQJHQGLHHWZDGXUFKGDV LP-DKUHEHVFKORVVHQH6WHXHUJHVHW]YRQ3DOP\UDID‰EDUZLUG3$7 9JO+DUWPDQQ *DZOLNRZVNLD:LOO  =XPU|PLVFKHQ)HUQKDQGHODOOJHPHLQ5DVFKNHEHVRQGHUV]XGHPEHU6\ULHQ'UH[KD JH  6FKXRO  
7



$QGUHDV/XWKHU

JHJHEHQ]XKDEHQÃ2VWURXWHµ   $X‰HUGHPLVWQLFKWXQZDKUVFKHLQOLFKGD‰ZHLWH UH 9HUELQGXQJHQ ]X DQGHUHQ 3XQNWHQ GHV (XSKUDW7DOHV H[LVWLHUWHQ   'DV 7DO VHOEVW ZDU HLQ QDWUOLFKHU 9HUELQGXQJVZHJ (LQHUVHLWV LVW LQ SDUWKLVFKU|PLVFKHU =HLW HLQH 6WUD‰HQYHUELQGXQJ EH]HXJW GLH ZRKO KDXSWVlFKOLFK DXI GHP V\ULVFKHQ 8IHU GHV )OXVVHV YHUOLHI   $QGHUHUVHLWV ZDU GHU )OX‰ VFKLIIEDU XQG GUIWH VRPLW VHOEVWYRQJUR‰HU%HGHXWXQJIUGHQ:DUHQYHUNHKUJHZHVHQVHLQ)UGHQ0LWWOH UHQ(XSKUDWZDUHQP|JOLFKHUZHLVHQRFK]ZHLZHLWHUH5RXWHQZLFKWLJ(LQHUVHLWV HLQH ]ZDU IU GLH NODVVLVFKH $QWLNH QLFKW EH]HXJWH DEHU GRFK DQ]XQHKPHQGH 1RUG6G9HUELQGXQJ GXUFK GDV 7DO GHV &KDERUDV$EXUD £ƗEnjU  GHU EHL GHQ 2UWVFKDIWHQ3DOLJDXQG1DEDJDWDZRKOGHPVSlWHUHQ&LUFHVLXP LQGHQ (XSKUDW PQGHWH   %HL GHP KHXWLJHQ 2UW 7DOO âƝÌ ¬DPDG DP 8QWHUHQ£ƗEnjU DQ GHVVHQ 6WHOOHRGHULQGHVVHQQlKHUHU 8PJHEXQJZRKOGDVDQWLNH0DJGDOD JHOHJHQKDW   VFKHLQW DQGHUHUVHLWV HLQH 2VW:HVW5RXWH GDV £ƗEnjU&KDERUDV7DO JHNUHX]W ]X KDEHQGLHYRP)OX‰%DOỨEHU+DWUDELVQDFK$VVXUJHIKUWKDEHQPDJ  +LHUEHL N|QQWH HV VLFK XP HLQHQ =ZHLJ GHU Ã6HLGHQVWUD‰Hµ JHKDQGHOW KDEHQ GLH YRQ GHU *HJHQG YRQ $VVXU DXV LQ GDV LUDQLVFKH +RFKODQG XQG ZHLWHU QDFK =HQWUDODVLHQ IKUWH   'D HV ZDKUVFKHLQOLFK YRQ GHU 0QGXQJ GHV £ƗEnjU&KDERUDV LQ GHQ (XSKUDWHLQH9HUELQGXQJQDFK3DOP\UDEHUGHQ$E]ZHLJQDKHGHU:VWHQVWDWLRQ 73

37

73

73

73

37

37

37

73

73

73

  

37

37

37

3RLGHEDUG'LUYHQ'LUYHQ (LQHUVHLWVH[LVWLHUWHHLQH 5RXWHYRQ3DOP\UD QDFK6XUDÃ1RUGURXWHµ 9JO+DUWPDQQ PLW$QP 'HQNEDUXQGYLHOIDFKDQJHQRPPHQLVW]XGHPHLQH9HUELQGXQJ]ZLVFKHQ 3DOP\UDXQGGHU0QGXQJGHV£ƗEnjU&KDERUDVLQGHQ(XSKUDWEHLGHQ2UWVFKDIWHQ3K DOLJD XQG1DEDJDWK1DEDJDWDVX  6R,VLGRUYRQ&KDUD[)*U+LVW)(LQHVROFKH9HUELQGXQJZLUGDXFKLPSOL]LHUWGXUFK GHQ%HJOHLWEULHIIUGHQSDUWKLVFKHQ*HVDQGWHQ*RFHVYRQFD3'XUD% LQGHPGLH 2UWHDP(XSKUDWJHQDQQWZHUGHQGLH*RFHVDXIGHP+HLPZHJYRQ$QWLRFKLHQDXV" SDVVLH UHQVROOWH9JO/XWKHU  'LHHQJH$QELQGXQJGHU5HJLRQDP8QWHUHQ£ƗEnjU&KDERUDVDQGDV*HELHWYRQ'XUDZLUG DXFKGXUFKGLHQHXHQ'RNXPHQWHYRP0LWWOHUHQ(XSKUDWQDKHJHOHJW)HLVVHOHWDO 9JOIUGLH6WUD‰HQLQDVV\ULVFKHU=HLW5DGQHU=XU*HRJUDSKLHGHV0QGXQJVJH ELHWVXQGGHU/DJHYRQ1DEDJDWDXQG3K DOLJD/XWKHU&KDXPRQW$UQDXG =DKOUHLFKH)RUVFKHUQHKPHQP(LUULJHUZHLVH DQGD‰3K DOLJDDQGHU6WHOOHGHV VSlWHUHQ&LUFHVLXPJHOHJHQKDEH*DZOLNRZVNLE,VDDF$QP*QROL   9JO.KQHXQG/XWKHU/XWKHUD1RYiNHWDO,;XQG/XWKHU 1RYiNXQG
    
  )UHLQH/DJHYRQ+DWUDDQGLHVHU6WUHFNHSOlGLHUW




'XUD(XURSRV

2UHVDJDEKHXWH¢D\\LEHK   ZDUEHUGLH.UHX]XQJEHL0DJGDODQLFKWQXUGHU 0LWWOHUH(XSKUDWVRQGHUQDXFK3DOP\UDDQGLHVH6WUHFNHDQJHEXQGHQ :HOFKH 5ROOH 'XUD(XURSRV LQGHV LP 5DKPHQ GHV EHUUHJLRQDOHQ +DQGHOV VSLHOWHLVWQLFKWPLWOHW]WHU6LFKHUKHLW]XEHVWLPPHQ'LH6WDGWODJZLHZLUVDKHQ DQGXUFKDXVJQVWLJHU6WHOOHIUGHQSDOP\UHQLVFKHQ,QGLHQKDQGHOGHQQKLHUZDU YRQ 3DOP\UD DXV GHU VFKQHOOVWH =XJDQJ ]XP (XSKUDW7DO P|JOLFK XQG VRPLW GLH 1XW]XQJGHV:DVVHU7UDQVSRUWV0*DZOLNRZVNLEUDFKWHYRUZHQLJHQ-DKUHQGLH hEHUOHJXQJLQV6SLHOGD‰'XUDHLQHZLFKWLJH)XQNWLRQIUGLHSDOP\UHQLVFKHQ.D UDZDQHQ DOV 6WDSHOSODW] DXI GHP Ã+LQZHJµ QDFK &KDUD[ EHVHVVHQ KDEHQ N|QQWH ZHLOYRQKLHUDXVGHUEHTXHPH:HLWHUWUDQVSRUWSHU6FKLIIHLQHQVFKQHOOHQ:DUHQ YHUNHKUHUP|JOLFKWKlWWH)UGHQ5FNZHJZlUHHVMHGRFKDXIJUXQGGHU6FKZLH ULJNHLWHQGHV7UDQVSRUWHVIOX‰DXIZlUWVQ|WLJJHZHVHQDEGHU6WDGW+ƯWGHQ.DUD ZDQHQZHJ QDFK 3DOP\UD GXUFK GDV :ƗGƯ ¬DXUƗQ ]X QXW]HQ   6R N|QQH 'XUD ZHQLJVWHQV IU HLQHQ 7HLO GHU 6WUHFNH ZLFKWLJ IU GHQ )HUQKDQGHO JHZHVHQ VHLQ 'DJHJHQ KDW LQ MQJHUHU =HLW / 'LUYHQ KHUYRUJHKREHQ GD‰ 'XUD IU 3DOP\UD QLFKWQXUDOV+DOWHSXQNWGHUSDOP\UHQLVFKHQ.DUDZDQHQVRQGHUQDXFKDOV3DUWQHU LP ORNDOHQ +DQGHO YRQ %HGHXWXQJ JHZHVHQ VHLQ NDQQ   ,KU +DXSWDUJXPHQW LVW KLHUEHLGDV)HKOHQYRQ1DFKULFKWHQGLHHLQVFKOlJLJEHUGLH%HWHLOLJXQJGHU'X UHQHUVRZLHGHUGRUWDQVlVVLJHQ3DOP\UHQHUDP)HUQKDQGHOEHULFKWHQ$OOHUGLQJV LVW DQ]XPHUNHQ GD‰ GLH JULHFKLVFKHQ XQG SDOP\UHQLVFKHQ ,QVFKULIWHQ DXV 'XUD QLFKWQXUNHLQHUOHL5FNVFKOX‰DXIGHQ )HUQKDQGHO]XODVVHQVRQGHUQDXFKNHLQH 'DWHQ EHU HLQHQ VROFKHQ ORNDOHQ +DQGHO ]ZLVFKHQ 'XUD XQG 3DOP\UD JHEHQ   'LHVSlUOLFKHQ,QIRUPDWLRQHQEHU:LUWVFKDIWXQG:DUHQDXVWDXVFKEH]LHKHQVLFK OHGLJOLFKDXIGLHQlKHUH8PJHEXQJYRQ'XUDQLFKWDEHUDXI3DOP\UD9RQ]HQWUD OHU :LFKWLJNHLW VLQG KLHU GLH ,QVFKULIWHQ DXV GHP +DXV GHV GXUHQLVFKHQ .DXI PDQQV 1HEXFKHORV DXV GHP  -DKUKXQGHUW DXV GHQHQ ]X HUIDKUHQ LVW GD‰ VHLQH 7lWLJNHLWDXIGLHXPOLHJHQGHQ2UWVFKDIWHQNRQ]HQWULHUWZDU  0HKUIDFKZLUGKLHU GHU 1DPH GHV 2UWHV $SDGDQD$SKSKDGDQD JHQDQQW GHU ZRKO LP %HUHLFK GHU 0QGXQJ GHV £ƗEnjU&KDERUDV LQ GHQ (XSKUDW ]X VXFKHQ LVW   'DMHGHQIDOOV GLH 1DFKULFKWHQ EHU GLH $NWLYLWlWHQ GHU GXUHQLVFKHQ .DXIOHXWH PHKU RGHU ZHQLJHU ]XIlOOLJDXIXQVJHNRPPHQVLQGEOHLEWGLH0|JOLFKNHLWGD‰VLFKGDV%LOGGXUFK QHXH)XQGHUHODWLYLHUHQN|QQWH,PPHUKLQLVWDEHUGLH$QQDKPHQDKHOLHJHQGGD‰ 73

37

73

73

37

37

73

73

37

37

73

37

  6RGLH$QQDKPHYRQ3RLGHEDUG9JO,VDDFPLW0DS,,6WRQHPDQ   *DZOLNRZVNLD9JO'LUYHQ  'LUYHQ    ÄD FRPELQDWLRQ RI ERWK³  'LUYHQ   =XP 3UREOHP GHU YLHOIDFKYHUWUHWHQHQ&KDUDNWHULVLHUXQJ'XUDVDOVHLQHUÃ.DUDZDQHQVWDGWµ5XIILQJE PLWZHLWHUHU/LWHUDWXU   'LHVJLEW'LUYHQVHOEVW]XÄ7KHUHLVQRHYLGHQFHIURP'XUD(XURSRVZKLFKXQHTXLYR FDOO\SURYHVWKDWWKLVFLW\ZDVLQYROYHGLQWKHFDUDYDQWUDGHQRULVWKHUHDQ\SURRIIRUFRP PHUFLDODFWLYLWLHVEHWZHHQERWKFLWLHVDWDORFDOOHYHO³  )U HLQH ZLUWVFKDIWVJHVFKLFKWOLFKH $XVZHUWXQJ GHU 1HEXFKHORV'DWHQ 5XIILQJ  )U HLQH$XVZHUWXQJGHUDXV'XUDEHUOLHIHUWHQ3UHLVDQJDEHQ5XIILQJE  6(* 1U!" VRZLH!"## =XUXPVWULWWHQHQ/RNDOL VLHUXQJYRQ$SSDGDQD/XWKHU*QROL*QROLEHV 9JO)HLVVHOXQG*DVFRX*DVFRX)HLVVHOXQG*DVFRX





$QGUHDV/XWKHU

GLH$QZHVHQKHLWYRQ3HUVRQHQIUHPGHU+HUNXQIWLQ'XUDYRUQHKPOLFKLP.RQWH[W YRQ +DQGHOVEH]LHKXQJHQ ]X VHKHQ LVW (LQH JU|‰HUH *UXSSH YRQ 3DOP\UHQHUQ VFKHLQWVFKRQYRUGHU=HLWHQZHQGHLQ'XUDDQVlVVLJJHZHVHQ]XVHLQVX 6LFKHU UHLFKWHQGLH.RQWDNWHGHU'XUHQHULQQDFKFKULVWOLFKHU=HLWDXFKLQGDV*HELHWYRQ $VVXU XQG +DWUD GD LQ 'XUD 7H[WH LQ QRUGRVWDUDPlLVFKHU 6FKULIW JHIXQGHQ ZXU GHQ   =XGHP LVW IU GDV -DKU  Q &KU GLH $QZHVHQKHLW HLQHU *UXSSH YRQ 9HUHKUHUQ GHV *RWWHV $SKODG EH]HXJW GHU DXV $QDWKD ÄVWDPPWH³ HLQHU FD  NPHXSKUDWDEZlUWVLPKHXWLJHQ,UDNJHOHJHQHQ6WDGW   ,P IROJHQGHQ ZROOHQ ZLU QLFKW GLH 5ROOH GHU 5HJLRQ YRQ 'XUD(XURSRV LP )HUQKDQGHO GHU SDUWKLVFKU|PLVFKHQ =HLW XQWHUVXFKHQ VRQGHUQ XQV YLHOPHKU GHU )UDJH QDFK GHQ 5DKPHQEHGLQJXQJHQ IU GHQ )HUQKDQGHO LQ GLHVHP *HELHW ]X ZHQGHQ6SH]LHOOLVWGHUSROLWLVFKH6WDWXVGHU6WDGW'XUD(XURSRVLP6SDQQXQJV IHOG ]ZLVFKHQ 5RP XQG GHQ 3DUWKHUQ YRQ ,QWHUHVVH GHU LQVEHVRQGHUH IU GDV  QDFKFKULVWOLFKH -DKUKXQGHUW 3UREOHPH DXIZLUIW ,Q GLHVHP =XVDPPHQKDQJ PX‰ YRUDOOHPGLH3UlVHQ]GHU3DOP\UHQHULQ'XUDQHXEHOHXFKWHWZHUGHQ     1DFKDOOJHPHLQHU$QVLFKWILHOGLHHKHPDOVVHOHXNLGLVFKH0LOLWlUNRORQLH'XUD (XURSRV  ZlKUHQGGHVU|PLVFKSDUWLVFKHQ.ULHJHVGHUXQWHUGHU5HJLHUXQJGHU EHLGHQ NDLVHUOLFKHQ Ä%UGHU³ 0DUF $XUHO XQG /XFLXV 9HUXV JHIKUW ZXUGH LQ U|PLVFKH+lQGHVSlWHVWHQVLP-DKUHDOVGHUU|PLVFKH)HOGKHUU$YLGLXV&DV VLXVQDFK=HQWUDOXQG6GPHVRSRWDPLHQYRUVWLH‰  (LQGUFNOLFKVWHU%HOHJKLHU IU LVW GD‰ HLQ $  YRQ 'XUD QDPHQV $XUHOLXV +HOLRGRUXV GHP .DLVHU /XFLXV9HUXVJHVWRUEHQ$QIDQJ HLQH6WDWXHHUULFKWHWH  ,QZHOFKHU)RUPGLH (UULFKWXQJGHU U|PLVFKHQ+HUUVFKDIWHUIROJWHLVWMHGRFKZHLWJHKHQGXQVLFKHU ,Q )UDJH NlPH HQWZHGHU HLQH (LQJOLHGHUXQJ LQ U|PLVFKHV 3URYLQ]LDOJHELHW RGHU DEHU HLQHORVHUH)RUPYRQ$EKlQJLJNHLWGHU6WDGWZLHLP)DOOHYRQU|PLVFKHQ.OLHQ WHOVWDDWHQGLHXQWHUPDVVLYHPU|PLVFKHP(LQIOX‰VWDQGHQ:lKUHQGHLQ7HLOGHU )RUVFKHU LP )DOO YRQ 'XUD GDV (UJHEQLV PLW YRUVLFKWLJHQ :RUWHQ IRUPXOLHUW ) 73

37

73

73

37

37

73

37

73

37

  9JO%H\HU$XFKDP£ƗEnjU&KDERUDVZXUGHQLQ]ZLVFKHQ7H[WHLQQRUGRVWDUDPlLVFKHU 6FKULIWJHIXQGHQ5|OOLJ  9JO0LOODU0LOODUE  =XU *HVFKLFKWH XQG .XOWXU 'XUDV /HULFKH  1DFK /HULFKH   KDW VLFK GLH 6WDGWZHUGXQJ'XUDVLQ]ZHL6FKULWWHQYROO]RJHQ(UVWXPGLH0LWWHGHV-DKUKXQGHUWVY&KU VFKHLQWGLH6LHGOXQJQDFKGHPKLSSRGDPLVFKHQ*UXQGSODQQHXJHVWDOWHWXQGPLWHLQHU0DXHU XPJHEHQ ZRUGHQ ]X VHLQ 1DKHOLHJHQG LVW KLHU HLQ =XVDPPHQKDQJ PLW GHU DOOJHPHLQHQ 6FKZlFKXQJGHU6HOHXNLGHQKHUUVFKDIWLPPHVRSRWDPLVFKLUDQLVFKHQ5DXPLP-DKUKXQGHUW GLH LQ GHU (UREHUXQJ 0HVRSRWDPLHQV GXUFK GLH 3DUWKHU ]ZLVFKHQ  XQG FD   NXOPL QLHUWH  =XP.ULHJ$QJHOL%HUWLQHOOL0LOODU9JO6FKPLWW  6(*    1U  YJO &XPRQW   1U  " % & '()$ *+ " %& ,

 & $- "&& %  .&   &$  )U\H HW DO   %H]HLFKQHQG LVW GHU *HQWLOQDPH $XUHOLXV +HOLRGRU NDQQ HUVW NXU] ]XYRU U|PL VFKHU%UJHUJHZRUGHQVHLQIUHXQGOLFKHU+LQZHLVYRQ'U0+HLO 





'XUD(XURSRV

0LOODUÄ'XUDSDVVHGXQGHU5RPDQ5XOH³   VFKHLQHQDQGHUH*HOHKUWHDQ]XQHK PHQ GD‰ 'XUD UHJHOUHFKW YRQ 5RP DQQHNWLHUW ZXUGH   GHPQDFK ]X U|PLVFKHP 3URYLQ]LDOJHELHW QlPOLFK ]XU 3URYLQ] 6\ULD JHVFKODJHQ ZXUGH +LHUIU JLEW HV MHGRFKOHLGHUVHKUZHQLJH+LQZHLVH(UVWDEGHQHU-DKUHQLVWGLH3UlVHQ]UHJX OlUHUU|PLVFKHU7UXSSHQLQ'XUDEH]HXJWQDPHQWOLFKGHUFRKRUV,,8OSLD(TXLWD WD   'RFK GLHV EHOHJW QLFKW ]ZLQJHQG GLH =XJHK|ULJNHLW ]XU V\ULVFKHQ 3URYLQ] VX =X%HJLQQGHV-DKUKXQGHUWVWULWWGRUW]XGHPHLQHU|PLVFKH$X[LOLDUWUXS SHYRQ3DOP\UHQHUQLQ(UVFKHLQXQJGLHFRKRUV;;3DOP\UHQRUXP  ZREHLEHWRQW ZHUGHQPX‰GD‰SDOP\UHQLVFKH0LOL]LRQlUHEHUHLWVIUKHUGRUWEH]HXJWVLQG±HLQ 8PVWDQGDXIGHQZLUXQWHQPHKUIDFK]XVSUHFKHQNRPPHQZHUGHQ9RP%HJLQQ GHV  -DKUKXQGHUWV VWDPPHQ DXFK GLH HUVWHQ DXVGUFNOLFKHQ +LQZHLVH DXI HLQH =XJHK|ULJNHLWGHU6WDGW]XUU|PLVFKHQ3URYLQ]6\ULD&RHOH  )HVW]XKDOWHQLVWGHU HUVWDXQOLFKH 8PVWDQG GD‰ HLQH VR EHGHXWHQGH )HVWXQJ ZLH GLH YRQ 'XUD GLH GLH JU|‰WH6WDGWGHV0LWWOHUHQ(XSKUDW7DOHVZDUXQGGHUHQ%HVLW]GLH.RQWUROOHGHV JHVDPWHQ5DXPHVXPGLH0QGXQJGHV£ƗEnjU&KDERUDVLQGHQ(XSKUDWXQGHLQHV ZHLWHQ$EVFKQLWWVGHV(XSKUDW7DOHVJHZlKUOHLVWHWKDEHQGUIWHXQPLWWHOEDUQDFK GHU U|PLVFKHQ (UREHUXQJ LQ GHQ HU -DKUHQ QLFKW GXUFK UHJXOlUH U|PLVFKH 7UXSSHQJHVLFKHUWZRUGHQ]XVHLQVFKHLQW  =XU.OlUXQJGHU)UDJHQDFKGHP6WDWXV'XUDVQDFKFDWUlJWQXQHLQHLQ GHU)RUVFKXQJP:EHUVHKHQH1DFKULFKWEHL,Q3'XUD%GHU.RSLHHLQHVLQ GLH=HLWXPGDV-DKUQ&KU]XGDWLHUHQGHQ'RNXPHQWV  ZLUGHLQQDPHQW 73

37

73

73

37

37

73

73

73

37

37

37

73

37

  0LOODU   XQG  GHXWOLFKHU DOOHUGLQJV  Ä)URP WKH V RQZDUGV ZKHQ 'XUD ZDVRFFXSLHGE\WKH5RPDQVLWZRXOGEHORQJWRWKHSURYLQFHRI6\ULD³ 9JO,VDDF 'LUYHQÄ'XULQJWKHILUVWIRUW\\HDUV5RPDQSUHVHQFHZDVPRGHUDWH³   6DUWUHÄDQQH[LRQ³ 6FKPLWWÄ(LQEH]LHKXQJYRQ'XUD(XURSRVLQGLH V\ULVFKH3URYLQ]³ 9JO=LHJOHU6FKXRO+DUWPDQQ$QP 6DUWUH  %DXUXQG5RVWRYW]HIIXQWHU&RPPRGXVQDFK 5RVWRYW]HII1U IUGDV-DKU 'LHVHFRKRUVZDUEHUHLWVLP.ULHJGHUHU-DKUHEHWHLOLJWYJO,/6 *HEKDUGW  9JO:HOOHVHWDO  3'XUDXQGYRQFDGLHGHQ/HJDWHQ0DULXV0D[LPXVHUZlKQHQ9JO:HOOHVHWDO   :lKUHQG ]XPHLVW DQJHQRPPHQ ZLUG GD‰ GLH SDOP\UHQLVFKHQ 0LOL]7UXSSHQ VSlWHU LQ HLQH UHJXOlUH U|PLVFKH (LQKHLW XPJHZDQGHOW ZXUGHQ ]XPDO VLH HUVW DE GHP -DKUH  EH]HXJW VLQG3'XUD$:HOOHVHWDO YHUPXWHWH'/.HQQHG\DXIJUXQGGHU5HNUX WLHUXQJVVWUXNWXU GHU FRKRUV ;; 3DOP\UHQRUXP GD‰ VLH EHUHLWV EHL GHU U|PLVFKHQ (LQQDKPH YRQ'XUDJHELOGHWZRUGHQVHL.HQQHG\$OOHUGLQJVZLVVHQZLUQLFKWVGDYRQ GD‰GLHFRKRUV;;VFKRQVHLWGHQHU-DKUHQLQ'XUDODJJHVFKZHLJHGHQQGDYRQGD‰VLH LQ 'XUD JHELOGHW ZXUGH $XFK DXIJUXQG GHU (UZlKQXQJ GHV 7LWHOV HLQHV Ä6WUDWHJHQ³ VX  EOHLEWGLH$QQDKPHZDKUVFKHLQOLFKHUGD‰GLHLQ'XUDXPEH]HXJWHQ%RJHQVFKW]HQ$Q JHK|ULJHGHUORNDOHQSDOP\UHQLVFKHQ0LOL]ZDUHQ9JO*HEKDUGW0LOODU   :HOOHVHWDOXQG'LHVEHOHJHQGLH1DPHQGHULP7H[WJHQDQQWHQ3HUVRQHQLQ $ZLUG+HOLRGRURVJHQDQQW $ -& - ($ 

 )GHULQGHP 'RNXPHQW 3'XUD  YRP )HEUXDU  HUZlKQW ZLUG ,Q % ZHUGHQ DOV =HXJHQ E]Z$UFKLYEHDPWH ]XGHPHLQ2O\PSRV6RKQGHV/\VLDVVRZLHHLQ$UWHPLGRURV6RKQGHV 7KHRGRURV JHQDQQWGLHEHLGHHEHQIDOOVLQ3'XUDDXIWDXFKHQ





$QGUHDV/XWKHU

OLFK XQEHNDQQWHU 6RKQ HLQHV 6HOHXNRV HUZlKQW GHV 6RKQHV GHV 7KHRPQHVWRV   'LHVHU EHVD‰ RIIHQEDU QRFK ZHLWHUH %HLQDPHQ YRQ GHQHQ HLQHU HLQ 7LWHO ZDU 3'XUD %      /
 $ 0& 1  ( 
 2 2 2 & 3   $
#)  $XV GHU (QGXQJ (++)  KDEHQGLH+HUDXVJHEHUGHV7H[WHVVLFKHU]X5HFKW (+++ $
 #) HUJlQ]WGHQQGLHVLVWHLQHUHJXOlUHXQGLQKHOOHQLVWLVFKHQ'RNXPHQ WHQKlXILJDXIWUHWHQGH%H]HLFKQXQJ  ,Q'XUDWDXFKWVLHPHKUIDFK]XVDPPHQPLW GHP 7LWHO #% DXI HWZD LQ GHU 9HUELQGXQJ  4  %  - 

%  #%  -   $
#  RGHU QXU DOV   $
#   ZLH LQ 3'XUD  XQG  YRQ  Q &KU 3'XUD  YRQ  Q &KU 3'XUD  YRP -XQL  Q &KU RGHU 3'XUD  YRQ  Q &KU RGHUDXFKLQ,QVFKULIWHQ   1XQLVWMHGRFKJHUDGHGLHVH%H]HLFKQXQJHLQSDUWKL VFKHU+RI7LWHOXQGVFKHLQWLQ'XUDVRQVWQXULQSDUWKLVFKHU=HLWDXI]XWUHWHQ'LH +HUDXVJHEHUGHUÃ3DUFKPHQWVDQG3DS\ULµDXV'XUD&%:HOOHV52)LQNXQG -) *LOOLDP YHUPHUNHQ KLHU]X OHGLJOLFK GD‰ LQ GHU IUKHQ U|PLVFKHQ =HLW GLH SDUWKLVFKHQ+RI7LWHOQRFKYHUZHQGHWZRUGHQVHLHQ  -HGRFKLVWGLH(UZlKQXQJ HLQHVÃ6RPDWRSK\OD[µLPU|PLVFKHQ'XUDGHU-DKUHQDFKFDPHKUDOVPHUN ZUGLJ GHQQ HLQ SDUWKLVFKHU +RI7LWHO LVW LQ HLQHU U|PLVFKHQ 3URYLQ]6WDGW IHKO DP3ODW]]XPDOHVVLFKKLHUEHLXPGDVHLQ]LJH%HLVSLHOIUGDVÃU|PLVFKHµ'XUD KDQGHOQZUGH0:JLEWHV]XGHPNHLQH3DUDOOHOIlOOHIUGLH9HUZHQGXQJGHUDU WLJHU KHOOHQLVWLVFKHU +RI7LWHO LQ U|PLVFKHU =HLW .DQQ HV VLFK KLHU HLQIDFK XP HLQHQ7LWHOKDQGHOQGHUGDV(QGHGHU3DUWKHU]HLWDXVWUDGLWLRQHOOHQRGHUQRVWDOJL VFKHQ*UQGHQEHUOHEWKDW"'LHVLVWZHQLJZDKUVFKHLQOLFKGHQQPLWGHU/RVO| VXQJ'XUDVYRQSDUWKLVFKHU+HUUVFKDIWKlWWHDXFKHLQH%HHQGLJXQJGHVÃSHUV|QOL FKHQµ9HUKlOWQLVVHV]ZLVFKHQ0RQDUFKXQG3KLORVHLQKHUJHKHQPVVHQ0DQPDJ HLQZHQGHQ GD‰ GLH 1HQQXQJ XQG $QZHVHQKHLW HLQHV VROFKHQ SDUWKLVFKHQ :U GHQWUlJHUVLPPLWWOHUZHLOHU|PLVFKHQ'XUDDQVLFKQLFKWV%HVRQGHUHVZlUH$OOHU GLQJVLVWHVJHUDGHQLFKWGHU)DOOGD‰HVVLFKKLHUXPHLQHQDXVZlUWLJHQ*DVWKDQ GHOW VRQGHUQ GHU 6RKQ GHV 6HOHXNRV ZDU YLHOPHKU HLQ %UJHU GHU 6WDGW 'XUD 73

73

73

37

37

37

73

37

  'HU LQ HLQHU ,QVFKULIW YRQ  HUZlKQWH 6HOHXNRV 6RKQ GHV 7KHRPQHVWRV VFKHLQW GHU 9DWHUGHV8QEHNDQQWHQYRQ3'XUD%]XVHLQ5RVWRYW]HIIHWDO1U  5 *6& &/
 $&  !"&07   3 &   &   8 9  &     & 9 
  &        & ()#  $

 'HU*HQLWLY3OXUDO(++) VFKOLH‰WDQGHUHGHQNEDUH(UJlQ]XQJHQHWZDJD]RSK\OD[RGHU FKUHRSK\OD[ SUDNWLVFKDXV  (WZDLQGHU,QVFKULIW6(* 1UYJO&XPRQW1U ZRKODXVGHP -DKUHQ&KU 5:;6+&*$*$&  & $&& - - $&  

 &  -  4 &  %   - 

%   #   - &   $ (
)&&#     6WDWW 5 :;6  VHO    LVW ZRKO 5 :<6  VHO    ]X OHVHQ GD HLQHUVHLWV LQ GHQ 'XUD,QVFKULIWHQ GLH %XFKVWDEHQ <XQG;YLHOIDFKJUR‰HbKQOLFKNHLWKDEHQDQGHUHUVHLWVHLQ6WUDWHJH/\VLDVLP

-DKUHJHVWRUEHQLVW)U\HHWDOXQG1U XQGLQGHQHU-DKUHQNHL QH$PWVSHUVRQGLHVHV1DPHQVEHNDQQWLVW  :HOOHVHWDOÄ(DUO\LQWKH5RPDQSHULRGZHILQGWKH3DUWKLDQFRXUWRUGHUVVWLOOLQ XVH³ 'LUYHQ





'XUD(XURSRV

(XURSRV HLQ 0   'DV )RUWEHVWHKHQ VWlGWLVFKHU 9HUZDOWXQJVVWUXNWXUHQ KHOOHQLVWLVFKHU 3UlJXQJ LVW KLQJHJHQ LQ 'XUD WDWVlFKOLFKELV LQ U|PLVFKH=HLWEH ]HXJW ZLH GLH (UZlKQXQJ GHU 3HUVRQHQ GLH GDV $PW HLQHV $ - - $  

   RGHU OHGLJOLFK GDV HLQHV $   EHNOHLGHWHQ QDKHOHJW  'DV7UDJHQU|PLVFKHU1DPHQEHL%UJHUQGHU6WDGW'XUDZLHLP)DOOH GHV$XUHOLXV+HOLRGRUXVDXVGHQHU-DKUHQPX‰LPEULJHQQLFKW]ZLQJHQGDXI HLQH]XYRUHUIROJWH(LQYHUOHLEXQJGHU6WDGWLQU|PLVFKHV6WDDWVJHELHWKLQZHLVHQ GD DXFK HWZD U|PLVFKH .OLHQWHON|QLJH RGHU DQGHUH %UJHU ]XPHLVW DEKlQJLJHU 6WDDWHQPLWGHPU|PLVFKHQ%UJHUUHFKWJHHKUWZRUGHQVLQG  ,FKYHUPXWHGD‰ZLUHVKLHUPLWHLQHQNRQNUHWHQ+LQZHLVDXIGHQ6WDWXVGHU 6WDGW 'XUD(XURSRV QDFK GHP .ULHJ YRQ  ]X WXQ KDEHQ 'HQQ EHGHQNW PDQGHQ8PVWDQGGD‰ H U V W H Q V  DXV'XUDYRUGHU6HYHUHU]HLWNHLQHUOHL+LQZHL VHDXIHLQH=XJHK|ULJNHLW]XHLQHUU|PLVFKHQ3URYLQ]H[LVWLHUHQGD‰] Z H L W H Q V  DEHUSDUWKLVFKH +RI7LWHO XP  QRFK LQ GHU 6WDGWLQ *HEUDXFK ZDUHQ XQG GD‰ G U L W W H Q V  QDFKFDSDOP\UHQLVFKHXQGU|PLVFKH7UXSSHQLQ'XUDODJHQVR EHVWHKW GLH P( QDKHOLHJHQGH /|VXQJ LQ GHU $QQDKPH GD‰ 'XUD QDFK FD  QRPLQHOOSDUWKLVFKHV*HELHWEOLHE]XQlFKVWVFKHLQWGLH6WDGWGXUFKHLQH$EWHLOXQJ SDOP\UHQLVFKHU %RJHQVFKW]HQ NRQWUROOLHUW ZRUGHQ ]X VHLQ GLH DOV $QJHK|ULJH GHV 5|PLVFKHQ 5HLFKHV LQGLUHNW GLH U|PLVFKHQ 6LFKHUKHLWVLQWHUHVVHQ YHUWUDWHQ   GDQQMHGRFKZRKOVSlWHVWHQVVHLWGHQHU-DKUHQGXUFKUHJXOlUHU|PLVFKH7UXS SHQ   :HQQ HUVWH +LQZHLVH DXI HLQH =XJHK|ULJNHLW 'XUDV ]X 6\ULD &RHOH  HUVW DXVGHP-DKUHVWDPPHQVRLVWHVQDKHOLHJHQGGLH(LQJOLHGHUXQJGHU*HJHQG LQ U|PLVFKHV 3URYLQ]LDOJHELHW PLW GHQ )HOG]JHQ GHV 6HYHUXV LQ 9HUELQGXQJ ]X EULQJHQ ,P =HLWUDXP GHU -DKUH  ELV FD  IKUWHQ VLH ]XU (LQULFKWXQJ GHU 3URYLQ]HQ 2VUKRHQD   XQG 0HVRSRWDPLD   ,Q GLHVHU =HLW GUIWH DXFK GDV XQWHUH7DOGHV)OXVVHV£ƗEnjU&KDERUDV]X6\ULD&RHOHJHVFKODJHQZRUGHQVHLQ   XQG KLHUEHL YLHOOHLFKW DXFK GHU EHQDFKEDUWH $EVFKQLWW GHV 0LWWOHUHQ (XSKUDW PLW GHU)HVWXQJVVWDGW'XUD(XURSRV 73

37

73

73

37

73

37

73

37

37

73

37

  /HULFKHXQG(Op$MMLXQGhEHUVLFKWPLW%HOHJHQ PLWGHUQHXJH IXQGHQHQ (KUHQLQVFKULIW IU 
 "  *$ & $ - - $  

 &   YRQ FD  LELG   (LQ ]ZHLWHV %HLVSLHO LVW GHU $ 6HSWLPLXV /\VLDVLELG$QIDQJ-K 9JO )U\HHWDO$U QDXGVLHKWLQGLHVHQ$PWVWUlJHUQLQSDUWKLVFKHU=HLWÄXQRIILFLHUUR\DOSOXVTX¶XQ PDJLVWUDWPXQLFLSDO³9RUVLFKWLJGDJHJHQ0LOODUEÄFDXWLRQ³   %UDXQG  9JO:HOOHVHWDOÄ6WLOOWKHVH3DOP\UHQHV\PPDFKLDULLPD\EHUHJDUGHGDVEHORQJ LQJWRWKH5RPDQJDUULVRQ³   'DV$XIWUHWHQGHUFRKRUV,,8OSLDNDQQZLH'U0+HLOYRUVFKOXJPLWHLQHUEOR‰HQ5HRUJD QLVDWLRQGHUPLOLWlULVFKHQ6WUXNWXUHQ]XVDPPHQKlQJHQHWZDQDFKGHP-DKUHLQGHU)RO JH GHU $XVHLQDQGHUVHW]XQJHQ XP GLH 3HUVRQ GHV $YLGLXV &DVVLXV EULHIOLFKH 0LWWHLOXQJ YRP  ,QGLHVHOEH5LFKWXQJPDJDXFKGLHYRQ.HQQHG\SRVWXOLHUWH5HRUJDQLVDWLRQGHU FRKRUV;;3DOP\UHQRUXPLQ'XUDXPGHXWHQ.HQQHG\  &DVVLXV'LR;LSK([F8 * S ;LSK([F9DO S 6+$6HY$e1U HUVWH1HQQXQJGHU3URYLQ]2VUKRHQD  9JODOOJHPHLQ6FKPLWW $QJHOL%HUWLQHOOL=LHJOHU   *DVFRX/XWKHUG 3



3



$QGUHDV/XWKHU

:DVGLH3UlVHQ]YRQ3DOP\UHQHUQLQ'XUDDQJHKWVRKDWVLHHLQHODQJH7UDGL WLRQ'LHHUVWHSDOP\UHQLVFKH,QVFKULIWGDWLHUWDXVGHP-DKUHY&KU  3DOP\ UHQLVFKH %RJHQVFKW]HQ GLH PDQ DOV 7HLOH HLQHU Ã0LOL]µ HUNOlUW KDW ZHOFKH GLH 6LFKHUXQJ GHU +DQGHOVZHJH SDOP\UHQLVFKHU .DXIOHXWH JHZlKUOHLVWHQ VROOWH   VLQGLQ'XUDMHGRFKHUVWIUGLH]ZHLWH+lOIWHGHV-KVEH]HXJW6LFKHUGDWLHUWH %HOHJHVWDPPHQDXVGHQ-DKUHQXQGQ&KUDOVRQDFK(QGHGHV.ULH JHVXQWHU9HUXV  ZHQQJOHLFKGRUWP|JOLFKHUZHLVHDXFKVFKRQYRUKHUSDOP\UHQL VFKH6ROGDWHQODJHQVX $X‰HULP)DOOH'XUDVOLHJHQDXVGHUVSlWHQ$QWRQLQHQ XQGDXVGHU6HYHUHU]HLW=HXJQLVVHIUSDOP\UHQLVFKHPLOLWLDHRGHU$X[LOLDUHLQKHL WHQDXFKIUDQGHUH2UWHGHV(XSKUDW7DOHVYRU6RVLQG5HLWHUHLQHUÃ(LQKHLWµYRQ *DPOƗXQGǥƖQƗLQHLQHU,QVFKULIWDXVGHU=HLWQDFKQ&KUEH]HXJW  P|JOL FKHUZHLVH DOVR QRFK YRU GHP KLHU YHUWUHWHQHQ 'DWXP GHU 3URYLQ]LDOLVLHUXQJ GHV *HELHWV DP 0LWWOHUHQ (XSKUDW %HLGH 2UWH ǥƖQƗ JULHFKLVFK $QDWKD  XQG *DPOƗ EHIDQGHQVLFKYRQ'XUDDXVIOX‰DEZlUWVLPKHXWLJHQ,UDN  'DUEHUKLQDXVLVWHLQH XQGDWLHUWH 7HVVHUD DXV 3DOP\UD EHOHJW GLH GLH SDOP\UHQLVFKH $XIVFKULIW 4â7¶ %<57¶VLF WUlJWÄ%RJHQVFKW]HQ>YRQ@%LUWKD³   =XPLQGHVWLQGHU6HYHUHU ]HLWDOVLQ'XUDGLHSDOP\UHQLVFKHQ%RJHQVFKW]HQGXUFKGLHFRKRUV;;3DOP\ UHQRUXPHUVHW]WZRUGHQZDUHQVLQGQDFK$XVVDJHGHULQ'XUDJHIXQGHQHQ5HVWH GHUURVWHUV$QJHK|ULJHGLHVHU(LQKHLWLQHLQHP%LUWKDEH]HXJW  'RFKNlPHQIU GLH,GHQWLILNDWLRQYRQ%<57¶%LUWKDPLQGHVWHQV]ZHL2UWHLQ)UDJHGDVZRKODP 8QWHUHQ£ƗEnjU&KDERUDVLQGHU8PJHEXQJYRQ7DOOâƝ̬DPDGJHOHJHQH%LUWKD $VSRUDNX  VRZLHGDVELVODQJQLFKWORNDOLVLHUWH%LUWKD2NEDQRQGDVYLHOOHLFKWDP (XSKUDW ODJ   8QGDWLHUWH SDOP\UHQLVFKH 6FKULIWIXQGH VLQG LP EULJHQ LP 2UW %LÍƗQ VG|VWOLFK YRQ $QDWKD  ]XWDJH JHWUHWHQ GRFK GHXWHW GHU )XQGNRQWH[W RI IHQEDU DXI GLH 6HYHUHU]HLW   :HQQJOHLFK VLFK DXV GHQ %HOHJHQ NHLQ NODUHV %LOG IUGLH=HLWYRUGHQ2VWIHOG]JHQGHV6HSWLPLXV6HYHUXVHUJLEWEOHLEW]XPLQGHVW GLH0|JOLFKNHLWGD‰]ZLVFKHQFDXQGQLFKWQXULPSDUWKLVFKHQ'X UD VRQGHUQ YLHOOHLFKW DQ ]ZHL RGHU GUHL ZHLWHUHQSDUWKLVFKHQ 2UWHQ GHV (XSKUDW 73

37

73

73

37

73

73

73

37

37

37

73

73

37

37

37

73

37

73

37

  3$7  +DUWPDQQ9JO]XUSDOP\UHQLVFKHQ0LOL]:LOO0? ?@"[email protected]" '.51 ¢% ǥ%'¶731<¶6¢5>¢@*¶%5=%'ǥ+'<ǥ/4⢶'<%':5¶%<5¬¶'5â17 XQG 1U  9  <9 >VLF@  $ :   - 0   ?  & $ - 5;6C   3$7  ¶4<0 /+ 35â<¶ %¶%5>¶@  '< *0/¶ :ǥ1¶ (LQH ZHLWHUH LQ GDV -DKU  Q &KU GDWLHUWH ,QVFKULIW QHQQW HLQHQ SDOP\UHQLVFKHQ Ä6WUDWHJHQ YRQ ǥƖQƗ XQG *DPOƗ³ 3$7 ¶6¢5¢*ǥ/ǥ1¶:*0/¶  =X$QDWKDLQGHUNODVVLVFKHQ=HLW1RUWKHGJHHWDO9JO3ROODUG  3$7'XQDQW1U0LOLN  :HOOHVHWDO  9JO/XWKHUD  %HLGH 2UWH ZHUGHQ LQ GHQ ,QVFKULIW âƗKEXKUV , DQ GHU .D¶EH\H =DUGRãW HUZlKQW +X\VH †>PS,SD,JU,@ %LUWKD2NEDQRQ]XGHPLQ3(XSKU9JO.HWWHQKRIHQ /XWKHUD*QROLXQG*QROLXQG  *DZOLNRZVNLD*DZOLNRZVNLE





'XUD(XURSRV

£ƗEnjU*HELHWHV SDOP\UHQLVFKH 7UXSSHQ ODJHQ GLH GLH 6LFKHUXQJ GHV 7DOHV LP U|PLVFKHQ6LQQHRGHU$XIWUDJEHUQDKPHQ  (LQGUFNOLFKHU LVW LQGHV HLQ 9HUJOHLFK PLW EHQDFKEDUWHQ *HELHWHQ GHV U| PLVFKSDUWKLVFKHQ *UHQ]UDXPHV (LQH lKQOLFKH 6LWXDWLRQ ZLH GLH LQ 'XUD SRVWX OLHUWH VFKHLQW ]XU VHOEHQ =HLW LQ 1RUGPHVRSRWDPLHQ YRUJHOHJHQ ]X KDEHQ GHQQ EHUHLWVYRUGHQ2VWIHOG]JHQGHV6HYHUXVEHIDQGHQVLFKRIIHQEDUU|PLVFKH7UXS SHQ LQ GHU 6WDGW1LVLELV|VWOLFK YRQ (GHVVD  RKQH GD‰ ZLU GHQ 6WDWXV GHU 6WDGW QlKHUIDVVHQN|QQHQ  9RQHLQHU=XJHK|ULJNHLWHWZD]XPZHVWOLFKDQJUHQ]HQGHQ XQGLQGLHVHU=HLWYRQ5RPDEKlQJLJHQ.|QLJUHLFK2VUKRHQHLVWQLFKWVEHNDQQW P|JOLFKHUZHLVHZDU1LVLELVGHPSDUWKLVFKHQ.|QLJGLUHNWXQWHUWDQ ,P .OLHQWHO N|QLJUHLFK $UPHQLHQ LP *HELHW YRQ .DLQHSROLV VLQG IU GLH HU -DKUH U|PL VFKH7UXSSHQEH]HXJW  GLHGRUWRIIHQEDU]XU6LFKHUXQJGHU+HUUVFKDIWGHVU|PL VFKHQ3URWpJpV6RKDHPXVVWDWLRQLHUWZDUHQZHOFKHULP-DKUHHLQJHVHW]WZRU GHQZDUDEHUEHUHLWVYRUHUQHXWIUNXU]H=HLWYHUWULHEHQZXUGH  ,Q+DWUDLQ 1RUGRVWPHVRSRWDPLHQ LVW ZLHGHUXP XQWHU *RUGLDQ ,,,   GLH 3UlVHQ] HL QHUU|PLVFKHQ(LQKHLWEH]HXJWGHUFRKRUV;,0DXURUXP*RUGLDQD  ZHQQJOHLFK +DWUD ]XU VHOEHQ =HLW YRQ HLQHP HLQKHLPLVFKHQ .|QLJ UHJLHUW ZXUGH   0|JOL FKHUZHLVH JLEW HV DXFK DXI GHU DUDELVFKHQ +DOELQVHO 3DUDOOHOHQ   (V LVW LQ DOOHQ GLHVHQ)lOOHQDQ]XQHKPHQGD‰GLHU|PLVFKHQRGHULPU|PLVFKHQ6LQQHDJLHUHQ GHQ 7UXSSHQVRZRKOGHQ6FKXW]DOVDXFKGDV:RKOYHUKDOWHQGHU|UWOLFKHQ'\QDV WHQVLFKHUVWHOOHQVROOWHQXQGGD‰GLH)ROJHHLQHIDNWLVFKH$EKlQJLJNHLWGHUEHWUHI IHQGHQ *HELHWH YRQ 5RP JHZHVHQ LVW +LHUEHL LVW GDYRQ DXV]XJHKHQ GD‰ GLH EHWUHIIHQGHQORNDOHQ.|QLJHRGHU)UVWHQHQWZHGHUGLHU|PLVFKH2EHUKRKHLWDQ HUNDQQW KDEHQ RGHU DEHU ZHQLJVWHQV HLQ $UUDQJHPHQW H[LVWLHUWH GDV GLHEHVHW]WH 5HJLRQXQWHUU|PLVFKHU.RQWUROOHKLHOW,P-DKUHY&KUHWZDZXUGHQDFKGHP 73

73

37

37

73

37

73

73

37

37

73

73

37

37

  :HLWJHKHQG XQVLFKHU EOHLEW ELVODQJ RE VFKRQ LQ GLHVHU =HLW DQ DQGHUHQ 2UWHQ GHV (XSKUDW 7DOHVSDOP\UHQLVFKHRGHUU|PLVFKH*DUQLVRQHQODJHQ'LH)HVWXQJHQVG|VWOLFKYRQ$QDWKD OLHIHUQHUVWIUGDV-K$XIVFKOX‰EHUU|PLVFKH%HVDW]XQJHQ,QGHUEHGHXWHQGHQ=LWDGHOOH YRQ.LIUƯQHWZDFDNPYRQ$QDWKDHQWIHUQWVFKHLQWHLQHHUVWH%HIHVWLJXQJDXVGHP-K ]XVWDPPHQGRFKVFKHLQWGLHVHSDUWKLVFKRGHUÄLQGLJHQ³]XVHLQYJO/LSSROLV   'LR([F8 * S 9JO.HQQHG\3ROODUG  ,/6XQG$QJHOL%HUWLQHOOL$QP0LOODU  &KDXPRQW  $e  1U  0|JOLFKHUZHLVH ODJ GLHVH $EWHLOXQJ VFKRQ XQWHU $OH[DQGHU 6HYHUXV GRUW,QVFKULIWYRP-XQL 9JODOOJHPHLQ+DXVHU3ROODUG  ,QVFKULIWHQ+DWUDXQGYJO%H\HU   $Q GHU :HQGH ]XP  -DKUKXQGHUW VFKHLQHQ DXFK 7HLOH $UDELHQV MHQVHLWV GHV .HUQJHELHWHV GHU3URYLQ]$UDELDYRQU|PLVFKHQ7UXSSHQSDWURXLOOLHUWZRUGHQ]XVHLQ%HL'XPDWDFD NPYRQGHU2DVH$]UDTLQVG|VWOLFKHU5LFKWXQJHQWIHUQW­DZI6DXGL$UDELHQ KDWHLQFHQ WXULRGHUOHJLR,,,&\UHQDLFDHLQH,QVFKULIWDXIHLQHP$OWDUKLQWHUODVVHQGLHZRKODXVGHU=HLW ]ZLVFKHQXQGVWDPPW+LHUDOOHUGLQJVPDJHVIOLH‰HQGHhEHUJlQJHEHLGHU.RQWUROOH GXUFK5RPJHJHEHQKDEHQ'LHP|JOLFKH=XJHK|ULJNHLWGHV)XQGRUWHV]XU3URYLQ]$UDELDZLUG DOOHUGLJVQRFKGLVNXWLHUW%RZHUVRFN6SHLGHO:HLWHUHZLFKWLJH=HXJQLV VHVWDPPHQHWZDDXV0DGƗ¶LQ6ƗOHÃ*UDIILWLU|PLVFKHU7UXSSHQ RGHUDXV5XZZƗIDK%LOLQ JXHGHU7KDPXGHQRLEHUGHQ%DXHLQHV7HPSHOVIUGHQ.DLVHUNXOW LQ6DXGL$UDELHQYJO 0LOODU 3



3



$QGUHDV/XWKHU

)HOG]XJGHVlJ\SWLVFKHQ3UlIHNWHQ&RUQHOLXV*DOOXVJHJHQGLH0HURLWHUGHUQ|UG OLFKH7HLOGHV.|QLJUHLFKHVYRQ0HURHXQWHUHLQHQYRQ5RPHLQJHVHW]WHQ'\QDV WHQJHVWHOOWXQGGXUFKU|PLVFKH*DUQLVRQHQJHVLFKHUWJOHLFK]HLWLJZXUGHPLWGHP .|QLJYRQ0HURHHLQ)UHXQGVFKDIWVYHUKlOWQLVEHJUQGHW   ,PHLQ]HOQHQZHUGHQ MHZHLOVVSH]LHOOH5HJHOXQJHQJHIXQGHQZRUGHQVHLQ-HGHQIDOOVOl‰WVLFKIU'XUD (XURSRVQDFKFDDQDORJYHUPXWHQGD‰DXFKHLQ7HLOGHUZHVWOLFKHQ*HELHWH GHV 3DUWKHUUHLFKHV XP GLH 6WDGW 'XUD YLHOOHLFKW PLW HLQHP EHWUlFKWOLFKHQ $E VFKQLWWGHV(XSKUDW7DOHVELV]XU6WDGW$QDWKDGLUHNWRGHULQGLUHNWGXUFK5RPNRQ WUROOLHUW ZXUGH DEHU HEHQ ZHLWHUKLQ IRUPDO LP SDUWKLVFKHQ 5HLFKVYHUEDQG YHUEOLHE $OOHUGLQJV PX‰ HLQH GHUDUWLJH 5HJHOXQJ QLFKW EHGHXWHW KDEHQ GD‰ GHU SDUWKLVFKH .|QLJ JHQHUHOO GLH 2EHUKRKHLW 5RPV DQHUNHQQHQ PX‰WH 'DUDXI GD‰ KLHUHLQ.RPSURPL‰JHIXQGHQZXUGHGHXWHWDXFKGHU8PVWDQGGD‰HVHEHQ]X QlFKVWSDOP\UHQLVFKH7UXSSHQZDUHQ±XQGQLFKWUHJXOlUHU|PLVFKH(LQKHLWHQ± GLH GLH 6LFKHUXQJ EHUQDKPHQ +LHU N|QQWH DXI %HILQGOLFKNHLWHQ GHV 3DUWKHUN| QLJV 5FNVLFKW JHQRPPHQ ZRUGHQ VHLQ ,QZLHIHUQ GLHVHU DX‰HUKDOE GHV 3ROLWL VFKHQ WDWVlFKOLFK ZHLWHUKLQ DP 0LWWOHUHQ (XSKUDW XQG LQ 'XUDSUlVHQW ZDU HWZD LP%HUHLFKGHV6WHXHUZHVHQVRGHUGHU5HFKWVSUHFKXQJEOHLEWXQVLFKHU 'HUU|PLVFKH(LQIOX‰LQ'XUDVHOEVWQDFKFDOl‰WVLFKDQYHUVFKLHGHQHQ 4XHOOHQIHVWPDFKHQ'LH ,QVFKULIWGHV$XUHOLXV+HOLRGRUXV]X(KUHQGHV.DLVHUV 9HUXV KDEHQ ZLU EHUHLWV HUZlKQW =XGHP ZXUGH EHUHLWV LQ GHQ HU -DKUHQ LQ ORNDOHQ'RNXPHQWHQDXV'XUDQDFKGHQU|PLVFKHQ.RQVXOQXQG.DLVHUQGDWLHUW ,Q3'XUDHWZDZLUGGDV'DWXP)HEUXDU QDFKGHQ.RQVXOQ%UXWWLXV3UDH VHQV XQG ,XOLXV 9HUXV VRZLH QDFK GHQ 5HJLHUXQJVMDKUHQ GHU .DLVHU 0DUF $XUHO XQG&RPPRGXVDQJHJHEHQQLFKWDEHUQDFKGHPSDUWKLVFKHQ.|QLJXQGGHU$UVD NLGHQlUD'RFKEH]HXJW GLHVH$UWGHU 'DWLHUXQJ OHGLJOLFKGHQEHUPlFKWLJHQ U| PLVFKHQ(LQIOX‰GHUVLFKLQDQGHUHQYRQ5RPDEKlQJLJHQ*HELHWHQHEHQVRPDQL IHVWLHUW 6R ZLUG HWZD LQ GHP U|PLVFKHQ .OLHQWHON|QLJUHLFK 2VUKRHQH LQ HLQHP RIIL]LHOOHQ$UFKLYGRNXPHQWYRP1RYHPEHUGDVLQGHUÃ(GHVVHQLVFKHQ&KUR QLNµEHUOLHIHUWZLUGQDFKGHU6HOHXNLGHQlUDGHU5HJLHUXQJGHV.DLVHUV6HSWLPL XV6HYHUXVXQGGHUGHVORNDOHQ'\QDVWHQGDWLHUWZREHLGHU1DPHGHV6HYHUXVYRU GHPGHVHGHVVHQLVFKHQ.|QLJVJHQDQQWZLUGÄ,P-DKUHXQWHUGHU+HUUVFKDIW GHV6HYHUXVXQGXQWHUGHU+HUUVFKDIWGHV.|QLJV$EJDU6RKQGHV.|QLJV0DǥQX LP0RQDW7â5<1¶¬5<³  (LQlKQOLFKJHODJHUWHU)DOOLVWDXFKGLHYRUZHQLJHQ -DKUHQ SXEOL]LHUWH 8UNXQGH 3(XSKU 6\U $ YRP 'H]HPEHU  GLH DXI GHP +HUUVFKDIWVJHELHW GHV RVUKRHQLVFKHQ .|QLJV $HOLXV 6HSWLPLXV $EJDU DEJHID‰W ZXUGHDEHULQGHU'DWXPVDQJDEHQHEHQGHU1HQQXQJGHVU|PLVFKHQ.DLVHUVDXFK GDV5HJLHUXQJVMDKU$EJDUVXQGGDV6HOHXNLGHQMDKUHUZlKQW  'HPQDFKLVWDXFK 73

73

37

37

73

37

  ,3KLODH (LGHHWDO1U9JO6WLFNOHU  &KURQLFRQ(GHVVHQXP,HG*XLGL,&6&26\U VFUV\ULVHU,,,,9WH[WXV±FKURQ PLQRUD,  %â17 ¬0â0¶¶ :7/7ǥ65¶ %0/.:7+ '6:5:6 :%0/.:7+ '¶%*5 0/.¶ %5 0ǥ1:0/.¶%¶<5¬7â5<1¶¬5<  9JO 'ULMYHUV XQG +HDOH\  3 6FULSWXUD H[WHULRU  %<5¬ .1:1 4'0 â17 ¬0â0¶¶:¬0â<1:757<1%â177/7'¶:¢45¢:5465054:6¶1¢:1<:6 *:5'<1:6*'<¶:=.<¶:%â17757<1'¶/<:663¢0<:6¶%*50/.¶%5





'XUD(XURSRV

LQYRQ5RPDEKlQJLJHQ *HELHWHQ HLQH 7HQGHQ]IHVW]XVWHOOHQLQRIIL]LHOOHQ'RNX PHQWHQ GLH IDNWLVFKH U|PLVFKH +HUUVFKDIW DQ]XHUNHQQHQ 'D‰ GHU 1DPH GHV SDUWKLVFKHQ0RQDUFKHQLQ'XUDQLFKWHUVFKHLQWPDJGHPQDFKGLH0DFKWGHV)DN WLVFKHQ ZLGHUVSLHJHOQ GHQQ GHU DUVDNLGLVFKH .|QLJ GUIWH NHLQHUOHL ZLUNOLFKHQ SROLWLVFKHQ(LQIOX‰PHKUDXVJHEWKDEHQ,PEULJHQVFKHLQWGLH+DQGKDEXQJKLHU YDULDEHOJHZHVHQ]XVHLQGHQQRIIHQEDUZLUGLQGHU.RSLHHLQHV%ULHIHVDXV'XUD GHU DXV GHU =HLW YRU  ± DEHU DXV HLQHP U|PLVFKHQ .RQWH[W ± VWDPPW 3'XUD DOOHLQQDFKGHU6HOHXNLGHQlUDGDWLHUWQLFKWHWZDQDFKGHQU|PLVFKHQ .RQVXOQ   $XFKLQ3DOP\UDLVWGLHVELVLQGDV-KDOVEOLFKH3UD[LV]XEHR EDFKWHQ     0LWGLHVHPÃ/|VXQJVYRUVFKODJµIUGHQ6WDWXVGHU6WDGWQDFKFDN|QQHQ ZLUHVMHGRFKKLHUQLFKWEHZHQGHQODVVHQGHQQHVVFKOLH‰WVLFKGLH)UDJHDQQDFK GHPU|PLVFKHQ(LQIOX‰LQ'XUDXQGDP0LWWOHUHQ(XSKUDWIUGLHXQPLWWHOEDUYR UDXVJHKHQGH =HLW 'LH 4XHOOHQ GLH GHQ =HLWDEVFKQLWW ]ZLVFKHQ GHP 3DUWKHU )HOG]XJGHV.DLVHUV7UDMDQYRQXQGGHP.ULHJGHU-DKUHHUKHO OHQODVVHQ DOVOHLFKWHVWH (UNOlUXQJ±XPGLHVYRUZHJ]XQHKPHQ±GLH+\SRWKHVH ]XGD‰DXFK Y R U  FDGLH3DOP\UHQHULPU|PLVFKHQ$XIWUDJSDUWKLVFKHV*H ELHWDP(XSKUDWXQGVRPLWYLHOOHLFKWDXFKGLH6WDGW'XUD(XURSRV EHVHW]WKLHOWHQ XQGGLH6LFKHUXQJGHV(XSKUDW7DOHVEHVRUJWHQ 'HU SDOP\UHQLVFKH )HUQKDQGHO EHU GLH &KDUD[5RXWH VFKHLQW ± ZLH EHUHLWV DQJHNOXQJHQ LVW ± QDFK (QGH GHV WUDMDQLVFKHQ 3DUWKHUNULHJHV HLQHQ VLJQLILNDQWHQ $XIVFKZXQJHUOHEW]XKDEHQ  2IIHQEDUZDUHQNHLQHUOHLEHGHXWHQGH+HPPQLVVH JHJHEHQ GLH GLH 3DOP\UHQHU KlWWHQ HLQVFKUlQNHQ N|QQHQ (UVWDXQOLFK LVW GDV $XVPD‰ GHU SDOP\UHQLVFKHQ 3UlVHQ] LP ]HQWUDOHQ XQG VGOLFKHQ =ZHLVWURPODQG XQG GHQ DQJUHQ]HQGHQ *HELHWHQ ,Q HLQHU EHVFKlGLJWHQ SDOP\UHQLVFKHQ ,QVFKULIW DXVGHU=HLW]ZLVFKHQXQGZLUGGHU1DFKNRPPHHLQHV$ǥELHUZlKQWGHV VHQ 7LWHO ZRKO Ã$UFKRQ GHU 0HVHQHUµ ODXWHWH (++)&$ !" - 5() <$   XQGGHUJOHLFK]HLWLJHLQ%UJHUYRQ3DOP\UDZDU$&D4      ,P -DKUH  Q &KU EHNOHLGHWH ]XGHP HLQ 3DOP\UHQHU QD PHQV,DUDLRVLP$XIWUDJHGHV.|QLJV0HHUHGDWHVYRQ&KDUDNHQH0HVHQHGDV$PW HLQHV 6DWUDSHQ YRQ 7KLORXDQD ZRKO GDV KHXWLJH %DÃUD\Q    %HLGH =HXJQLVVH ODVVHQVLFKQXUGXUFKIUHXQGVFKDIWOLFKHQJH.RQWDNWH]ZLVFKHQGHU&KDUDNHQHXQG 73

37

73

73

37

37

73

37

    

0ǥ1:=XGHPLVWGLH$QIKUXQJGHUU|PLVFKHQ1DPHQVEHVWDQGWHLOHGHVRVUKRHQLVFKHQ.| QLJVDXIIlOOLJ 3'XUD(+++)&() ($)$5() +DUWPDQQ 9JO6FKXRO1U 3$7  ?"A"?,> >0,(6:""8),6   & ()"*"<"**"/,6 ( ) "EE"8">,6&(!")-;
 $&() / < & $  $ E  &   FG$ E  5 & 


 5<6C
(-)&E H 6FKXRO1U





$QGUHDV/XWKHU

3DOP\UD HUNOlUHQ 8QVLFKHU LVW KLQJHJHQ GDV 9HUKlOWQLV GHV .|QLJV 0HHUHGDWHV ]XP SDUWKLVFKHQ *UR‰N|QLJ :LH DXV GHU YRU ZHQLJHQ -DKUHQ DXIJHWDXFKWHQ %L OLQJXHDQGHU+HUDNOHV6WDWXHWWHYRQ6HOHXNHLDDP7LJULVKHUYRUJHKWZDUHU6RKQ GHV $UVDNLGHQ 3DNRURV   ,P -DKUH  ZXUGH HU QDFK $XVZHLV GHUVHOEHQ ,QVFKULIWYRP3DUWKHUN|QLJ9RORJHVHVJHVWU]WGRFKVLQGGLH+LQWHUJUQGHIUGLH $XVHLQDQGHUVHW]XQJ XQEHNDQQW ,QZLHZHLW GLH .RQWDNWH GHV &KDUDNHQHUV PLW 3DOP\UDXQGVHLQH*HJQHUVFKDIW]X9RORJHVHVDOVHLQH)RUPYRQÃ$EKlQJLJNHLWµ YRQ 5RP ]X LQWHUSUHWLHUHQ VLQG   PX‰ XQNODU EOHLEHQ ,PPHUKLQ VFKHLQW DEHU 9RORJHVHVGHQSDOP\UHQLVFKHQ+DQGHOLQGHU)ROJH]HLWQLFKWEHKLQGHUW]XKDEHQ (LQ EHGHXWHQGHV =HXJQLV IU GLH 6WHOOXQJ GHU 3DOP\UHQHU LP 3DUWKHUUHLFK VHOEVW LVWMHGRFK HLQH ,QVFKULIW DXV GHP -DKUH  Q &KU GLH LQ GHU |VWOLFK YRQ 3DOP\UD JHOHJHQHQ .DUDZDQHQVWDWLRQ YRQ *HQQDƝ KHXWH 8PP DOǥ$PDG  JHIXQGHQ ZXUGH XQG LQ GHU GLH (KUXQJ HLQHV 3DOP\UHQHUV QDPHQV 6RDGRV DXI JUXQG VHLQHU 9HUGLHQVWH XP GHQ .DUDZDQHQKDQGHO EH]HXJW ZLUG 0HKUHUH %LOG QLVVHZXUGHQ]XVHLQHQ(KUHQDQYHUVFKLHGHQHQ2UWHQDXIJHVWHOOW(LQHVGHU9HU GLHQVWHEHVWDQGRIIHQEDUGDULQGD‰6RDGRVLQGHU6WDGW9RORJHVLDHLQ+HLOLJWXP IU GHQ .XOW GHU U|PLVFKHQ .DLVHU JHJUQGHW KDEH - $ & () ,  ($I - -   )$    0|JOLFKHUZHLVH YHUIJWH 6RDGRV GRUW EHU HLQH QLFKW QlKHU EH]HLFKQHWH Ã0DFKWVWHOOXQJµ $9   $  'LH*UQGXQJHLQHV7HPSHOVIUGHQ.XOWGHUU|PLVFKHQ.DLVHULVW ZRKO QLFKW PLW GHU *UQGXQJ HLQHV 7HPSHOV HWZD IU HLQH ORNDOH SDOP\UHQLVFKH *RWWKHLW ]X YHUJOHLFKHQ   GHQQ GHU U|PLVFKH .DLVHUNXOW KDWWH HLQ SROLWLVFKHV 0RPHQW XQG GUIWH YRPSDUWKLVFKHQ .|QLJ QLFKW RKQHZHLWHUHV WROHULHUW ZRUGHQ VHLQVHOEVWZHQQHULQ9RORJHVLDHKHUSULYDWHU1DWXUZDU  'DGHUDUWLJH.XOWVWlW 73

37

73

37

73

73

37

37

73

37

73

37

  6FKXRO   1U  5   & 9!  J0  & K6C $- & $  "&$  ,  $ & - < &LM$  $&$ <$L$M  & -<$&  ;  &$$ - &-< $& 

<$  &  -J  & 

 <$   -   &   

 . & 9   
 9 &$ !   - 

 <$ &  9      FG& 9  !"   &

  &9
'LHVGHXWHQDXFKGLHLP-DKUH VHO   Q &KU  JHSUlJWHQ 0Q]HQ DQ <0A08"@ 6?,  =,',A,6  "N?*0O "?*0O> "?*06,<">"?O> 6>8%0&$UDELD

1UYJO6FKXRO 1LFKWUHVWORVJHVLFKHUWLVWREGLHSDUWKLVFKHQ.|QLJHLP JULHFKLVFKHQ .RQWH[W QDFK GHU PDNHGRQLVFKHQ 9DULDQWH GHU 6HOHXNLGHQlUD UHFKQHWHQ RGHU QDFKGHUEDE\ORQLVFKHQ 9JO+DXVHU  ,QGLHVHP6LQQHHWZDGH]LGLHUW3RWWHU*DZOLNRZVNLÄFOLHQWRI5RPH³  *DZOLNRZVNL3ROODUG




'XUD(XURSRV

WHQVRQVWQXUVLFKHUDQVROFKHQ2UWHQEH]HXJWVLQGGLHVLFKDXIGHP*HELHWHLQHV U|PLVFKHQÃ.OLHQWHOVWDDWHVµEHIDQGHQOLHJWGLH+\SRWKHVHQDKHGD‰DXFK9RORJH VLDYRUGHP-DKUH]XHLQHP*HELHWJHK|UWHGD‰LQHLQHPXQEHVWLPPWHQ$XV PD‰YRQ5RPÃDEKlQJLJµZDU:HQQJOHLFKGLH/RNDOLVLHUXQJGHUZRKOYRQ9ROR JHVHV , LP  -K Q &KU JHJUQGHWHQ 6WDGW 9RORJHVLD   QRFK LPPHU XPVWULWWHQ LVW GUIWH VLH VLFK LP *HELHW XP 6HOHXNHLD XQG .WHVLSKRQ DP 7LJULV EHIXQGHQ KDEHQ  %HGHXWHQGLVWLQMHGHP)DOOHGLH$QJDEHGHU,QVFKULIWGD‰9RONXQG5DW YRQ 3DOP\UD GLH $XIVWHOOXQJ YRQ 6WDQGELOGHUQ QLFKW DOOHLQ LQ 3DOP\UD EHVFKOR‰ VRQGHUQ DXFK 5  $ E  & ( )-  ,()$I - () BP 
 L$M&($)    *HQQDƝ JXW  NP |VWOLFK YRQ 3DOP\UDJHOHJHQEHIDQGVLFKVLFKHUQRFKXQWHUGLUHNWHUSDOP\UHQLVFKHU.RQWUROOH 'DV 9HUDQODVVHQ GHU $XIVWHOOXQJ YRQ 6WDQGELOGHUQ LQ 6SDVLQX &KDUD[ KLQJHJHQ N|QQWH GXUFK GLH HQJHQ %H]LHKXQJHQ HUNOlUEDU VHLQGLH 3DOP\UD ]XU VHOEHQ =HLW PLW0HHUHGDWHVYRQ&KDUDNHQHSIOHJWH,Q9RORJHVLDMHGRFKGDVXQWHUGHUGLUHNWHQ +HUUVFKDIWGHV3DUWKHUN|QLJVJHVWDQGHQ]XKDEHQVFKHLQWLVWGLHVQXUDOV,QGL]IU HLQHQ KHUDXVUDJHQGHQ SDOP\UHQLVFKHQ (LQIOX‰ ]X YHUVWHKHQ 'LH $QQDKPH GD‰ GHU$UPGHUSDOP\UHQLVFKHQ0LOL]HQELV]XP0LWWOHUHQ(XSKUDWVRQGHUQDXFKELV QDFK=HQWUDOPHVRSRWDPLHQUHLFKWHILQGHWLQGHU6RDGRV,QVFKULIW]ZDUNHLQH6WW ]H'RFKP|JOLFKHUZHLVHJHQRVVHQGLH3DOP\UHQHUQDFKGHPWUDMDQLVFKHQ3DUWKHU )HOG]XJXQEHNDQQWH6RQGHUUHFKWHLPZLFKWLJHQ(PSRULXP9RORJHVLD 'HUPLOLWlULVFKH$UP3DOP\UDVUHLFKWHMHGRFKLQGHU7DWPLQGHVWHQVVHLWGHQ HU -DKUHQ ELV DQ GHQ (XSKUDW ,Q GLHVHP =XVDPPHQKDQJ LVW HLQH SDOP\UHQL VFKH ,QVFKULIW DXV GHP -DKUH  Q &KU EHPHUNHQVZHUW LQ GHU HLQ Ä1DEDWlHU³ QDPHQVǥ%<':JHQDQQWZLUGGHU]XHLQHPXQJHQDQQWHQ=HLWSXQNWYRUGHP6HS WHPEHU GLHVHV -DKUHV LQ GHU ZRKO ]X GLHVHU =HLW DXISDUWKLVFKHP *HELHW JHOHJH QHQ 6WDGWǥƖQƗ$QDWKDVHLQHQ'LHQVWDOV5HLWHU35â YHUULFKWHWH  'LH3UlVHQ] 73

73

37

37

73

37

73

37

  9JO3OLQQDWXQWHUGHP1DPHQ9RORJHVRFHUWD +lXILJHULVWGHU1DPH9RORJHVLD VRLQGHQSDOP\UHQLVFKHQ,QVFKULIWHQ¶/*â<¶ XQGLQGHUDQWLNHQ/LWHUDWXUHWZDEHL3WROH PDLRV  9JO &KDXPRQW   SRVWXOLHUW ]ZHL 6WlGWH GDV LQ GHQ SDOP\UHQLVFKHQ ,QVFKULIWHQ JHQDQQWH9RORJHVLDDPKHXWLJHQ1DKU+LQGƯ\DKHLQHP6HLWHQDUPGHV(XSKUDWXQG9RORJH VRFHUWDEHL6HOHXNHLD.WHVLSKRQ 'DJHJHQ0DULFT9RORJHVLDXQG9RORJHVRFHU WDVHLHQGLHVHOEH6WDGWQDKH6HOHXNHLD.WHVLSKRQ 'LH8QWHUVFKLHGHLQGHU1DPHQVIRUPVLQG LQGHU7DWOHLFKWDOV9DULDQWHQ]XHUNOlUHQ ZLH IUGLH JULHFKLVFKH1DPHQVIRUP $ E LQ GHQ SDOP\UHQLVFKHQ ,QVFKULIWHQ GLH )RUPHQ ¶63>6@145¢ 3$7   -K Q &KU  .5.¶ YJO 3$7    .5.>¶@ ' " < "  0<â1 YJO 3$7   .5. 0<â1 YJO 3$7    RGHU.5. ¶6361¶ YJO 3$7    JHEUDXFKW ZHUGHQ 6FKXRO +DUWPDQQ'LHDXVGHU/RNDOLVLHUXQJ&KDXPRQWVDEJHOHLWHWH9HUPX WXQJ0*DZOLNRZVNLVGD‰9RORJHVLDV DXIGHP*HELHWGHVÄYRQ5RPDEKlQJLJHQ³.|QLJ UHLFKV &KDUDNHQH LQ %DE\ORQLHQ  ODJ LVW LP EULJHQ NHLQHVZHJV ]ZLQJHQG *DZOLNRZVNL   ÄWKH FLW\ RI 9RORJHVLDV ZDV VLPSO\ RXWVLGH WKLV MXULVGLFWLRQ³ JHPHLQW LVW GLH GHU 3DUWKHU XQG*DZOLNRZVNLÄLQWKH$QWRQLQHSHULRGSHUKDSVDGHSHQGHQFHRI0HVHQH³   3$77HLO$=   3$7  ǥ%<': %5 ǥ10:  >%5@ âǥ'/7 1%¢<¶ 5:¬<>¶@ '< +:¶ 35â  >%@¬<57¶:%0â5<7¶'<ǥ1¶Äǥ%<':6RKQGHVǥ10:>6RKQHVGHV@âǥ'/71DEDWlHU DXV5DZZƗÃDKGHU5HLWHU>LP@.DVWHOOXQGLP /DJHUYRQǥƖQƗ ZDU³ *DZOLNRZVNLD  YHUPXWHW GD‰ ǥ%<': XQWHU SDOP\UHQLVFKHP RGHU U|PLVFKHP .RPPDQGR VWDQG YJO 3



3

3

3



$QGUHDV/XWKHU

YRQ 3DOP\UHQHUQ DP 0LWWOHUHQ (XSKUDW IU GLHVH =HLW LVW ELVODQJ XQWHUVFKLHGOLFK HUNOlUW ZRUGHQ 0 *DZOLNRZVNL HWZD GHQNW   GD‰ VLFK ǥƖQƗ LP *HELHW HLQHU ÄPDUFKH HXSKUDWpHQQH GH 3DOP\UH³ ELV YRU GDV *HELHW XP GLH KHXWLJH 6WDGW +ƯW GLHDXFKLQSDUWKLVFKHU=HLWH[LVWLHUWKDEHQGUIWH  XQGVRPLWLPXQPLWWHOEDUHQ Ä%HVLW]³GHU3DOP\UHQHUEHIXQGHQKDEH$,QYHUQL]]LQLPPWKLQJHJHQDQ  GD‰ HVHLQH$UWÄDFFRUGRWUD3DOPLUDQRQ5RPD HL3DUWL³JHJHEHQKDEHZRQDFKǥƖQƗ HLQHÄVWD]LRQHGLIURQWLHUD³IUÄRSHUD]LRQLGRJDQDOL³JHZHVHQVHL3DOP\UDN|QQ WH DXIJUXQG HLQHU VROFKHQ 9HUHLQEDUXQJ GDV 5HFKW EHVHVVHQ KDEHQ GLHVH 3OlW]H VHOEVWPLOLWlULVFK]XVLFKHUQ  'HU(LQIOX‰GHU6WDGW3DOP\UDGLHZlKUHQGGHU5H JLHUXQJV]HLW+DGULDQVGHQ%HLQDPHQ+DGULDQƝDQQDKPVWDQGMHGHQIDOOVZLHGHUXP VWHOOYHUWUHWHQG IU GHQ 5RPV   $XFK U|PLVFKH 7UXSSHQ VFKHLQHQ LP EULJHQ LQ GHQHU-DKUHQLQGLHVHP*HELHWWlWLJJHZHVHQ]XVHLQ  :LFKWLJLVWHLQZHLWHUHU%HOHJDQGHUHU1DWXUDXVGHU5HJLHUXQJGHV$QWRQLQXV 3LXV 'HQQ XQWHU GHP ]ZHLWHQ .RQVXODW GHV 3LXV &26 ,,  DOVR DXV GHP -DKUH ZXUGHHLQH6HULHYRQ0Q]HQJHSUlJWDXIGHUHQ5HYHUVHLQH5HLKHYRQ*H ELHWHQSHUVRQLIL]LHUWDEJHELOGHWLVWGLH]XP5|PLVFKHQ5HLFKJHK|ULJZDUHQRGHU LQ HLQHU DQGHUHQ %H]LHKXQJ ]X LKP VWDQGHQ $)5,&$ $/(;$1'5,$ $50(1,$ $6,$ &$33$'2&,$ '$&,$ +,63$1,$ ,7$/,$ 0$95(7$1,$ 3$57+,$ 3+2(1,&( 6&<7+,$ 6,&,/,$ 6<5,$ XQG 7+5$&,$  :LUILQGHQ KLHUYRUQHKPOLFK3URYLQ]HQGHV5HLFKHVRGHUSURYLQ] EHUJUHLIHQGH *UR‰UlXPH $6,$ &$33$'2&,$ '$&,$ +,63$1,$ XD  DEHU DXFK YRQ 5RP DEKlQJLJH *HELHWH ZLH GDV .OLHQWHON|QLJUHLFK $50(1,$ 73

37

73

37

73

73

37

73

37

73

73

37

37

37





  

 





:LOO 7HL[LGRUQLPPWGDJHJHQDQGD‰ǥ%<':HLQÄFDYDOLHUDXVHUYLFH GHV3DUWKHV³JHZHVHQLVWYJO,QYHUQL]]L (KHUXQZDKUVFKHLQOLFKLVWGD‰ǥ%<': ZlKUHQG GHV 3DUWKHUNULHJHV XQWHU 7UDMDQ GRUW NXU]]HLWLJ VWDWLRQLHUW ZDU DXFK ZHQQ $UULDQ 3DUWK)LP=XVDPPHQKDQJPLWGLHVHP.ULHJGLH6WDGWQ"9HUZlKQW *DZOLNRZVNL D  ÄOLPHV SDOP\UpQLHQ³  *DZOLNRZVNL   *DZOLNRZVNL SDOP\UHQLVFKHV7HUULWRULXPKDEHLP-DKUKXQGHUWELV]XP(XSKUDWJHUHLFKW 9JO &XPRQW;/9,,,*DZOLNRZVNL
'XUD(XURSRV



'HU $QOD‰ IU GLHVH (PLVVLRQ LVW XQVLFKHU   $XIVHKHQ LQ GHU PRGHUQHQ )RU VFKXQJKDWVHLWMHKHUGLH0Q]HKHUYRUJHUXIHQDXIGHUGLH/HJHQGH3$57+,$]X OHVHQLVW  ,Q$QDORJLH]XGHQEULJHQ0Q]OHJHQGHQVFKHLQW3DUWKLD]XGHQYRQ 5RPDEKlQJLJHQ6WDDWHQJH]lKOWZRUGHQ]XVHLQJHZLVVHUPD‰HQDOV.OLHQWHOVWDDW 'D ZLU DEHU ]XYRU QLFKWV YRQ HLQHU 8QWHUZHUIXQJ GHV 3DUWKHUN|QLJV XQWHU U|PL VFKH2EHUKRKHLWZLVVHQZlUH DOV(UNOlUXQJIU GLHVH0Q]HPLVVLRQDP HKHVWHQ GHQNEDU GD‰ 5RP HLQHQ 7HLO SDUWKLVFKHQ 7HUULWRULXPV NRQWUROOLHUWH 9RU GHP +LQWHUJUXQGGHUSDOP\UHQLVFKHQ0LOLWlUSUlVHQ]LQǥƖQƗXPVRZLHDQJHVLFKWV GHV (LQIOXVVHV HLQHV 6RDGRV LQ GHU SDUWKLVFKHQ 6WDGW 9RORJHVLD XP  N|QQWH GLHVH U|PLVFKH .RQWUROOH YRQ 7HLOHQ SDUWKLVFKHQ *HELHWV DP 0LWWOHUHQ (XSKUDW ZLHGHUXPGXUFK9HUPLWWOXQJGHU3DOP\UHQHUHUIROJWVHLQlKQOLFKZLHREHQIUGLH =HLWQDFKYHUPXWHW 6XFKW PDQ QDFK GHP %HJLQQ GLHVHV U|PLVFKSDOP\UHQLVFKHQ Ä3URWHNWRUDWV³ DP (XSKUDW VR E|WH VLFK DOV JHQHUHOOHU 7HUPLQXV SRVW TXHP GHU WUDMDQLVFKH 3DUWKHUNULHJ   DQ GHU NXU]IULVWLJ ]X HLQHU 3URYLQ]LDOLVLHUXQJ GHV =ZHL VWURPODQGHV XQG $UPHQLHQV IKUWH   $OOHUGLQJV ]RJ VLFK QRFK 7UDMDQ VHOEVW ]X UFNXQG+DGULDQVFKHLQWGHQ(XSKUDWZLHGHU]XU'HPDUNDWLRQVOLQLHJHPDFKW]X KDEHQ   $OOHUGLQJVPX‰ GLHVQLFKWEHGHXWHWKDEHQGD‰U|PLVFKHU(LQIOX‰XQWHU +DGULDQ DP (XSKUDW HQGHWH 1DFK  NDQQ YLHOOHLFKW GHU ZHVWOLFKH 7HLO GHV 3DUWKHUUHLFKHVXQWHUHLQHPU|PLVFKHQÄ.OLHQWHON|QLJ³JHVWDQGHQKDEHQGHP$U VDNLGHQ3DUWKDPDVSDWHVGHQQRFK7UDMDQDOVSDUWKLVFKHQ.|QLJLQWKURQLVLHUWKDWWH ,P -DKUH  NDP HV ]X HLQHU U|PLVFKSDUWKLVFKHQ 9HUHLQEDUXQJ GXUFK GLH HLQ GURKHQGHU .ULHJ YHUKLQGHUW ZHUGHQ NRQQWH   XQG YHUPXWOLFK ZXUGH LQ GLHVHP =XVDPPHQKDQJ DXFK HLQH 1HXRUGQXQJ GHU $EKlQJLJNHLWVYHUKlOWQLVVH YRUJH QRPPHQ 3DUWKDPDVSDWHV PX‰WH RIIHQEDU  VHLQH $QVSUFKH DXI GHQ SDUWKL VFKHQ7KURQDXIJHEHQVFKHLQWDEHULQGLHVHP=XVDPPHQKDQJYRQ5RPPLWGHP HKHPDOVSDUWKLVFKHQ Ä7HLON|QLJUHLFK³ 2VUKRHQH DEJHIXQGHQ ZRUGHQ ]X VHLQ GDV IRUWDQ HLQ U|PLVFKHV .OLHQWHON|QLJUHLFK EOLHE ZHQQJOHLFK GLH HLQKHLPLVFKH '\ QDVWLHGRUWEHUHLWVLP-DKUHRGHUZLHGHUDQGLH0DFKWJHNRPPHQ]XVHLQ 73

73

37

73

73

37

37

37

73

37

  +lXILJ ZLUGHLQ=XVDPPHQKDQJ PLWGHU'DUEULQJXQJGHVDXUXPFRURQDULXPDQJHQRPPHQ YRQGHUGLH9LWD3LLGHU+LVWRULD$XJXVWD EHULFKWHW'DGLHVH6RQGHUDEJDEHVRZRKOYRQ GHQ3URYLQ]HQGHV5HLFKHVDOVDXFKYRQGHQU|PLVFKHQµ.OLHQWHOVWDDWHQ¶]XHUEULQJHQZDULVW YHUVWlQGOLFKZLHVRQHEHQU|PLVFKHQ3URYLQ]HQRGHUVROFKHQ*HELHWHQGLH]X3URYLQ]HQGHV 5HLFKVJHK|UHQ$/(;$1'5,$RGHU3+2(1,&( DXFKHWZDGDVYRQ5RPDEKlQJLJH$U PHQLHQJHQDQQWZLUG  %0&,PS61U3O $YHUV$1721,196Â$9*3,96335HYHUV 3$57+,$6&&26,,5,&61U  9JO]XGHQ(UHLJQLVVHQ$QJHOL%HUWLQHOOL6FKPLWW$QJHOL%HUWLQHOOL  *RQ]iOH]  8PVWULWWHQ EOHLEW RE HV HLQH 3URYLQ] $VV\ULD JDE XQG ZR VLH JHJHEHQHQIDOOV]XORNDOLVLHUHQLVW0LOODU  (XWURSVWDWLPSURYLQFLDVWUHVUHOLTXLWTXDV7UDLDQXVDGGLGHUDWHWGH$VV\ULD0HVRSR WDPLD$UPHQLDUHYRFDYLWH[HUFLWXVDFILQHPLPSHULLHVVHYROXLW(XSKUDWHQ )HVWXVXQG  6+$ +DGU  %HOOXP 3DUWKLFXP SHU LGHP WHPSXV LQ PRWX WDQWXP IXLW LGTXH +DGULDQL FRQORTXLRUHSUHVVXPHVW





$QGUHDV/XWKHU

VFKHLQW  $OV=HLWSXQNWIUHLQH1HXRUGQXQJDXFKGHU(LQIOX‰VSKlUHQLP(XSK UDW7DONlPHQGHPQDFKHQWZHGHUGDV-DKURGHUDEHUGHU=HLWUDXPLQ )UDJH   :RKO LP -DKUH  NDP HV ]X HLQHU )UVWHQNRQIHUHQ] ]X GHU DXFK GHU 3DUWKHUN|QLJHLQJHODGHQ ZDU7RSDUFKDVHWUHJHVDGDPLFLWLDPLQYLWDYLWLQYLWDWR HWLDP 2VGURH UHJH 3DUWKRUXP UHPLVVDTXH LOOL ILOLD TXDP 7UDLDQXV FHSHUDW DF SURPLVVDVHOOD TXDH LWLGHP FDSWDIXHUDW   'D‰ KLHU GHU 3DUWKHU 2VURHV ZLH HLQ .OLHQWHON|QLJ EHKDQGHOW ZXUGH LVW DXIIlOOLJ XQG N|QQWH GXUFK GLH U|PLVFK SDOP\UHQLVFKH.RQWUROOHYRQ7HLOHQGHV3DUWKHUUHLFKHVEHJUQGHWVHLQ,P/DXIH GLHVHV]ZHLWHQ2ULHQWDXIHQWKDOWHVEHVXFKWH+DGULDQLPEULJHQDXFK3DOP\UDXQG ZXUGHGRUWPLWJUR‰HQ(KUHQEHGDFKW  ZDVHLQHQ*UXQGLQGHUYRQ5RPJHI|U GHUWHQSULYLOHJLHUWHQ6WHOOXQJGHU3DOP\UHQHUKDEHQPDJ ,P-DKUHEHVFKOR‰ GHU 5DW GHU 6WDGW 3DOP\UD DXFK HLQ QHXHV 6WHXHUJHVHW]   GDV ZRKO GHQ $XI VFKZXQJZLGHUVSLHJHOWGHQGLH6WDGWVHLWGHP(QGHGHVWUDMDQLVFKHQ3DUWKHUNULH JHVHUIXKU6RN|QQWHPDQYHUPXWHQGD‰GHU%HJLQQGHUSDOP\UHQLVFKHQ0LOLWlU SUlVHQ]LQ7HLOHQGHV(XSKUDW7DOHVLQGLH=HLW]ZLVFKHQGHP$E]XJ7UDMDQVXQG GHP-DKUGDWLHUW :DVQXQ'XUD(XURSRVDQJHKWVRVLQGOHLGHUGLH%HOHJHIUGLH=HLW]ZLVFKHQ FD  XQG FD  QLFKW HLQGHXWLJ :LU KDEHQ HLQ XQGDWLHUWHV SDOP\UHQLVFKHV =HXJQLVDXVGHP7HPSHOGHU*DGGHLQ'XUDHLQH,QVFKULIWGLHDP5HOLHI,9]X (KUHQGHV*RWWHV
73

37

37

73

73

37

37

73

73

37

37

73

37

73

37

  +LHU]X /XWKHU E  ZR QRFK HLQ :HFKVHO GHV 3DUWKDPDVSDWHV DXI GHQ RVUKRHQL VFKHQ7KURQLP-DKUDQJHQRPPHQZLUGHEHQVRLQGHU/LVWHEHL/XWKHUF  5HYLGLHUWEHL/XWKHUG9JODXFK*HEKDUGW$QGHUVGLHFRPPXQLVRSLQLR 3DUWKDPDVSDWHV KDEH EHUHLWV LP -DKUH  GLH 2VUKRHQH HUKDOWHQ XQG VHLQH +HUUVFKDIW EHU GLHVHV .|QLJUHLFK LP -DKUH  JDQ] DXIJHEHQ PVVHQ 9JO HWZD =LHJOHU   6FKPLWW%LUOH\  9JO%LUOH\XQG  6+$+DGU  +DUWPDQQ  3$7  9JO3$7 5RVWRYW]HIIHWDO1U<5¬%:/¶/+¶¢%¶0·%¶'< ǥ<1¶ǥ%'%1<0<7¶4⢶   *DZOLNRZVNLXQGÄ,OHVWFODLUTXHOHVWULEXVVXEVLVWHQWHQSOHLQ,, H VLqFOHVDQV TXHO¶DSSDUWHQDQFHjO¶XQHG¶HOOHVVRLWWRXMRXUVMXJpHGLJQHGHUDSSHO³ 9JO'LMNVWUD 2IIHQEDUZXUGHGLH%H]HLFKQXQJGHU6WDPPHV]XJHK|ULJNHLWLQGHQSDOP\UHQLVFKHQ,Q VFKULIWHQQDFKGHU0LWWHGHV-DKUKXQGHUWV]XQHKPHQGXQEOLFK  =XGHP VLQG LQ GHPVHOEHQ )XQGNRQWH[W ]ZHL ,QVFKULIWHQ ]XWDJH JHWUHWHQ GLH DXV GHP -DKUH VWDPPHQ3$7XQG 5RVWRYW]HIIHWDO1UXQG 3



3



'XUD(XURSRV

P\UHQLVFKHU%RJHQVFKW]HQLQ'XUD Y R U  GHUU|PLVFKHQÃ(LQQDKPHµXP   :HQQJOHLFK)0LOODUYRUZHQLJHQ-DKUHQGDUDXIKLQZLHVGD‰GHUSDOP\UHQLVFKH (LQIOX‰VFKRQLQÃSDUWKLVFKHUµ=HLWLQ'XUDEHWUlFKWOLFKJHZHVHQLVWXQGIHVWVWHOO WHGD‰VLFKGLH(YLGHQ]IUHLQSDUWKLVFKHV'XUDEHUKDXSWDOVUHFKWEHJUHQ]WGDU VWHOOW  JHK|UWHGLH6WDGWYRUFDDOOHU:DKUVFKHLQOLFKNHLWQDFKWDWVlFKOLFK]X SDUWKLVFKHP *HELHW 6FKRQ LP -DKUH  ZDUHQ GLH U|PLVFKHQ 7UXSSHQ 7UDMDQV DXVGHU6WDGWDEJH]RJHQ  )UGLH)ROJH]HLWKDEHQZLUHLQ=HXJQLVIUGLH$NWL YLWlWHQSDUWKLVFKHU2IIL]LHOOHULQ'XUDXQG8PJHEXQJ8QWHULKQHQLVWIUGDV-DKU  Q &KU GDWLHUW XD QDFK GHQ 5HJLHUXQJVMDKUHQ GHV SDUWKLVFKHQ .|QLJV  HLQ 3DUWKHU QDPHQV 0HWROEDHVVDV EH]HXJW )HVWXQJVNRPPDQGHXU #()  GHV 2UWHV 3DOLJD HLQ *RXYHUQHXU 6WUDWHJH  YRQ 0HVRSRWDPLD XQG 3DUDSRWDPLD 0DQHVRVVRZLHHLQ%HDPWHU3KUDDWHVGHUGHQLUDQLVFKHQ7LWHO  ZRKO HEHQIDOOV Ä)HVWXQJVNRPPDQGHXU³   WUXJ 3'XUD   0HWROEDHVVDV 0DQH VRVXQG3KUDDWHVEHIHKOLJWHQKLHUEHLVLFKHUOLFK7UXSSHQGLHGHPSDUWKLVFKHQ.| QLJXQWHUVWDQGHQ=XGHPLVWLQGLHVHP'RNXPHQWYRQGHU$EIKUXQJHLQHU6WUDIH DQGDVN|QLJOLFKH6FKDW]KDXV()--$  GLH5HGH3'XUD  $OOHUGLQJV EOHLEW Y|OOLJ XQVLFKHU ZHOFKHU SDUWKLVFKH .|QLJ KLHU JHPHLQW LVW HV ZLUG EHL GHU 'DWXPVDQJDEH ZLH EOLFK QXU GHU 7KURQQDPH $UVDNHV PLW VHLQHQ (SLWKHWDJHQDQQW (VN|QQWHVLFKGXUFKDXVXPGHQYRQ5RPSURWHJLHUWHQ.|QLJ 3DUWKDPDVSDWHVKDQGHOQGHUVLFKVFKHLQEDUELV]XP-DKUHLQ7HLOHQGHV5HL FKHVKDOWHQNRQQWH  $X‰HUGHPGDWLHUW3'XUDDXVGHU=HLWYRUGHQ9HUKDQG OXQJHQ+DGULDQVPLWGHQ3DUWKHUQYRQE]ZGLHRIIHQEDUHUVW]XHL QHU 1HXRUGQXQJ GHV 9HUKlOWQLVVHV IKUWHQ ,Q HLQHP ]ZHLWHQ 'RNXPHQW 3'XUD  YRP -DKUH  ZLUG RIIHQEDU GHU DXFK DXV 'RNXPHQWHQ GHV  -KV EHNDQQWH N|QLJOLFKH *HULFKWVKRI HUZlKQW $    ($ )    :LH DXFK LPPHU DOO GLHVH %HOHJH ZUGHQ JUXQGVlW]OLFK QLFKW GDJHJHQ VSUHFKHQ GD‰ 'XUDQDFKFDHLQYRQ3DOP\UDNRQWUROOLHUWHVXQGKLHUGXUFKLQGLUHNWYRQ5RP DEKlQJLJHV *HELHW ZDU GHQQ DXFK LQ EHVHW]WHQ *HELHWHQ NDQQ HV ZHLWHUKLQ HLQ )XQNWLRQLHUHQ GHU HLQKHLPLVFKHQ *HZDOWHQ JHJHEHQ KDEHQ HEHQVR ZLH LQ 'XUD XPGLH([LVWHQ]HLQHVSDUWKLVFKHQ6RPDWRSK\OD[QDFK]XZHLVHQLVW   $P 5DQGH VHL EHPHUNW GD‰ HV ZlKUHQG GHV .ULHJHV YRQ FD  HLQH 6FKODFKW EHL (XURSRV JDE GLH QDFK HLQHU YRQ /XNLDQ DOV EHUWULHEHQ JHWDGHOWHQ 73

73

37

37

73

37

73

73

37

37

73

73

37

37

  5RVWRYW]HIIHWDO6RDXFK0LOODU'DJHJHQMHGRFK*DZOLNRZVNLD ÄDSUqVSOXW{WTXH©YHUVª³ 'LUYHQ7H[W1U P|FKWHGLHVH,Q VFKULIWlKQOLFKLQGLH=HLW]ZLVFKHQXQGQ&KUGDWLHUHQ9JO




$QGUHDV/XWKHU

$QJDEHGHU]HLWJHQ|VVLVFKHQ*HVFKLFKWVVFKUHLEHUQXUHLQHJDQ]JHULQJH=DKOYRQ U|PLVFKHQ 2SIHUQ IRUGHUWH ZlKUHQG GLH 3DUWKHU JHZDOWLJH 9HUOXVWH GDYRQJHWUD JHQ KlWWHQ   )DOOV PLW GLHVHP 2UW GLH 6WDGW 'XUD(XURSRV JHPHLQW LVW   :LH ZlUHQ GLH YHUPHLQWOLFK KRKHQ SDUWKLVFKHQ 9HUOXVWH EHVVHU ]X HUNOlUHQ DOV GXUFK GLH $QQDKPH GD‰ GLH 3DUWKHU YHUJHEOLFK YHUVXFKWHQ VLFK LQ GHQ %HVLW] GLHVHU EHUHLWV]XYRUGXUFKHLQH$EWHLOXQJGHUSDOP\UHQLVFKHQ0LOL]JHVLFKHUWHQ6WDGW]X EULQJHQ"  )DVVHQZLU]XVDPPHQ$SSLDQEH]HXJWLP9RUZRUW]XVHLQHUZRKOXQWHU0DUF $XUHO XQG /XFLXV 9HUXV DEJHVFKORVVHQHQ Ã5|PLVFKHQ *HVFKLFKWHµ GD‰ GHU (LQIOX‰EHUHLFK 3DOP\UDV ELV ]XP (XSKUDW UHLFKWH   :HQQJOHLFK KLHU XQVLFKHU LVWIUZHOFKHQ=HLWSXQNWXQGIUZHOFKHQ%HUHLFKGHV(XSKUDW7DOHVGLHVH)HVW VWHOOXQJJLOWGUIWHVLHVRZRKOIUGLH=HLWQDFKGHP.ULHJYRQDOVDXFK IUGLH=HLWGDYRUJUXQGVlW]OLFK]XWUHIIHQ( U V W H Q V   $EHLQHPQLFKWQlKHUEH VWLPPEDUHQ=HLWSXQNWLP$QVFKOX‰DQGHQ3DUWKHUNULHJ7UDMDQVYLHOOHLFKWDEGHP -DKUHVFKHLQHQGLH3DOP\UHQHULPU|PLVFKHQ$XIWUDJH7HLOHGHV]XP3DUWKHU UHLFKJHK|UHQGHQ(XSKUDW7DOHVXPGLH6WDGW$QDWKDNRQWUROOLHUW]XKDEHQ1LFKW XQGHQNEDUZlUHHVKLHUEHLZHQQVLFKEHUHLWV]XGLHVHP=HLWSXQNWDXFKGLH6WDGW 'XUD LQ GLHVHU 0LOLWlU]RQH EHIDQG = Z H L W H Q V   $E GHP .ULHJ GHU -DKUH   VFKHLQW QLFKW QXU ZLHGHUXP HLQ EHWUlFKWOLFKHU $EVFKQLWW GHV (XSKUDW7DOHV XQWHUSDOP\UHQLVFKU|PLVFKHU .RQWUROOH JHVWDQGHQ ]X KDEHQ VRQGHUQ DXFK 7HLOH GHV Q|UGOLFKHQ 0HVRSRWDPLHQ ELV KLQ ]XP 7LJULV VFKHLQHQ IRUWDQ U|PLVFKHV %H VDW]XQJVJHELHWÃ3URWHNWRUDWµRGHUÃ.OLHQWHOWHUULWRULXPµJHZHVHQ]XVHLQ 6LFKHUZDUGLHVH5HJHOXQJ7HLOHLQHUSDUWKLVFKU|PLVFKHQ9HUHLQEDUXQJGLH HLQHQ.RPSURPL‰]ZLVFKHQSDUWKLVFKHQSDOP\UHQLVFKHQXQGU|PLVFKHQ ,QWHUHV VHQGDUVWHOOWH'D‰5RPKLHUDXIGLH3DOP\UHQHU]XUFNJULIIN|QQWHGDKHUPHKUHUH *UQGHKDEHQ$EJHVHKHQGDYRQGD‰HVGHP3DUWKHUN|QLJEHGHXWHQGDQJHQHKPHU JHZHVHQVHLQGUIWHNHLQHU|PLVFKHQ/HJLRQHQDQGHQ*UHQ]HQVHLQHUEDE\ORQL VFKHQ%HVLW]XQJHQ]XVHKHQZDUGDV7DOGHV0LWWOHUHQ(XSKUDWHLQHUVHLWVVRZHLW YRQ U|PLVFKHP 3URYLQ]LDOJHELHW HQWIHUQW GD‰ GHU ORJLVWLVFKH $XIZDQG HLQHU GL UHNWHQ U|PLVFKHQ 0LOLWlUNRQWUROOH EHWUlFKWOLFK JHZHVHQ VHLQ PX‰ )U GLH U|PL VFKH 6HLWH EUDFKWH GLH 3UlVHQ] GHU 3DOP\UHQHU VRPLW GHQ 9RUWHLO GD‰ VLH VHOEVW NHLQH 7UXSSHQ LQ HLQHP VFKZLHULJHQ 7HUUDLQ VWHOOHQ PX‰WHQ $QGHUHUVHLWV GUIWH GDV,QWHUHVVH3DOP\UDVDQHLQHU.RQWUROOHGHV(XSKUDW7DOHVYRUDOOHPGXUFKGLH 6LFKHUXQJ GHV +DQGHOVIOXVVHV PRWLYLHUW ZRUGHQ VHLQ *OHLFK]HLWLJ PVVHQ GLH 73

37

73

73

37

37

  /XNLDQKLVW  9JO]XP3UREOHPGHU/RNDOLVLHUXQJGLHVHV2UWHV&XPRQW/,,$QJHOL%HUWLQHOOL (XURSRV 'XUD(XURSRV &RUFHOOD(XURSRV 2UWLQ1RUGV\ULHQ   $SSLDQ SUDHI  
 -   ;$  =  - P  9$$P - =  J9 J  '   -
 - 
- 0#   9$$  5  ;
     ;
   R

 ! - 0#  9  $ 9JO  (XSKUDW DOV 5HLFKVJUHQ]H LQ $VLHQ 

   "$ 
  0#  GRFKNDQQKLHUPLWGHUREHUH(XSKUDWDXIGHU+|KHYRQ =HXJPD

JHPHLQWVHLQ'LH6FKOX‰IROJHUXQJGD‰$SSLDQV*HVFKLFKWHGHVKDOEYRUGHP-DKUHDEJH VFKORVVHQVHLQPX‰LVWP(XQ]XOlVVLJGDGHUU|PLVFKSDUWKLVFKH.ULHJQLFKWPLWGHU9RU YHUOHJXQJGHUU|PLVFKHQ*UHQ]HJHHQGHW]XKDEHQVFKHLQW



'XUD(XURSRV



SDOP\UHQLVFKHQ.DXIOHXWHGDUDQLQWHUHVVLHUWJHZHVHQVHLQP|JOLFKVWJUR‰H7HLOH GHV :DUHQIOXVVHV ]X NRQWUROOLHUHQ XQG NRQNXUULHUHQGH =ZLVFKHQKlQGOHU HEHQVR ZLH GLH SROLWLVFKH RGHU ILVNDOLVFKH $EKlQJLJNHLW YRQ ORNDOHQ 2EULJNHLWHQ DXV]X VFKDOWHQ,P)DOOHYRQ'XUD(XURSRVKDWWHQ3DOP\UHQHUMDVFKRQVHLWYRUFKULVWOL FKHU =HLW (UIDKUXQJHQ PLW GHU SDUWKLVFKHQ 9HUZDOWXQJ PDFKHQ N|QQHQ (V NDQQ MHGHQIDOOVQLFKWYHUZXQGHUQGD‰GLHQDFKGHPWUDMDQLVFKHQ3DUWKHUNULHJHUNHQQEDU ZHUGHQGH (U|IIQXQJ GHV SDOP\UHQLVFKHQ Ã.RUULGRUVµ ]ZLVFKHQ $QDWKD 9RORJHVLD XQG&KDUD[GHUYLHOOHLFKWDXFKVFKRQIUK'XUDXPID‰WHH[DNWPLWGHP%HJLQQ GHU%OWH]HLW]XVDPPHQIlOOWGLHGHUSDOP\UHQLVFKH)HUQKDQGHOLP-DKUKXQGHUW HUOHEWH 





$QGUHDV/XWKHU

$%&' ()'*+"*

$e $QQpHeSLJUDSKLTXHKJYRQ5&DJQDWXD3DULVII %0& ,PS   0DWWLQJO\ +   &RLQV RI WKH 5RPDQ (PSLUH LQ WKH %ULWLVK 0XVHXP9RO,9%GH/RQGRQ %0&$UDELD +LOO*)&DWDORJXHRIWKH*UHHN&RLQVRI$UDELD0HVRSR WDPLDDQG3HUVLD%ULWLVK0XVHXP&DWDORJXH1'%RORJQD ,/6  ,QVFULSWLRQHV /DWLQDH 6HOHFWDH KJ YRQ + 'HVVDX  7HLOH %HUOLQ   3$7 3DOP\UHQH$UDPDLF7H[WVKJYRQ'5+LOOHUVXQG(&XVVLQL%DOWLPRUH ±/RQGRQ 5,& 0DWWLQJO\+XQG($6\GHQKDP7KH5RPDQ,PSHULDO&RLQDJH 9RO,,,1'/RQGRQ 6(*  6XSSOHPHQWXP (SLJUDSKLFXP *UDHFXP KJ YRQ --( +RQGLXV XD /HLGHQ II 3

 

                           



3

'XUD(XURSRV



*!! 

 $QJHOL %HUWLQHOOL 0*  ³, 5RPDQL ROWUH O¶(XIUDWH QHO ,, VHFROR G & OH SURYLQFHGL$VVLULDGL0HVRSRWDPLDHGL2VURHQH ³$15:,, $QJHOL %HUWLQHOOL 0*  ³7UDLDQR LQ RULHQWH /D FRQTXLVWD GHOO¶$UPHQLD GHOOD0HVRSRWDPLDHGHOO¶$VVLULD´,Q7UDMDQR(PSHUDGRUGH5RPDKJYRQ -*RQ]iOH]5RPD $UQDXG 3  Ä'RXUD(XURSRV PLFURFRVPH JUHF RX URXDJH GH O¶DGPLQLVWUDWLRQDUVDFLGH"³6\ULD %DXU39&XQG0,5RVWRYW]HII+JJ7KH([FDYDWLRQVDW'XUD(XURSRV 3UHOLPLQDU\5HSRUWRI)LUVW6HDVRQRI:RUN6SULQJ1HZ+DYHQ %H\HU.'LHDUDPlLVFKHQ,QVFKULIWHQDXV$VVXU+DWUDXQGGHPEULJHQ 2VWPHVRSRWDPLHQ*|WWLQJHQ %LUOH\$+DGULDQ/RQGRQ±1HZ




$QGUHDV/XWKHU

)U\H 51 -) *LOOLDP + ,QJKROW XQG &% :HOOHV +JJ  Ä,QVFULSWLRQV IURP'XUD(XURSRV³<&6 *DVFRX -  Ä8QLWpV DGPLQLVWUDWLYHV ORFDOHV HW IRQFWLRQQDLUHV URPDLQV /HV GRQQpHV GHV QRXYHDX[ SDS\UXV GX 0R\HQ (XSKUDWH HW G¶$UDELH³ ,Q /RNDOH $XWRQRPLH XQG U|PLVFKH 2UGQXQJVPDFKW LQ GHQ NDLVHU]HLWOLFKHQ 3URYLQ]HQ YRP  ELV  -DKUKXQGHUW KJ YRQ : (FN XQG ( 0OOHU/XFNQHU  6FKULIWHQGHV+LVWRULVFKHQ.ROOHJV.ROORTXLHQ0QFKHQ *DZOLNRZVNL0/HWHPSOHSDOP\UpQLHQ3DOP\UH:DUV]DZD *DZOLNRZVNL0DÄ3DOP\UHHWO¶(XSKUDWH³6\ULD *DZOLNRZVNL0EÄ/¶ÌOHGH%LGMDQIRUWHUHVVHDVV\ULHQQHHWURPDLQH³$U FKpRORJLD *DZOLNRZVNL0Ä7KH5RPDQ)URQWLHURQWKH(XSKUDWHV³0HVRSRWDPLD  *DZOLNRZVNL 0 D Ä/H FRPPHUFH GH 3DOP\UH VXU WHUUH HW VXU HDX³ ,Q /¶$UDELHHWVHVPHUVERUGLqUHV,,WLQpUDLUHVHWYRLVLQDJHVKJYRQ-)6DO OHV&ROOHFWLRQGHV7UDYDX[GHOD0DLVRQGHO¶2ULHQW/\RQ *DZOLNRZVNL0EÄ/D URXWHGHO¶(XSKUDWHG¶,VLGRUHj-XOLHQ³ ,Q*pRJUD SKLH +LVWRULTXH DX 3URFKH2ULHQW KJ YRQ 3/ *DWLHU XD  &156 &HQWUH GH 5HFKHUFKHV $UFKpRORJLTXHV 1RWHV HW 0RQRJUDSKLHV 7HFKQLTXHV 3DULV *DZOLNRZVNL0Ä3DOP\UDDVD7UDGLQJ&HQWUH³,UDT *DZOLNRZVNL0Ä3DOP\UDDQGLWV&DUDYDQ7UDGH³$$6 *DZOLNRZVNL0Ä/¶(PSHUHXU-XOLHQVXUOHVERUGVGHO¶(XSKUDWH³,Q'HV 6XPpULHQVDX[5RPDLQVG¶2ULHQW/DSHUFHSWLRQJpRJUDSKLTXHGXPRQGHKJ YRQ$6pUDQGRXU$QWLTXLWpV6pPLWLTXHV3DULV *HEKDUGW$,PSHULDOH3ROLWLNXQGSURYLQ]LDOH(QWZLFNOXQJ.OLR%HLKHIWH 1)%HUOLQ *QROL7Ä,SDSLULGHOO¶(XIUDWH6WXGLRGLJHRJUDILDVWRULFD³0HGLWHUUDQHR $QWLFR *QROL75RPD(GHVVDH3DOPLUDQHO,,,VHFG&3UREOHPLLVWLWX]LRQDOL %LEOLRWHFDGL©0HGLWHUUDQHR$QWLFRª3LVD±5RPD *RQ]iOH]-Ä5HIOH[LRQHVHQWRUQRDODFURQRORJLDGHODVFDPSDxDVSDUWLFDV GH7UDMDQR³ ,Q7UDMDQR(PSHUDGRUGH5RPDKJYRQ-*RQ]iOH] 5RPD +DUWPDQQ8'DVSDOP\UHQLVFKH7HLOUHLFK2ULHQVHW2FFLGHQV6WXWWJDUW +DXVHU65Ä+DWUDXQGGDV.|QLJUHLFKGHU$UDEHU³ ,Q'DV3DUWKHUUHLFK XQGVHLQH=HXJQLVVHKJYRQ-:LHVHK|IHU+LVWRULD(LQ]HOVFKULIWHQ 6WXWWJDUW +DXVHU65Ä=XU'DWLHUXQJGHUDUVDNLGLVFKHQ7HWUDGUDFKPHQ³,Q9DULDWLR 'HOHFWDW *HGHQNVFKULIW IU 3 &DOPH\HU KJ YRQ 5 'LWWPDQQ XD  $OWHU2ULHQWXQG$OWHV7HVWDPHQW0QVWHU +X\VH 3K  'LH GUHLVSUDFKLJH,QVFKULIW âƗEXKUV, DQ GHU.DǥEDL =DUGXãW â.= %GH/RQGRQ ,QYHUQL]]L$Ä.LIULQ±ǺǾȋȋȅȊĭȇǼǿȃ³0HVRSRWDPLD ,VDDF%7KH/LPLWVRI(PSLUH2[IRUG



'XUD(XURSRV



.HQQHG\'/Ä7KH*DUULVRQLQJRI0HVRSRWDPLDLQWKH/DWH$QWRQLQHDQG (DUO\6HYHUDQ3HULRG³$QWLFKWKRQ .HQQHG\'/Ä7KH&RKRUV;;3DOP\UHQRUXPDW'XUD(XURSRV³ ,Q7KH 5RPDQDQG%\]DQWLQH$UP\LQWKH(DVWKJYRQ('ąEURZD.UDNyZ .HWWHQKRIHQ('LHU|PLVFKSHUVLVFKHQ.ULHJHGHV-DKUKXQGHUWVQ&KU QDFKGHU,QVFKULIWâƗKSXKUV,DQGHU.DǥEH\H=DUWRãW%HLKHIWH]XP7$92 5HLKH%:LHVEDGHQ .HWWHQKRIHQ(gVWOLFKHU0LWWHOPHHUUDXPXQG0HVRSRWDPLHQ'LH5HLFKV NULVHXQGGDV9RUGULQJHQGHU$UDEHUQ&KU 7$92.DUWH%9 :LHVEDGHQ .KQH + XQG $ /XWKHU  Ä7DOOâƝÌ ¬DPDG  'njU.DWOLPPX 0DJGDOX"³ 1RXYHOOHV$VV\ULRORJLTXHV%UqYHVHW8WLOLWDLUHV /HULFKH3Ä'XUD(XURSRV³(QF\FORSDHGLD,UDQLFD /HULFKH3Ä3RXUTXRLHWFRPPHQW(XURSRVDpWpIRQGpHj'RXUD"³,Q(VFOD YDJH JXHUUH pFRQRPLH HQ *UqFH DQFLHQQH +RPPDJHV j




$QGUHDV/XWKHU

0RXWHUGH5XQG$3RLGHEDUG³/DYRLHDQWLTXHGHVFDUDYDQHVHQWUH3DO P\UHHW+LWDX,, H VLqFOHDS-&³6\ULD 1RGHOPDQ 6K$  ³$ 3UHOLPLQDU\ +LVWRU\ RI &KDUDFHQH´ %HU\WXV   1RUWKHGJH$$%DPEHUXQG05RDI([FDYDWLRQVDWǥƖQD4DOǥD,VODQG ,UDT$UFKDHRORJLFDO5HSRUWV:DUPLQVWHU 1RYiN 0 XQG $ 2HWWHO  ³(LQ SDUWKLVFKU|PLVFKHU )ULHGKRI LQ 7DOO âƝÌ ¬DPDG2VW6\ULHQ´$QW: 1RYiN 0 $ 2HWWHO XQG & :LW]HO  'HU SDUWKLVFKU|PLVFKH )ULHGKRI YRQ 7DOOâƝÌ ¬DPDG0DJGDOD7HLO%HULFKWHGHU$XVJUDEXQJ7DOOâƝ̬DPDG 'njUNDWOLPPX%HUOLQ 1RYiN0XQG+
3

3

3



3

3

'XUD(XURSRV



6SHLGHO 0 Ä7KH5RPDQ 5RDG WR 'XPDWD -DZI LQ6DXGL $UDELD  DQG WKH )URQWLHU6WUDWHJ\RISUDHWHQVLRQHFROOLJDUH³+LVWRULD 6WLFNOHU7Ä*DOOXVDPRUHSHULEDW³"&RUQHOLXV*DOOXVXQGGLH$QIlQJHGHU DXJXVWHLVFKHQ +HUUVFKDIW LQ bJ\SWHQ $OWKLVWRULVFKH 6WXGLHQ GHU 8QLYHUVLWlW :U]EXUJ5DKGHQ:HVWI 6WRQHPDQ53DOP\UDDQGLWV(PSLUH$QQ$UERU 7HL[LGRU-8QSRUWURPDLQGXGpVHUW3DOP\UHHWVRQFRPPHUFHG¶$XJXVWH j&DUDFDOOD6HPLWLFD3DULV :HOOHV&%)LQN52XQG*LOOLDP-)7KH3DUFKPHQWVDQG3DS\UL7KH ([FDYDWLRQVDW'XUD(XURSRV)LQDO5HSRUW9,1HZ+DYHQ :LHVHK|IHU-'DVDQWLNH3HUVLHQ0QFKHQ±=ULFK :LOO(/HV3DOP\UpQLHQV/D9HQLVHGHVVDEOHV3DULV


MARKTORGANISATION UND PREISBILDUNG IN DER RÖMISCHEN KAISERZEIT Herbert Graßl Die Usancen der Preisbildung auf antiken Märkten sind von Wirtschaftshistorikern noch nicht ausreichend untersucht worden. Dokumentarische Quellen wie Kaufverträge sind hier nicht aussagekräftig, es gilt vielmehr das weitverstreute Material der narrativen Texte zusammenzutragen und auszuwerten. Ein erster Versuch in diese Richtung wird in vorliegender Arbeit unternommen. Für das Verständnis der antiken Wirtschaft ist diese Frage grundlegend, insbesondere für die Einschätzung der Marktökonomie oder welche Elemente einer solchen im Altertum bekannt waren. Nach Polanyi (Polanyi 1979, 177) kannte man erst ab dem 3. Jh. v. Chr. Ansätze einer Marktwirtschaft mit freier Preisbildung. Dies würde bedeuten, dass neben der altorientalischen Welt auch das klassische Griechenland weit von Marktstrukturen entfernt war. Eine genaue Quellenanalyse zeigt aber, dass dieses Bild korrekturbedürftig ist: schon im Athen des späteren 5. Jh. v. Chr. waren marktwirtschaftliche Prozesse voll entfaltet und wurden durch den Peloponnesischen Krieg verstärkt (Spielvogel 2001). Die massenweise Verbreitung des Münzgeldes hat diesen Prozess vorangetrieben, er war aber nicht davon abhängig, finden wir doch die Techniken des Markthandels auch mit Naturalien parallel zur Geldwirtschaft noch im 5. Jh. v. Chr. präsent (Aristoph. Ach. 898). Es sprechen aber einige Hinweise dafür, dass marktwirtschaftliches Verhalten in Hellas schon im 6. Jh. v. Chr. einsetzt. Ein Blick auf die antike Lebenspraxis und das Marktverhalten kann natürlich auch aus Erfahrungen auf heutigen Märkten1, insbesondere jenen, die in antiker Tradition stehen wie der orientalische Basar oder Suq, aber auch unseren Flohmärkten profitieren. Auf dem Markt erkundigt sich der Konsument zunächst nach dem Warenpreis2. Dies kann direkt beim Verkäufer geschehen, die Auskunft kann aber auch von Personen erbeten werden, die vom Markt zurückkehren. Preisanfragen betreffen so gut wie alle Waren: dazu zählen insbesondere Lebensmittel wie Getreide (Aristoph. Ach. 758), Brot (Greg. Nyss. Migne, PG 46,557; dazu Milewski 2000, 53 ), Gemüse (Epikt. ench. 25,3), Fleisch (Aristoph. Ach. 812; Teles p. 13), Fisch (Theophr. char. 4,15; Plaut. Aul. 373; Suet. gramm. 25,5; Athen. 6,224), Honig (Philogelos 188), Süßwaren (Athen. 13,43), Gebrauchsgüter wie Schuhe (Herondas 7,64), Felle (Theophr. char. 4,15), Wolle, Salben (Teles p. 13), Blumen (Anth. Pal. 12,8), Holz (Vita Aes. 60), Seile (Anth. Pal. 11,169), Bücher (Mart. 1,117,17; Gell. 9,4,1), Statuen (Aisop. 90) und andere Kunstgegenstände (Plin. nat. 35,88), selbstverständlich auch Vieh (Plaut. Men. 289; Varro rust. 2,1,20; 2,4,16) und Sklaven. 1

2

Zur Preisbildung in der Marktwirtschaft der Gegenwart: Handwörterbuch der Wirtschaftswissenschaften, Bd. 6 (1981), s.v.; dort wird auch auf staatliche Preisregulierungen mit Festpreisen oder Grenzpreisen Bezug genommen. Zu den Typen der Preisregulierung vgl. MayerMaly 1973, 141-1. Für den griechischen Markt vgl. Xen. mem. 1,2,36. Für Rom: Sen. epist. 42,8; dazu Weeber 1995, 146-50.

Herbert Graßl

353

Horaz lässt uns auf seiner Einkaufstour durch die Straßen Roms begleiten und erkundigt sich, was Mehl und Gemüse kosten (Hor. sat. 1,6,112: percontor quanti holus ac far). Aus seinem bescheidenen Einkauf bereitet er sich sein Abendbrot zu. Ein ausführliches Verkaufsgespräch kann man einem zweisprachigen Schulbuch3 entnehmen (Corp. Gloss. Lat. III 657 c. 13): „Ich gehe zum Kleiderhändler. Wie viel kostet der Mantel? - 100 Denare. - Wie viel der Regenmantel? - 200 Denare. - Das ist zu viel, nimm 100 Denare. - Um diesen Preis geht es nicht, so hoch kommt es mich beim Einkauf von den Lieferanten zu stehen. Was soll ich also geben? Soviel du meinst. - Gib ihm 125 Denare“. In diesem Gespräch will der Käufer den Preis bis auf die Hälfte herunter drücken, der Verkäufer nennt seinen Einkaufspreis und erhält am Ende 25% mehr. Es kommt auf dem antiken Markt immer wieder vor, dass Händler über ihre Einkaufspreise Auskunft geben, auch im Sklavenhandel4. Dieses Verhalten sollte die Ehrlichkeit der Händler und ihre mageren Gewinnspannen dokumentieren5. Im Schulbuchbeispiel ist es gelungen, vom Ausgangspreis 37,5% herunter zu handeln, was als ordentlicher Erfolg gelten kann. Bei einem Sklavenkauf hat man von 100 Minen auf 80 und schließlich 60 Minen handeln können, das heißt 40% vom verlangten Preis (Plaut. Persa 665, Powers 1944, 20, 37). Beim Kauf eines Smaragdes auf Zypern konnte die Kaufsumme von 6 auf 4 Aurei, also um ein Drittel gesenkt werden, was aber vom eitlen Flötenspieler Ismenias, der den Kauf in Auftrag gab, sogar getadelt wurde (Plin. nat. 37,6). Bücher konnte man sogar um die Hälfte des Ausgangspreises erstehen (Mart. 13,3). Schwieriger war das Handeln bei Lebensmitteln. Ein Versuch, den Preis für ein paar Fische von 10 auf 8 Obolen zu drücken, scheiterte am Widerstand des Händlers (Alexis bei Athen. 6,224). Die Käufer haben bei verderblichen Waren Druck auf den Verkäufer ausgeübt, waren aber dabei nicht immer erfolgreich. Die Fischhändler galten als besonders hartnäckig (Athen. 6,224 c-d). Dies wird auch an einer Episode bei Apuleius deutlich (Apul. met. 1,24)6: Um sich zu versorgen, geht der Romanheld Lucius auf den Lebensmittelmarkt (forum cupidinis) und sieht dort prächtige Fische ausgestellt: „Ich fragte nach dem Preis, den der Verkäufer mit 100 Sesterzen (centum nummis) angab. Ich lehnte das ab und erstand sie für 20 Denare (viginti denariis)“. Auf dem Weg vom Markt begegnete er Pythias, einem Mitschüler aus Athen, der jetzt das Amt eines Ädilen (= agoranomos) bekleidete. Dieser bot ihm seine Hilfe an und fragte nach dem Preis des Einkaufs, der mit 20 Denaren angegeben wurde. Daraufhin führte der Beamte seinen Freund auf den Markt zurück, erkundigte sich nach dem Händler und schrie diesen an: „Jetzt nehmt ihr nicht einmal auf unsere Freunde oder überhaupt auf Fremde Rücksicht, dass ihr für ein paar mickrige Fische einen hohen Preis verlangt und damit die blühendste Stadt Thessaliens wie eine Wüste durch Ver3 4

5

6

Friedländer 1922, 166; Drexhage et al. 2002, 286-7. Vita Aes. 27: Der Einkaufspreis für den Sklaven Aesop von 60 Denaren und ein Spesenaufwand von 15 Denaren ergeben einen Verkaufspreis von 75 Denaren; vgl. Aristoph. Pax 1240f.; dazu Spielvogel 2001, 161. Wenn Johannes von Gischala das Öl, das er in seiner Heimatstadt billigst eingekauft hat, in Caesarea zum zehnfachen Preis abgab (Ios. vita 13), mag dies eine unerfreuliche Ausnahme sein. Die Konsumenten rechneten aber stets mit hohen Gewinnen der Händler. Dazu Norden 1912, 167; Jakab 1997, 174.

354

Marktorganisation und Preisbildung

teuerung der Lebensmittel verödet“. Daraufhin schüttete er die eingekauften Fische auf die Straße, ließ seinen Amtsdiener darauf treten und sie zertrampeln. Lucius war darüber sehr bestürzt und sah sich um sein Geld und Essen gebracht. In diesem Beispiel wird der Einkauf von 100 auf 80 Sesterzen, also um ein Fünftel gedrückt. Der Ädil hält den Preis für überhöht und schreitet in vielleicht überzogener Weise dagegen ein. Als besonderes Ärgernis wurde angesehen, dass ein Fremder so behandelt wurde, was für das Image der Stadt abträglich sei. Dazu kommt noch, dass Käufer und Ädil befreundet waren. Außerökonomische Kategorien wie Freundschaft, Feindschaft, Einheimischer oder Fremder haben da und dort das Marktgeschehen und die Preisgestaltung beeinflusst7. So kommt es schon mal vor, dass jemand keine Ware erhält, wenn er mit dem Händler verfeindet war (vgl. Aristoph. Ach. 962ff.; dazu Spielvogel 2001, 79). In diese Lebenssphäre führt auch eine Geschichte, die Cicero von Theophrast erzählt (Cic. Brut. 172): Theophrast fragte eine alte Frau, wie teuer sie etwas verkaufe. Sie gab ihm ihre Antwort und fügte noch hinzu: „Fremder Herr, billiger geht’s nicht!“ Das ärgerte Theophrast gewaltig, da er nach so langem Aufenthalt in Athen immer noch als Fremder angesehen wurde. Insgesamt bleiben freilich außerökonomische Faktoren eher marginal. Preisnachlässe seitens der Händler wurden allgemein erwartet und auch gewährt (Iuv. 7,220f.). Dies kann auch in Form einer Draufgabe, also einer größeren Warenmenge für denselben Geldbetrag geschehen. Solche Zugaben wurden vom Konsumenten ausdrücklich verlangt (Athen. 7,309 d) oder vom Händler von sich aus gewährt (Aisop. 90). Im antiken Warenhandel wurde der Preis entweder nach dem Kaufgegenstand ausgerichtet, wobei selbstverständlich auf die Qualität der Ware und auch auf das Verhalten der Konkurrenten bedacht genommen wurde (Xen. mem. 3,10,10). Es existierte aber auch der Brauch, für einen traditionell eingespielten Geldbetrag eine bestimmte (und je nach Marktlage wechselnde) Warenmenge auszufolgen (Bab. Tal. baba batra 5,9; baba mecia 5,1). Dieser Brauch kann darauf zurückgehen, dass im Altertum die Masse an Kleingeld notorisch knapp war und für die Feinabstimmung des Markthandels nicht genügte. Nicht immer kommt es zwischen Käufer und Verkäufer zu einer Einigung über den Preis, so mancher verärgerte Konsument zog daraus seine Konsequenzen, wie in einer Komödie des Plautus (Plaut. Aul. 373-378): „Da kam ich auf den Markt; ich sehe mich nach Fischen um; „die stehen hoch im Preise“, heißt’s; Lammfleisch, Rindfleisch, Kalbfleisch, Seefische, Schweinefleisch – alles war teuer und für mich noch teurer, weil ich zum Einkauf nicht die Mittel habe. Voll Zorn geh ich von dort weg. Nichts hab ich gekauft. So hab ich’s all den Schurken ordentlich besorgt.“ Ein Konsumverzicht wie in diesem Fall war natürlich keine wirksame Dauerstrategie gegen hohe Preise (vgl. auch Anth. Pal. 11, 169). Ein Kaufboykott kommt aber sowohl individuell als auch als Massenphänomen immer wieder ins Gespräch. In einem Fall war diesem Vorgehen auch ein Erfolg beschieden. Aristoteles schildert einen Aufstand der Konsumenten in Naxos (Aristot. fr. 558 = Athen. 8, 348 b-c): „Bei den Naxiern wohnte der größte Teil der Wohlhabenden in der Stadt, die anderen verstreut auf dem Lande. In einem 7

Dazu Millett 1990, 184; Harris 2002, 76.

Herbert Graßl

355

der Dörfer, mit Namen Leistadai, wohnte Telestagoras, ein sehr reicher, in gutem Rufe stehender und vom Volk unter allem möglichem anderem mit Geschenken, die ihm täglich gebracht wurden, geehrter Mann. Sooft sie nun aus der Stadt hinabgingen und etwas von dem, was verkauft wurde, herunterhandelten, war es bei den Verkäufern üblich, dass sie sagten, sie würden es eher dem Telestagoras schenken, als für so wenig Geld verkaufen. Ein paar junge Leute waren nun dabei, einen großen Fisch zu erstehen, und der Fischhändler sagte dasselbe. Da wurden sie zornig, da man das immer wieder hörte, und zogen in angetrunkenem Zustand lärmend zu jenem hin. Telestagoras empfing sie freundlich, sie aber taten ihm und seinen beiden heiratsfähigen Töchtern Gewalt an. Darüber erregten sich die Bewohner von Naxos so sehr, dass sie zu den Waffen griffen und gegen die jungen Leute einschritten. So kam es zu einem Riesenaufstand, wobei Lygdamis die Bewohner von Naxos anführte“. Sollte diese Hintergrundgeschichte, die ja die Entstehung der Tyrannis auf Naxos (um 540 v. Chr.) erklären will, vertrauenswürdig sein, würde dies für das 6. Jh. v. Chr. nicht nur einen voll entwickelten Markthandel bezeugen, sondern auch Solidaritätsbewusstsein auf Seiten der Konsumenten, was schließlich in einen politischen Umsturz mündete. Auch in diesem Fall stehen die Fischverkäufer am Pranger. Als besonders ungehobelt galt nach Theophrast (Theophr. char. 15,4) ein Händler, der sich weigert, über seine Preise Auskunft zu geben. Ein solches Verhalten zielt offensichtlich darauf ab, Preisvorstellungen und Zahlungswilligkeit der Kundschaft auszuloten. Manche Händler haben die Preisanfrage an den Kunden zurückgegeben. Sie bestanden auf ein Angebot oder der Kaufinteressent trat von sich aus mit einem Anbot an den Händler heran8. Es kam auch vor, dass ein Käufer überhaupt nicht nach dem Preis fragt, einen solchen vielmehr selbst bestimmt und auch bezahlt9. Dieser Kunde war mit Marktlage und Preisgefüge sicher gut vertraut. Ein solches Vorgehen ist bei geringwertigen Gütern, z.B. Gemüse (Vita Aes. 34f.) ebenso der Fall wie bei Götterstatuen (Anakr. fr. 11). Ein Kauf, der dem Käufer die Festsetzung des Preises überlässt, war nach römischem Recht ein negotium imperfectum (Dig. 18,1,35,1)10: „Es steht fest, dass das Geschäft noch nicht zustande gekommen ist, wenn der Verkäufer zu dem, der kaufen will, sagt: „Der Kauf ist abgeschlossen für den Preis, den du willst“ oder „den du 8

Lukian. vit. auct. 11: in der Satire werden für einen Kyniker zwei Obolen geboten; Eriphos bei Athen. 3,84: für einen Granatapfel wird eine Obole geboten; Anakr. fr. 11; Herondas 7, 64 – 79. 9 Schon Aristot. eth. Nic. 1164 b sieht die Festlegung des Wertes im Bereich des Käufers angesiedelt, vgl. dazu auch Aug. serm. 117,1 (Migne, PL 38,662). Aug. serm. 75 (Migne, PL 39,1890) zitiert einen Fall, dass ein Käufer sein Anbot über die Hälfte verminderte, als er den Verkäufer in wirtschaftlichen Schwierigkeiten sah. Dass ein Käufer mit öffentlicher Machtstellung dies auch ausnutzen konnte, den Preis zu diktieren, ist bekannt; vgl. dazu das Beispiel der Gattin Kaiser Valentinians (Ioh. Mal. 13,31; Chr. pasch. 1, 559,7): „Als der Kaiser erfuhr, dass seine Gattin Marina ein Grundstück in der Vorstadt zu einem günstigeren Preis, als es nach dem Ertrag wert war, gekauft hat und als Kaiserin den Preis festgesetzt hatte, schickte der Kaiser Gutachter, die das Grundstück schätzen sollten. Als er erfuhr, dass es viel mehr wert war, war er gegen die Kaiserin aufgebracht, verbannte sie aus der Stadt und gab der Frau das Grundstück zurück“. 10 Dazu Daube 1991, 767-72.

356

Marktorganisation und Preisbildung

für gerecht hältst“ oder: „den du schätzt“. Trotz dieses Makels werden solche Geschäfte immer wieder angesprochen. Preisverhandlungen werden selbstverständlich mündlich geführt. Das laute Werben mit Waren war auf der Agora, dem forum und dem macellum üblich. Dabei war der Warenhandel nicht auf diese auch im juristischen Sinne fest definierten Plätze beschränkt; für den Produzentenhandel müssen die Geschäftsviertel insgesamt im Blick bleiben. Ob das Anpreisen so wie mit dem Umfang und der Qualität der Waren auch mit deren Preis geführt wurde, wird aus der Überlieferung nicht deutlich. Die räumliche Konzentration der Berufs- und Handelssparten hat dem Käufer eine raschere Information über das Warenangebot ermöglicht. Hinsichtlich der Preise war der Konsument auf Einzelgespräche und Verhandlungen angewiesen. Erst in römischer Zeit sind Geschäftsaufschriften mit Preisauszeichnung bekannt. Diese Erweiterung des mündlichen Preisgespräches durch die Schriftform ist für Geschäftsleute wie Konsumenten ein folgenschwerer Schritt. Schriftliche Preisankündigungen binden den Geschäftsinhaber wie im Falle einer Gastwirtin aus Pompeji (CIL IV 1679): Die Kunden werden mit Preis und Qualität angelockt und das noch dazu in Versform: „Man kann hier für ein As trinken; für zwei As trinkst du was besseres; für vier As trinkst du Falerner“. Ob die räumliche Nähe von Geschäftslokalen auch die Händler dazu veranlasste, Preisvergleiche anzustellen, ist durchaus möglich, aber nur bei gleichartiger Massenware sinnvoll. Vor unseren Augen tut sich somit ein Markttreiben auf, wo das Feilschen um Preise gang und gäbe war. Trotzdem war dieses Verhalten nicht ganz ohne Probleme. Ein hartnäckiger Einkäufer musste oft zur Kenntnis nehmen, dass Qualität ihren Preis hat. Dies galt insbesondere bei Fleisch, wie es auch ein Sprichwort ausdrückt: „Kein Feilscher kauft ein gutes Fleisch“11. Um Fleisch für Götteropfer sollte auch nicht gehandelt werden (Plin. nat. 28,201), offenbar weil dadurch die sakrale Sphäre verletzt wird. Die Inanspruchnahme der Götterwelt im Kaufhandel, vor allem die dabei üblichen Eide, war verpönt. Schon Platon (Plat. leg. 917 c) hat dies verurteilt und in seinem Gefolge haben auch nicht wenige Kirchenväter (z.B. Clem. Al. Paid. 3,79,1) dagegen angekämpft (Ioh. Chrys. cat. bapt. 2,1,22): „Ein tiefer Abgrund ist das viele Schwören – und zwar nicht nur wenn es um geringfügige Dinge, sondern auch wenn es um bedeutsame Angelegenheiten geht. Ob wir Gemüse kaufen und um zwei Obolen streiten oder Sklaven zürnen oder drohen, immerfort rufen wir Gott zum Zeugen an“. Kleinhändler galten eben als notorische Lügner, wie das besonders ausfällig Ovid (Ov. fast. 5,663ff.) rügt. Platon (Plat. leg. 917b) stellte die Forderung auf, pro Tag nur einen Preis zu nennen, was für Verkäufer und Käufer Geltung haben sollte. Diese Maxime fand trotz aller Kritik aus der Lebenspraxis (Alexis bei Athen. 6,226) immer wieder Nachfolger (z.B. Clem. Al. Paid. 3, 78,4), so auch in Cicero (Cic. off. 3,61): „Wenn beide (Käufer und Verkäufer) zur Preisbestimmung kommen, werden sie ihn nicht mehr als einmal bestimmen“. Philosophen forderten ein ethisch vertretbares Verhalten gerade auch im Wirtschaftsleben. Im Sinne der geforderten Gerechtigkeit war es auch in bestimmten Fällen geboten, freiwillig einen höheren Preis zu bezahlen als 11 Com. Adesp. 277 Kock; Ael. Dion. o 33; Apostol. 13,30; Poll. 3,126; Suda Append. prov. 4,35.

Herbert Graßl

357

er vom Verkäufer verlangt wurde. Dies kam dann zum Tragen, wenn der Verkäufer in Unkenntnis der Marktlage für ein bestimmtes Produkt handelte. Ein bemerkenswertes Beispiel dafür liefert der alexandrinische Philosoph Hermeias im 5. Jh. n. Chr. (Damaskios vita Isid. bei Phot. bibl. 242,74): „Als eines Tages ein unerfahrener Mann ihm ein Buch unter seinem wahren Wert verkaufen wollte, korrigierte er ihn und kaufte das Buch um einen höheren Preis. Auch sonst verhielt er sich so gerecht, während sich andere nicht darum kümmerten. Wenn immer ein Verkäufer den gerechten Preis nicht wusste, nannte er ihn“. Auch Augustinus kommt auf einen ähnlichen Fall zu sprechen (Aug. trin. 13,3). Dieses Beispiel des Kirchenvaters übte auf die mittelalterliche Wirtschaftsethik großen Einfluss aus. Freilich war dem Kirchenlehrer bekannt, dass das übliche Verhalten seiner Zeitgenossen ein völlig anderes war, was er mit einem Vers aus einem unbekannten Mimus (fr. 12 Ribbeck) belegt: „vili vultis emere et caro vendere“. Das andersartige und für Augustinus beispielhafte Verhalten des Buchliebhabers wird mit der traditionellen Munifizenz der städtischen Oberschichten verglichen. Beispiele wie diese verdeutlichen einmal mehr das Problem der Information im Wirtschaftsleben. In diesen Fällen war nicht der Verkäufer und Händler, wie aus dem Berufsbild heraus zu erwarten, sondern der Käufer informiert. Es ist auch durchaus möglich, dass dem Intellektuellen die Unterbewertung geistiger Erzeugnisse nicht so recht gefiel. Jedenfalls hat er sein Wissen nicht zum persönlichen ökonomischen Vorteil eingesetzt. In besonderen Fällen mochte der Käufer über ein Billigangebot zunächst verwundert sein, wie es im Falle des Verkaufs des Sklaven Aesop berichtet wird (Vita Aes. 15): „Für wie viel verkaufst du diesen Taugenichts? – Für drei Obolen – Für wie viel? – Gib was du willst! Der Sklavenhändler händigte ihm eine Kleinigkeit aus, und damit war der Kauf abgeschlossen“. Die Idee eines gerechten Preises12 war im griechischen Altertum spätestens seit dem 4. Jh. v. Chr. in Politik, Moralphilosophie (besonders der Stoa) und Popularethik eingeführt. In die römische Welt fanden diese Ideen ebenfalls Eingang. Es ist nun ganz interessant, bei Seneca eine Debatte zwischen dem philosophisch–ethischen und marktökonomischen Zugang zum Thema zu verfolgen (Sen. benef. 6,5,3): „Manche Dinge, heißt es, sind mehr wert als der Preis, um den sie verkauft worden sind, und deswegen schuldest du mir für sie zusätzlich etwas, obwohl sie gekauft worden sind.“ Erstens – was kommt es darauf an, wie viel sie wert sind, wenn über den Preis zwischen Käufer und Verkäufer Einvernehmen besteht? Zweitens – nicht habe ich es um seinen Preis gekauft, sondern um deinen. „Mehr ist es wert“, heißt es, „als den Preis, um den es verkauft worden ist“, doch um einen höheren Preis konnte es nicht verkauft werden. Der Preis aber einer jeden Sache richtet sich nach der Situation; wenn du diese Dinge richtig lobst, sind sie soviel wert, um wie viel teurer sie nicht verkauft werden können; außerdem schuldet dem Verkäufer nichts, wer gut gekauft hat. Ferner – auch wenn diese Dinge mehr wert sind, so ist das dennoch nicht deine Leistung, dass man nicht nach Nutzen und Wirkung, 12 Zu den griechischen Wurzeln dieser Vorstellung: Schachtschabel 1939, 33-48; Brinkmann 1939, 418-37; Genzmer 1937, 26-9; Herrmann 1990, 384-94; zu Aristoteles: Lowry 1974, 57-63. Die Idee vom gerechten Preis war auch im republikanischen Rom schon bekannt: Herz 1988, 39; Malmendier 2002, 155-62.

358

Marktorganisation und Preisbildung

sondern nach Gewohnheit und Marktpreis wertet“. Es fällt auf, dass der Philosoph an dieser Stelle einen klar marktwirtschaftlichen Standpunkt vertritt und damit voll auf dem Boden des römischen Rechts steht, das dem Willen der Marktteilnehmer in der Preisgestaltung freie Hand gewährte und auch das Handeln zum eigenen wirtschaftlichen Vorteil zuließ (Dig. 19,2,22,3; 4,4,16,4). An anderer Stelle freilich kritisiert Seneca die Ökonomisierung seiner Umwelt mit scharfen Worten, etwa wenn es um den Verkauf von Eis zu wechselnden Marktpreisen geht (Sen. nat. 4,13,8). Ein Faktum wie dieses war in seinen Augen deshalb besonders anstößig, da Wasser kostenlos zur Verfügung stand. Ein angemessener Preis13 war beiden Vertragsparteien ein Anliegen, ließ immer eine größere Bandbreite für Verhandlungen offen und war also nicht auf eine ganz bestimmte Summe fixiert. Nicht immer war darüber ein Einvernehmen herzustellen. Bisweilen wurde die Festsetzung in das billige Ermessen (aequitas) einer Partei, z.B. des Verkäufers gelegt (Symm. epist. 4,60,2 ; dazu Steinwenter 1957, 21). Es ist auch nicht deutlich auszumachen, wie weit Preis- und Werttheorien von Philosophen auf den alltäglichen Geschäftsverkehr eingewirkt haben. Auf dem antiken Markt wird unter einem angemessenen Preis der gewohnte oder marktübliche Preis verstanden. Eine Tendenz zur Objektivierung der Preise begegnet schon bei Platon (Plat. leg. 920 c), der die Preisfestlegung nach Selbstkosten und einem mäßigen Gewinn vorsieht, worüber erfahrene Fachleute zu befinden haben. Im Alltagsgeschäft wurde eine kalkulatorische Kostenrechnung nur in Ansätzen betrieben, etwa im produzierenden Gewerbe. Herondas (7) lässt seinen Schuster die hohen Schuhpreise mit den gestiegenen Forderungen der Zulieferer (Farbenhersteller, Gerber) erklären. Forderungen der Kunden nach zu hohen Preisnachlässen, die an oder sogar unter die Einstandspreise reichten, erbitterten die Händler. Ein erboster Ausruf eines Geschäftsmannes findet sich auf einer Ladenwand in Pompeji (CIL IV 9839): „Ich verwünsche die Armen. Wer etwas gratis verlangt, ist verrückt. Er soll zahlen und die Ware mitnehmen“. Um richtiges Marktverhalten zu erlernen, konnte man sich an Fachleute halten. Ein Lynkeus aus Samos hat (wohl im 3. Jh v. Chr.) dazu eine eigene Schrift publiziert14, die durch einige Hinweise bei Athenaios bekannt ist (Athen. 6,228 c): „Lynkeus aus Samos verfasste sogar für einen, der die Preise herunterhandelt, eine „Kunst des Einkaufens“ und führt aus, was er zu den halsabschneiderischen Fischhändlern sagen muss, um vorteilhaft und ohne Ärger einzukaufen, was er will“. An anderer Stelle (Athen. 7,13f.) werden aus dieser Schrift alle jene Techniken angesprochen, die beim Handeln Beachtung verdienen: die Fixierung auf 13 Dafür standen mehrere Ausdrücke zur Verfügung: aequum pretium war die Terminologie des Alltags (Tab. Vindol. II 302; dazu Drexhage 1997, 21; Liv. 7,21,8; Plaut. Persa 585), aber auch von Juristen (Dig. 30,66; 47,11,6 pr.), iustum pretium bevorzugten Philosophen und Rhetoren (Symm. epist. 9,149) und wurde auch die übliche Wendung bei Juristen (Dig. 1,12,1,11; 6,1,70; 10,3,10,2; 11,7,12 pr.; 20,1,16,9; 23,3,1,2,1; 24,1,36 pr.; 28,8,5,1; 34,1,36 pr., 38,5,1,12; 38,5,1,15; 40,5,30,6; 40,5,31,4; 49,14,3,5; Tit. Ulp. 2,11; Cod. Iust. 3,37,3; 4,44,2.8; 4,46,2; 5,9,6,5; 5,18,6,2; 5,37,28,5; 7,72,10,3; 8,40,18; 10,26,1,2; Nov. 120,6,2). Gleichbedeutend sind suum pretium (Dig. 25,2,9) und iusta aestimatio (Dig. 23,3,12,1; 31,54; 32,14,2; Cod. Iust. 3,37,3). 14 Bei Millett (1990,194) wird der Verfasser fälschlich als Duris bezeichnet.

Herbert Graßl

359

bestimmte Händler, die Herabsetzung der Ware, der Vergleich mit anderen Produkten, die Vertreibung von Kaufinteressenten. Dadurch soll eine Annahme des Preises durch den Verkäufer erzwungen werden. Dabei fällt auch die griechische Bezeichnung für den Feilscher: dysone. Die lateinische Entsprechung ist der coctio15 (Paul. Fest. 44): „Coctiones dicti videntur a cunctatione, quod in emendis vendendisque mercibus tarde perveniant ad iusti pretii finem“. Die behandelten Quellenzeugnisse lassen Gewinnsucht und Konkurrenz der Händler16, aber auch Preisbewusstsein und Verhandlungsgeschick der Käufer erkennen. Dazu wird uns das Schwanken in Angebot und Nachfrage als entscheidender Faktor der Preisbildung nahegebracht17, zu dem die Probleme der Information für Konsumenten und manchmal auch Händler. Diesem Marktgeschehen stehen aber auch Zeugnisse für Preiskontrollen, Festlegung von Maximal- und Fixpreisen entgegen. Die staatlichen Eingriffe in das Preisgeschehen wurden in der Forschung zuletzt intensiv diskutiert und können an dieser Stelle nicht näher untersucht werden. Für die griechische Polis bis in die Spätantike hinein kann generell festgehalten werden, dass Fixpreisverordnungen18 nur in Ausnahmesituationen erlassen wurden, so etwa bei vorhersehbaren Versorgungsengpässen, wie sie etwa durch große Menschenansammlungen auf Festen und ähnlichen Anlässen vorkamen. Dadurch war der Markt gestört und führte zu starken Abweichungen bei Angebot und Nachfrage. Im Regelfall hatte der agoranomos oder ein vergleichbarer Beamter19 die Kompetenz im Einzelfall einzuschreiten. Dadurch bildete sich eine feste Tradition in der Führung dieses Amtes aus. Besonderen Regelungsbedarf erforderte die Sicherstellung der Grundversorgung. Fixpreise schlossen jegliches Verhandeln am Markt aus, Maximalpreise dagegen schützen die Konsumenten vor Preiswucher, unterbanden aber weder die Konkurrenz der Händler und das Feilschen am Markt. Durch Beschränkungen des Zwischenhandels konnte die Tendenz zur Verteuerung ebenso eingedämmt werden. Auch in Rom wurde schon in der Republik das Instrumentarium von Preisobergrenzen 15 Zum coctio: Colin 2000, 151; De Francisci 1955, 214. 16 Händler konkurrenzierten sich auch, wenn sie beim Produzenten einkauften: Apul. met. 5,4; zum Wettbewerb der Händler: Rathbone 1991, 278-306, 1997, 206-12; de Ligt 1993, 213; Kudlien 1994, 1-39; 1999, 99-113. 17 Zur Praxis der Getreidehändler in Athen, den Preis mehrmals am Tag um eine Drachme zu erhöhen vgl. Lys. 22,12; zu Steigerungen der Warenpreise im Macellum: Cic. div. 2,27,59; zur Haltung Ciceros vgl. Giardina 1986, 281-86; Preissteigerungen werden durch eine gestiegene Nachfrage hervorgerufen: Varro rust. 3,2,16; Diphilos bei Athen. 6,224; beim Sinken der Nachfrage gibt auch der Preis nach: Calp. Piso fr. 8 = Gell. 11,14; Tac. ann. 6,16; zum Feilschen auf antiken Märkten: Wacke 1977, 184-246; Millett 1990, 194; Drexhage et al. 2002, 125-86; Ps. – Quint. decl. 12,21: cocionari. 18 Dazu Descat 1997,13-20; Migeotte 1997,33-52; Bresson 2000, 152-82.; Wiemer 1997, 195215: der festgelegte Höchstpreis für Getreide macht etwa das Doppelte des Normalpreises aus, sollte aber nur einen Tag in Geltung sein; dazu auch Herz 1988, 186. 19 Zu diesem Amt: Jakab 1997, 73-79; nach Aristot. Ath. pol. 51,3 soll Getreide am attischen Markt „ehrlich“, das heißt zum gerechten Preis verkauft werden. Rosivach (2000, 47-50) sieht darin eine Profitbegrenzung für die Getreidehändler; nach Lys. 22,6; 8 sind Handelsspannen für Getreide festgeschrieben. Für Fische waren in Athen Opsonomoi zuständig: Sophil. 2 bei Athen. 6,228 B.

360

Marktorganisation und Preisbildung

eingesetzt (Plin. nat. 14,95; dazu Detlefsen 1900, 599). Das zuständige Organ war nicht der Ädil, sondern entweder die Edikte der Zensoren oder eigene Gesetze (Gell. 2,24,12; Macr. Sat. 3,17,11; dazu Kunkel und Wittmann, 1995, 482). Auch in der Kaiserzeit wurde bei Grundnahrungsmitteln immer wieder in diese Richtung gewirkt20. Diese eher punktuellen Maßnahmen unterbanden aber die Kräfte des Marktes in keiner Weise. So ist es sicher überzogen, davon zu sprechen, dass in Rom kaum eine freie Preisbildung und deshalb auch keine Marktwirtschaft herrschte (Schneider 1998, 671-321). Solche summarischen Festlegungen verkennen nicht nur weite Bereiche der antiken Alltagsrealität, sie kontrastieren auch die antike Wirtschaft in sehr einseitiger Weise mit unserer heutigen Marktwirtschaft, die aber ebenso ihre gar nicht wenigen dirigistischen und monopolistischen Elemente kennt. Staatliche oder behördliche Eingriffe erfolgten im Altertum nie zum Selbstzweck und schon gar nicht zur Umsetzung bestimmter Staats- und Gesellschaftsentwürfe. Man reagierte vielmehr auf drängende Herausforderungen, etwa um die Versorgung der städtischen Zivilbevölkerung oder die von Heeresangehörigen in Krisenzeiten zu sichern. Dabei griff man auf Instrumente zurück, die schon die griechische Tradition anbot, auch wenn ihre Tauglichkeit nicht bewiesen war. Es ist auch nicht zu übersehen, dass diese staatlichen Versuche in der Krise des 3. Jh. n. Chr. bei Diokletian einen Höhepunkt erlebten. So einzigartig das Preisedikt wegen des universalen Anwendungsraumes und der Vollständigkeit der Regelmaterie auch dasteht, es war sicher nicht als dauerhafte Norm gedacht, die eine Marktökonomie ersetzen sollte22. Denn auch in der Spätantike waren eine freie Preisgestaltung und ein Verhandeln um Preise erlaubt und wurde auch betrieben23. Den Korporationen, die vom Staat in immer größerem Umfang zur Sicherstellung öffentlicher Aufgaben in die Pflicht genommen wurden, oblag auch das wirtschaftliche Überleben ihrer Mitglieder, was auch zu Preisabsprachen und Festlegung von Mindestpreisen führte (Dittmann–Schöne 2001, 74-6). Dies schloss aber Konkurrenz am Markt keineswegs aus24. Kartellbildungen wurden auch eingedämmt (Cod. Iust. 4,59,2). Wenn die Kaiser der Spätantike punktuelle Fixpreise für Grundnahrungsmittel verordneten25, so unterschieden sie sich aus der Langzeitperspektive gesehen nur in Nuancen von früheren Jahrhunderten. Auch 20 Suet. Tib. 34; Tac. ann. 2,87; 15,39; SHA Comm. 14,3; zur Geschichte der Preisregelung in Rom: Ermatinger 1996, 67-71; Herz 1988, 148-50; 208-20. 21 Zur Frage der Marktökonomie in Rom: Temin 2001, 169-81(befürwortet die Existenz von Marktwirtschaft und lokal verbundener Märkte); in der jüngeren, besonders angelsächsischen Forschung wird die Rolle des Marktes hervorgehoben: Paterson 1998, 149-67. 22 Dazu Meißner 2000, 79-100; Der Statthalter in Phrygien Fulvius Asticus propagierte das Edikt des Kaisers als Festsetzung gerechter Fixpreise, die auf ewig gelten sollten; damit hat er die Absicht des Kaisers uminterpretiert. 23 Cod. Theod. 3,1,1; 3,1,4; 3,1,7; Cod. Iust. 4,44,15; 4,44,8. 24 Noethlichs 1985, 109-114, hat gezeigt, dass die Marktpreise der Spätantike und die verordneten Fixpreise sehr nahe bei einander liegen. 25 Schweinepreise: Cod. Theod. 14,4,2; 14,4,3; 14,4,4; Weinpreise: Cod. Theod. 11,2,2; Brotpreis: Cod. Theod.14,19. Die verordneten Preise richteten sich am Niveau des freien Marktes am Herstellungsort aus: Cod. Theod. 14,2,3; Cod. Iust. 10,27,2; vgl. Dig. 35,2,63,2. Zu monopolistischen Tendenzen und der Preisbildung in der Spätantike Giardina 1981, 123-46.

Herbert Graßl

361

hinsichtlich der Preispolitik und des Marktgeschehens muss das Bild vom spätrömischen Zwangsstaat zurechtgerückt werden. Das bisher gezeichnete Bild des Marktgeschehens kann durch eine Auswertung der im Talmud gesammelten jüdischen Texte ergänzt und abgesichert werden. Wenngleich dieses Material einer bestimmten ethnischen, kulturellen und sprachlichen Gruppe entstammt und auch auf diese bezogen ist, so stand diese Bevölkerungsgruppe doch in vielfältigen ökonomischen Beziehungen zur außerjüdischen Welt und war den Traditionen seiner kulturellen Umwelt verpflichtet. Wir finden in diesen Texten ausreichend Hinweise auf das ständige Schwanken der Marktpreise26, den unlauteren Wettbewerb durch Werbemaßnahmen27, die Konkurrenz der Händler28. Besonders hervorgehoben werden soll das Lieferungsgeschäft zum günstigsten Marktpreis, verbunden mit einer Rückforderung des zuviel bezahlten Geldes. Dies entspricht in Ansätzen der heutigen Bestpreisgarantie. Eine derart konsumentenfreundliche Regelung gab es im römischen Recht nicht. Hier konnte sich nur der Verkäufer in bestimmten Geschäftsfällen (Immobilien- und Sklavenhandel) entsprechend absichern29. Auch die spätantike laesio enormis30 schützte nur den Verkäufer. Im Gegensatz dazu ist die Vorschrift gegen Übervorteilung im jüdischen Recht besonders konsumentenfreundlich, da hier auch der Käufer geschützt war. Schon bei einem Sechstel des Kaufpreises konnte man das Geschäft rückgängig machen31. Andere Vorschriften wiederum schützten die Händler32, die ihren Informationsvorsprung bzw. ein unter-schiedliches Preisniveau in benachbarten Orten entsprechend nutzen konnten, was zur Angleichung der Preise und Interdependenz lokaler Märkte führte33. Vertraute Themen sind weiters Preisregelungen34 oder die Einschränkung des Handels mit Grundnahrungsmitteln35. Bei günstigen Kaufgelegenheiten war eine spezielle Information der Bevölkerung vorgesehen36. Diese Debatten unter den jüdischen Schriftgelehrten sind sowohl für Althistoriker wie auch den modernen Wirtschaftswissenschaftler von großem Interesse, zeigen sie doch ein ständiges Ringen zwischen marktwirt26 27 28 29 30

31 32

33 34 35 36

Tal. Bab. baba batra 5,8. Tal. Bab. baba mecia 4,12, dazu Ohrenstein und Gordon, 1992, 64-66. Zu Handel und Preisregelungen im römischen Palästina: Sarai 1994, 316-20. Dazu Sieg 1933; Peters 1973, 7-49. Dazu zuletzt Pennitz 2002, 575-89 mit Verweis auf die einschlägige Literatur. Nach Pennitz war dieser Rechtsbehelf für jene Personen gedacht, die aus Unerfahrenheit oder Ungeschicklichkeit oder wegen irriger Vorstellungen über den Warenwert ihr Gut verschleudert haben. Tal. Bab. baba mecia 4,3; dies galt nicht bei Grundstücks- und Sklavenkäufen; zur laesio enormis im Talmud Kohler 1907, 189. Tal. Bab. baba mecia 4,10: „Man darf nicht jemanden fragen: „Was kostet diese Sache?“, wenn man nicht die Absicht hat, sie zu kaufen“. Diese Regel sollte nur kaufwillige Interessenten in ein Preisgespräch eintreten lassen. Tal. Bab. baba mecia 5,7, Gemara. Tal. Bab. baba mecia 5,7 unterscheidet Märkte mit amtlich geregelten Preisen, das heißt mit Marktbeamten, von kleinstädtischen Märkten, die keine festgesetzten Preise haben. Tal. Bab. baba batra 5,10 Dies geschah durch Blasen mit Instrumenten auch am Sabbat, nach einer Ansicht allerdings nur, wenn der Preis um 40% gesunken ist.

362

Marktorganisation und Preisbildung

schaftlichen und dirigistischen Elementen. Dieser Antagonismus ist freilich nicht auf die Alte Welt beschränkt und prägt auch das Wirtschaftsleben unserer Zeit. Summary Market Organization and Price Fixing during the Roman Imperial Age The practice of price fixing has long been ignored by ancient historians, but is an indispensable requirement for the understanding of the way a market function. Supplier and consumer are dominated by competition, information is highly important for haggling over prices. Those sort of texts which reflect every day life clearly show to what extent the mechanisms of the market characterized the ancient, in particular the Roman economy. Vital principals of the free market and in therefore of free price fixing were predominant.

Herbert Graßl

363

Bibliographie Bresson, A. 2000. La cité marchande. Ausonius Publications: Scripta Antiqua 2. Paris: De Boccard. Brinkmann, C. 1939. “Geschichtliche Wandlungen in der Idee des Gerechten Preises”. Die Welt als Geschichte 5: 418-37. Colin, X. 2000. “Commercants itinerants et marchands sedentaires dans l'Occident romain”. Mercati permanenti e mercati periodici nel mondo romano. Ed. Elio Lo Cascio, 149-60. Bari: Edipuglia. Daube, D. 1991. Collected Studies in Roman Law 2. Frankfurt/Main: Vittorio Klostermann. De Francisci P. 1955. “Iustum pretium”. Studi in onore di Ugo Enrico Paoli. Florenz: Felice le Monnier. Descat, R. 1997. “Les prix dans l' inscription agoranomique du Pirée”. Economie antique. Prix et formation des prix dans les économies antiques, 13-20. Saint– Bertrand-de – Comminges. Detlefsen D. 1900. “Die Wertangaben in der Naturalis Historia des Plinius”. Hermes 35: 584-601. Dittmann-Schöne, I. 2001. Die Berufsvereine in den Städten des kaiserzeitlichen Kleinasiens. Regensburg: S. Roderer Verlag. Drexhage, H-J. 1997. “Preise im römischen Britannien (1. – 3.Jh. n. Chr.)”. Miscellanea oeconomica. Studien zur antiken Wirtschaftsgeschichte. Ed. K. Ruffing und B. Tenger, 13-25. St. Katharinen: Scripta Mercaturae Verlag. Drexhage, H.-J., Konen, H., Ruffing, K. 2002. Die Wirtschaft des Römischen Reiches (1. – 3. Jahrhundert) Eine Einführung. Berlin: Akademie Verlag. Ermatinger, J.W. 1996. The Economic Reforms of Diocletian. St. Katharinen: Scripta Mercaturae Verlag. Friedländer, L. 1922. Darstellungen aus der Sittengeschichte Roms in der Zeit von Augustus bis zum Ausgang der Antonine 1. Leipzig: S. Hirzel. Genzmer, E. 1937. “Die antiken Grundlagen der Lehre vom gerechten Preis und der laesio enormis”. Deutsche Landesreferate zum II. Internationalen Kongreß für Rechtsvergleichung im Haag 1937. Ed. E. Heymann. 25 – 64. BerlinLeipzig: Walter de Gruyter & Co. Giardina, A. 1981. “Aristocrazie terrieri e piccola mercatura. Sui rapporti tra politico e formazione dei prezzi nel tardo impero romano”. Quaderni Urbinati di cultura classica 36:123 – 46. Giardina, A. 1986. “Le merci, il tempo, il silenzio. Ricerche su miti e valori sociali nel mondo greco e romano”. Studi storici 27: 277 – 302. Harris, E.M. 2002, “Workshop, marketplace and household: the nature of technical specialization in classical Athens and its influence on economy and society”. Money, Labour and Land. Approaches to the economies of ancient Greece, ed. P. Cartledge, E.E. Cohen, L. Foxhall. 67 – 99. London/ New York: Routledge.

364

Marktorganisation und Preisbildung

Herrmann, J. 1990. “Der Gedanke des iustum pretium in der Antike”. Kleine Schriften zur Rechtsgeschichte. Ed. G. Schiemann. MünchBeitr 83. 384 – 94. München: C.H. Beck'sche Verlagsbuchhandlung. Herz, P. 1988. Studien zur Römischen Wirtschaftsgesetzgebung. Die Lebensmittelversorgung. Historia Einzelschriften 55. Stuttgart: Franz Steiner Verlag. Jakab, E. 1997. Praedicere und cavere beim Marktkauf. Sachmängel im griechischen und römischen Recht. MünchBeitr 87. München: C.H. Beck'sche Verlagsbuchhandlung. Kohler, J. 1907. “Darstellung des talmudischen Rechtes”. Zeitschrift für vergleichende Rechtswissenschaft 20: 161 – 264 . Kudlien, F. 1994. “Die Rolle der Konkurrenz im antiken Geschäftsleben”. Münstersche Beiträge zur Antiken Handelsgeschichte 13: .1 – 39. Kudlien, F. 1999. “Über-, Unter- und Selbstkostenpreis im antiken Handel”. Laverna X: 99 – 113. Kunkel, W. und Wittmann, R. 1995. Staatsordnung und Staatspraxis der römischen Republik. Rechtsgeschichte des Altertums III 2/2. München: C.H. Beck'sche Verlagsbuchhandlung. de Ligt, L. 1993. Fairs and markets in the Roman empire. Dutch monographs on ancient history and archaeology 11. Amsterdam: Gieben. Lowry, S. T. 1974. “Aristotle's Natural limit and the Economics of Price Regulation”. GRBS 15: 57 – 63. Malmendier, U. 2000. Societas publicanorum. Staatliche Wirtschaftsaktivitäten in den Händen privater Unternehmer. Forschungen zum römischen Recht 49. Köln/ Weimar/ Wien: Böhlau Verlag. Mayer – Maly, Th. 1973. “Der gerechte Preis”. Festschrift Heinrich Demelius. Ed. G. Frotz und W. Ogris. 139 – 54. Wien: Manzsche Verlags- und Universitätsbuchhandlung. Meißner, B. 2000. “Über Zweck und Anlaß von Diokletians Preisedikt”. Historia 49: 79 – 100. Migeotte, L. 1997. “Le controle des prix dans les cités grecques”. Economie antique. Prix et formation des prix dans les économies antiques: 33 - 52. Saint– Bertrand-de–Comminges. Milewski, I. 2000. “Löhne und Preise bei den Kappadokischen Kirchenvätern und bei Johannes Chrysostomus”. Münstersche Beiträge zur Antiken Handelsgeschichte 19: 48 – 58. Millett, P. 1990. “Sale, credit and exchange in Athenian law and society”. NOMOS. Essays in Athenian law, politics and society. Ed. P. Cartledge, P. Millett, St. Todd, 167 – 94. Cambridge: Cambridge University Press. Noethlichs, K.L. 1985. “Spätantike Wirtschaftspolitik und Adaeratio”. Historia 34: 102 – 16. Norden, F. 1912. Apulejus von Madaura und das römische Privatrecht. Berlin/ Leipzig: B.G. Teubner. Ohrenstein, R.A. und Gordon, B. 1992. Economic Analysis in Talmudic Literature. Studia Post-Biblica 40. Leiden/ New York/ Köln: Brill.

Herbert Graßl

365

Paterson, J. 1998. “Trade and traders in the Roman world: scale, structure, and organisation”. Trade, traders and the ancient city. Ed. H. Parkins und C. Smith: 149 – 67. London/ New York: .Routledge Pennitz, M. 2002. „Zur Anfechtung wegen laesio enormis im römischen Recht“. Iurisprudentia universalis. Festschrift für Theo Mayer-Maly zum 70. Geburtstag. Ed. M.J. Schermaier, J.M. Rainer, L.C. Winkel, 575 – 89. Köln/ Weimar/ Wien: Böhlau Verlag. Peters, F. 1973. Die Rücktrittsvorbehalte des römischen Kaufrechts. Forschungen zum römischen Recht 31. Köln/ Wien: Böhlau Verlag. Polanyi, K. 1979. Ökonomie und Gesellschaft. Frankfurt/M: Suhrkamp. Powers, O.S. 1944. Studies in the commercial vocabulary of early latin. Diss. University of Chicago. Chicago. Rathbone, D. 1991. Economic rationalism and rural society in third-century A.D. Egypt. Cambridge: Cambridge University Press. Rathbone, D. 1997. Prices and price formation in Roman Egypt. Economie antique. Prix et formation des prix dans les économies antiques. 183 – 244. SaintBertrand – Comminges. Rosivach, V.J. 2000. Some Economic Aspects of the Fourth Century Athenian Market in Grain. Chiron 30: 31 – 64. Safrai, Z. 1994. The economy of Roman Palestine. London/ New York: Routledge. Schachtschabel, H.G. 1939. “Die Idee eines gerechten Preises in der griechischen Antike”. Schmollers Jahrbuch für Gesetzgebung, Verwaltung und Volkswirtschaft im Deutschen Reiche 63: 289 – 304. Schneider, H. 1998. “Das Imperium Romanum. Subsistenzproduktion – Redistribution – Markt”. Imperium Romanum Studien zu Geschichte und Rezeption. Festschrift für Karl Christ zum 75. Geburtstag. Ed. P. Kneissl und V. Losemann, 654 – 73. Stuttgart: Franz Steiner Verlag. Sieg, H. 1933. Quellenkritische Studien zur Bessergebotsklausel (in diem addictio) im römischen Kaufrecht. Hamburg: Friederichsen, de Gruyter & Co. Spielvogel, J. 2001. Wirtschaft und Geld bei Aristophanes. Untersuchungen zu den ökonomischen Bedingungen in Athen im Übergang vom 5. zum 4. Jh. v. Chr. Frankfurter althistorische Beiträge 8. Frankfurt/M: Buchverlag Marthe Clauss. Steinwenter, A. 1957. “Die Briefe des Qu. Aur. Symmachus als Rechtsquelle”. ZSav 74: 1 – 25. Temin, P. 2001. “A Market Economy in the Early Roman Empire”. JRS 91: 169 – 81. Wacke, A. 1977. “Circumscribere, gerechter Preis und die Arten der List”. ZSav 94: 184 – 246. Weeber, K.W. 1995. Alltag im Alten Rom. Zürich: Artemis Wiemer, H.-U. 1997. “Das Edikt des C. Antistius Rusticus. Eine Preisregulierung als Antwort auf eine überregionale Versorgungskrise?! AnatSt 47: 195 – 215.

ROYAL IDEOLOGICAL PATTERNS BETWEEN SELEUCID AND PARTHIAN COINS: THE CASE OF !"#$%%&'() ) Andrea Gariboldi Commerce and monetary systems were, in the past more than nowadays, important means not only for the exchange of material goods, but also for the conveyance of far and different cultures. I would like to stress the strength that commercial relationships and coins, in themselves, have to put in contact different cultural patterns, influencing each others and sometimes irreversibly. As I mentioned, coins were also a means of exchanging ideas, because they were a means for propaganda. Many times we have heard about monetary propaganda or coins as “the most important medium of propaganda of the time”1. Many numismatists and historians have written so enthusiastically about the propagandistic value of the coins, and in certain instances this is true, but only because of the lack of sources. Propaganda’s main goal is to take people away from the opposite side, its means is word of mouth, slogans and inscriptions. The figures and the inscriptions of the coins are rather the reflection of propaganda, they can also become symbols, of which the coins are, like Belloni said2, the memento. This introduction seems to be a duty, because it is not believed that Parthian kingship, a very complex topic, could have easily been influenced by certain Greek coins. But coins, circulating with time in regions that were also far, falling into the hands of many people, can have, without a doubt, a “psychagogic” function, in the sense that they can condition the believe of who comes into contact with these continuing messages. There was certainly from the Parthians the desire to be benevolent, and also similar to the previous dominators, towards the subjects of Greek culture. It is not surprising to find sometimes on Parthian coins the same titles used by Seleucid or Graeco-Bactrian kings. These titles, like Megas, Theos, Theopator, Epiphanes, Euergetes, Eupator, Philopator, Philadelphos or Autokrator, also appear on Seleucid coins, but for example Ktistes and Dikaios, which are also well known Greek titles from epigraphy and literature, are missing on Seleucid coins. Whilst other titles used on Seleucid coins are missing from the Parthian coins, like Eusebes, Soter, Nikator and Nikephoros. Sometimes Parthian regal titles were coined purposely for their political value, like Philhellen and Philoromaios. All this means that we, through the coins, can reconstruct only a small part of the internal political frame and of the conception of Parthian kingship3. The coins reflect the increase and the magnificence of Parthian regal titles, without a doubt, in contrast and competition, besides imitation, with the plentiful Seleucid titling, however, a direct relationship 1 2 3

Mørkholm 1983, p. 63. Interesting reflections about the significance of the monetary propaganda are in Belloni 1996, pp. 387-415, with specific bibliography. Lukonin 1983, pp. 683-685.

Royal Ideological Patterns

367

between the Seleucid regal titles on the coins and the titles on the Parthian coins, must be taken with caution. Among the numerous titles that I mentioned, I would like to focus particularly on !"#$%&'(4, literally “one who has a father who is a God”, or “of divine descent”, which is ideologically different from that of !"%*. The case of Theopator is significant, because it is known exclusively through the Seleucid and Parthian numismatic documentation. And it is not by chance that this epiclesis appears first on Seleucid coins and, a few years later, on Parthian ones. We should not be tempted to try to find an immediate direct relationship between them, but maybe the insistent Seleucid propaganda on the Theopator title (which today we perceive only from coinage) could have generated, for different reasons, the same title in the Parthian environment. Since Theopator is not present in any ancient known literature5, neither in Hellenistic epigraphs6, we must assume that, at least in this case, coins were a privileged means of political propaganda. Theopator sounds like an erudite word, artefact, very far from the common language. A similar case is the hapax legomenon of the queen Agathokleia of Bactria, coregent of Straton I (about 130 B.C.), who on the coins bears the title of !"&("%#"*, “similar to God”7, or, literally, “one who turns to God”. Even this word might suggest, but does not imply, that the king is a God. Among the kings of Bactria the kingship assumed the characters of a theocracy since Antimachos I (175-170 B.C.), called Theos, and we must consider that the Parthians, both East and West, had a similar model of sovereignty.

4 5

6

7

About Theopator see Muccioli 1996, p. 26, note 23. The sources will be discussed below. The word Theopator, used in ancient Christian literature of Greek language to denote the close relationship of blood between David and Jesus, has obviously nothing to do with Hellenistic and Parthian royal titles: see apud Ioan. Chrysost. Vol. 6, p. 478; Dion. Ar., Ep. 8, 1 (M.3.1085b); Gregent. Disp. (M.86.628a); Ioan. Dam. fide ort. 4.11 (M.94.1132a), id. imag.1.1 (M.94.1232b); Thdr. Stud. or. 5.1 (M.99.721a); referred to Joseph, see Steph. Diac. vita Steph. (M.100.1038a); to Joachim and Anna, parents of Maria Virgin, see Lit. Chrys. (p.358.35). We have to consider that Theopator referring to David means “father of God” and not “one who has a father God”. Theopator is used in the Roman world, as far as I know, only at Samos, as testified by scattered evidence. We have one epigraph from the Heraion in honour of Divus Vespasianus and the emperor Titus, called Theopator, “one who has a father who is a God” (Herrmann 1960, pp. 121-122), and a unique coin of Agrippina II with the legend !"+,%&'(, “mother of God”, referring to Nero (see RPC I, p. 446, n. 2686: bust of Agrippina II and on reverse a peacock standing on caduceus with sceptre). It is very probable that Hera at Samos was worshipped as Theometor, and so it was quite natural to transfer this title from Hera to Agrippina, as is clearly alluded by the peacock on the reverse of Agrippina’s coins with the ethnic -./012. Once this unusual title was endorsed within the imperial titles, it is not surprising that Theopator has been adopted also by Titus at Samos, instead of the more common epithet of 3!"45)467"* % 8) Allouche-Le Page 1956, pp. 68-70 ; Le Rider 1967, pp. 331-342, in particular pp. 341-342, where the author describes a coin of an unknown queen of Taxila, perhaps Nachene or Machene, Maues’ wife, in the last years of the II century B.C., with the title of Theotropos inspired by the coins of Agathokleia.

368

Andrea Gariboldi

In order to better understand the genesis of Theopator we have to review briefly the troubles of Alexander Balas8, the first and only Seleucid king to bear this title. After the death of Antiochus IV (164 B.C.) a new tormented era began for the Seleucid empire, characterized by internal struggles for power, and a progressive loss of strength of the kings, who were compelled to look for external allies, often unfaithful, or overbearing and pragmatic like Rome. In fact, the descendants, real or presumed, from the family branch of Antiochus IV, had to face the descendants of his older brother, Seleucus IV. With Antiochus IV a heavy use of the regal titles began, on both coins and epigraphs, almost unknown before, or rather only used in particular situations. The discovery of the great political and propagandistic value of regal titles will never be abandoned, neither from his direct descendants, nor from those of the parallel genealogic branch9. Antiochus IV proclaims himself on the coins Theos, Epiphanes, Nikephoros. He is evidently a god, bearer of victory, and the first Seleucid king to claim it on coins10. The great charisma of this king is seen from the desperate attempts of his successors to follow his prestige, claiming to descend from him. New regal titles were invented ad hoc, beginning from Antiochus V (164-162 B.C.), who was called Eupator, from the moment he was presented to the people by his tutor Lysias, as the legitimate heir. Sources (Macc. I, 16, 17 and Ioseph. Ant.Iud. XII, 361) say that Lysias was the one who invented the title Eupator for his favourite11. A similar political and propagandistic need probably brought also to the creation of the word Theopator. Antiochus V was soon assassinated, leaving an open field to the other branch of the dynasty represented by Demetrius I (162-150 B.C.), who escaped from Roman captivity. Rome officially recognised him only after he had defeated the usurper Timarchos (160 B.C), satrap of Babylonia, proclaiming to be the Great King of Media. But Demetrius displeased and offended too many people, and 8

About Alexander Balas a very specific bibliography lacks. One can see RE I (1894), sub Alexander I Balas (22) coll. 1437-38; Bouché-Leclercq 1913, pp. 329-337 ; Volkmann 1923, pp. 51-66; 1925, pp. 373-412; Will 19832, pp. 373-379; Grainger 1997, pp. 6-7; Muccioli 1995, 1996 and 2001, passim. 9 Muccioli 2001, pp. 297-298. 10 As is well known, the Milesians firstly conferred to Antiochus II the title of Theos, because he had freed them from the tyranny of Timarchus (App. Syr. 65). Antiochus III introduced the official cult of the living queens, which implies, one can assume, also the cult of the king (Bikerman 1938, p. 247). The title of Theos, initially conferred only post mortem, was adopted by the living king surely from Antiochus IV, after 169 B.C., as is testified by coins and epigraphs (Bikerman 1938, pp. 239-240; 244). See also Muccioli 2001, pp. 296-299. 11 Muccioli 1996, in particular pp. 26-28, remembers that in the past it has been erroneously tempted to confer to Balas also the epithet of Eupator (but not by Babelon 1890, who expressively excludes this title from those of Alexander Balas), which in fact belongs to Antiochus V (164-162 B.C.). Cfr. Gardner 1878, p. 54, n. 33; Volkmann 1923, p. 66. This misunderstanding was caused by an erroneous reading of some rare bronze coins which bear the ethnic 9:;.<=9128)The city which coined with this temporary ethnic is probably now to be identified with Orthosia in Phoenicia, according to Moore 1993-94, pp. 54-59, from 148/7 to 146/5, under the influence of Ptolemy VI. See Houghton-Spaer 1998, p. 206, n. 1499.

Royal Ideological Patterns

369

soon a great coalition was created against him (Iust. XXXV, 1, 6-7). One of his diplomatic errors was to support Orophernes to the Cappadocian throne (158/57 B.C.), presumed brother of Ariarathes V, who, with the help of Attalus II of Pergamum, defeated Orophernes and remained the king of Cappadocia, in the area of the Pergamenian patronage, with the approval of Rome. Demetrius failed in the attempt to conquer Cyprus, displeasing also the Ptolemies. The powerful Milesian family of Herakleides, brother of the dead Timarchos, wanted to avenge on Demetrius too. Not even the inhabitants of Antiochia were in favour of him, after he violently ended the revolt organized by Orophernes. A pretender was needed for the Seleucid throne to face Demetrius, but to be credible he should have been the son of Antiochus IV. The king of Pergamon, Attalus II, in accordance with Herakleides, not being natural heirs, invented one: Alexander Balas. Attalus searched for someone who looked like Antiochus (Diod. XXXI, 32a), and found a person in the city of Smyrne. Alexander immediately declared himself to be the son of Antiochus. Attalus crowned him with the regal diadem, and sent him to Cilicia, while word spread that a new heir of the throne would go against Demetrius. Alexander, who was only sixteen or seventeen years old, needed only the approval of Rome, so in 154/53 B.C. Herakleides accompanied him in front of the Senate, together with a false sister of Balas of the name Laodike (the name was probably invented like Alexander’s), and gave a speech saying that the Senate had to approve the return of the two pretenders because they were the legitimate children of the king Antiochus (Polib. XXXIII, 18). The leitmotiv of Herakleides’ apology was that Alexander was >$&$?)@4%A6B the son of Antiochus. After the approval of Rome, Alexander conquered the city of Ptolemais (153/52), in Iudaea, and gave many privileges to the chief of the Asmoneians, Jonathan, who he also nominated Great Priest. Jonathan cleverly took advantage of the other numerous offers of Demetrius, but in the end sustained Balas, who was also supported by Ptolemy VI Philometor. Demetrius, who became completely isolated, had to succumb in 151/50 (Ioseph. Ant.Iud. XIII, 3561). Balas asked to marry Ptolemy’s daughter, Cleopatra Thea12, and the Lagid enthusiastically accepted to celebrate the marriage, thinking that due to the weakness of the Seleucid king he could expand his influence in all of Coele-Syria. The wedding was splendidly celebrated in Ptolemais, which became the residence of Balas in 150 B.C. (Ioseph. Ant.Iud. XIII, 35; 80-82). At Seleucia Pieria splendid propagandistic tetradrachms were coined for this occasion, with on the obverse the jugated and diademed busts of Cleopatra Thea and of Alexander13 (1). Cleopatra, as a new Tyche (perhaps in opposition with the 12 This important Seleucid queen married at first Alexander Balas, afterwards Demetrius II and finally Antiochus VII: Muccioli 1995, p. 47, note 26. 13 To this important propagandistic silver issue, we have to add some small bronzes, without Theopator, coming from the excavations at Seleucia on the Tigris, and recently attributed by Le Rider to this mint. One coin (Le Rider 1999, p. 12, Pl. 1, 27), known in only one exemplar, shows Cleopatra Thea in front and behind her the profile of Balas, while one other type (Le Rider 1999, p.12, Pl. 1, 28), more common, presents Alexander in front and behind him the head of Cleopatra. These iconographic variations are a clear sign of the uncertain political position of Balas.

370

Andrea Gariboldi

use of the Tyche on coins of Demetrius I 14) wears also a veil and a kalathos on her head, while a cornucopia appears on the left. On the reverse Zeus nikephoros is represented, and the inscription is Basileos Alexandrou Theopatoros Euergetou. What strikes us in this issue, apart from the superior artistic quality compared with the normal monetary issues of Balas, is that his portrait appears behind that of Cleopatra. This is quite peculiar, considering that the coin was struck under his name. But this iconographic particularity shows the real political position of Balas, after his acquisition of power, which goes back to 150 B.C., when he started to struck coins for all the empire (from 162 to 167 of the Seleucid era, id est 150-145 B.C., from the beginning with the title of Theopator). Alexander appears oppressed under the weight of his political supporters, and so also to his contemporaries had to appear in the same way. I think that the title of Theopator was certainly not chosen by Alexander, neither was he called Alexander15, as clearly defined by Iustinus XXXV, 1, 7, nomen ei Alexandri inditur genitusque ab Antioco rege dicitur, but that this title was invented so that it could put in evidence his lineage from Antiochus, probably by Attalus II and Herakleides, many years before Alexander assumed power. In these two persons, rather than the influent chief minister of Balas, Ammonios16, or Ptolemy VI, who seems to appear sustain Balas only from 153/52, I would identify the philoi of the king17 who worked on the plan of propaganda to eliminate Demetrius I, so to insert themselves, remaining behind the scenes, in the Seleucid politics. Alexander adopted on coins the titles of Euergetes and Theopator. Euergetes is a common civic honour, but it is the first time that it appears on Seleucid coins. Theopator clearly alludes to the Theos of Antiochus. Babelon18 wrongly attributed 14 Houghton 1988, p. 93, note 25. 15 Muccioli 1996, pp. 26-27, note 25. I would nourish some doubt also on the truthfulness of the name Balas, which is patently derived from the Aramaic Ba ‘al, “God”. Balas seems to be a “hellenization” of Ba ‘al, so an hypocoristic theophoric name. But is it not suspicious that an usurper calls himself (or is called) from the beginning Alexander “God”? The first name could deceive the Greek people, the second, the Semite one. 16 Ammonios was one of the philoi of Alexander (Grainger 1997, p. 76) who plotted against the life of Ptolemy VI (Ioseph. Ant. Iud. XIII, 106-107), and who reigned de facto almost instead of Alexander Balas (Liv. Per. 50: in Syria…iacente eo (Balas) in ganea et lustris Hammonius regnabat). He could be one of the personages who invented the titles for Balas (Muccioli 2001, p. 302; 1995, p. 48, note 31), but personally I give more credit to Polybius (XXXIII, 15-18), Iustinus (XXXV, 6-7), Diodorus (XXXI, 32a) and Strabo (Geog. XIII, 4,2), who all strongly stress the role of Attalus II and Herakleides in the catch of the power of Balas against Demetrius I. Another spy of the friendship of Alexander with Miletus, from which originated Herakleides, brother of Timarchos, is a Milesian epitaph of a certain Antigonus son of Menophilus, B$4%%$(C"*))D.E!F$%BG("4 (Herrmann 1987; Muccioli 2001, p. 314). 17 About the role of the friends of the king in Hellenistic age: Savalli-Lestrade 2001, in particular p. 279, for Timarchos and Herakleides philoi of Antiochus IV. 18 Babelon 1890, p. CXXIV. Of course the authoritative sentence of Babelon generated a long series of mistakes (for example Head 1911, p. 764) which can cause some perplexity still in modern times (Muccioli 1995, p. 42; 1996, p. 26, note 24; Houghton 1983, pp. 19 and 28). For the unique gold stater of Alexander II Zabinas, with the legend Basileos Alexandrou

Royal Ideological Patterns

371

to Balas also the titles of Epiphanes and Nikephoros (firstly assumed by Antiochus IV for his theological and military propaganda), which belong in reality to Alexander II Zabinas (128-123 B.C.), another usurper, presumed descendant of Alexander Balas, according to Porphyrius (FGH 260, F 32, 21), or adopted son of Antiochus VII, according to Iustinus (XXXIX, 1, 4-6). In this case, Alexander Zabinas (which in Aramaic means “bought”) had been supported by Ptolemy VIII against Demetrius II. Alexander’s titles leave no doubt that the propaganda in his favour was based largely on the presumed regal lineage, beside a vague resemblance to Alexander the Great, purposely emphasised19, and evoked starting from the name. It would be diminishing to say that propaganda was left only to coins, in fact Zenophanes, who welcomed the young Balas in Cilicia under Attalus’ orders, even before he became king, spread words in all of Syria on his account and his aspirations to the throne (Diod. XXXI, 32a: G6!G6%G"4)E"%H"4*)!6D*)&,?B)-4(6%$B)'7*)+!%EE"B&"*)!D#6)) &,?B)#$&('%I$B)$D(C,?B)>$&6!%B$6)&"45)+!6($>6%A>"4). The favour of the people was to be prepared with care and time was needed. It is possible that in those political speeches the term Theopator was already in circulation. I agree with Muccioli thinking that Theopator is the climax of the titles Philopator, Eupator, Theopator, and that Theopator was a new word, while the others, which were more modest, were already used20. But if the sources are so scarce with information, the analysis of the coins of Alexander Balas, with or without Theopator, can still be useful. Mørkholm, for example, has evidenced how, during difficult political times, Alexander did not even hesitate to issue coins in the name and with the portrait of his presumed father, Antiochus IV, who had been dead for years21. Naturally the date of posthumous issues assures us that they were coined during Balas’ reign22. A first emission of bronzes under the name of Antiochus appeared around 151/50 at Apamea, during the final phase of the war against Demetrius I. An abundant issue of tetradrachms, drachms and posthumous bronzes were struck at Antiochia in 146/45, when, before Demetrius’ arrival in the capital, who was hated from the people because of his father, the generals of Alexander, Hierax and Diodotus Tryphon, tried to confer the crown of Syria to Ptolemy VI, who refused it, suggesting that it belonged to Demetrius II (Ioseph. Ant.Iud. XIII, 109-115). While Alexander was

19

20 21 22

Theou Epiphanous Nikephorou, imprinted on Antiochus IV’s titling, see Mørkholm 1983, p. 62, Pl. 9,8. On the history of Zabinas: Ehling 1995, pp. 2-7; Grainger 1997, p. 7. Balas is not only the first Seleucid king to call himself Alexander, but his portraits on the coins even resemble those of Alexander the Great, also in the hair style, with the curls pulled up on the forehead. On some bronze issues Balas even wears the lion skin on his head (Babelon 1890, Pl. XVII, 14; Houghton-Spaer 1998, nn. 1448-1464). The imitatio Alexandri is evident also in some statues attributed to Balas (Charbonneaux-Laumonier 1955). See Bohm 1989, pp. 105-116; Muccioli 1996, pp. 26-27, note 25. Muccioli 1996, p. 26. Mørkholm 1960 and 1983. See, for example, Mørkholm 1983, Pl. 9, 9 (silver tetradrachm in the name of Antiochus IV dated 146/45 B.C.).

372

Andrea Gariboldi

escaping from Antiochia and he was reorganizing the last strenuous defence23, the propaganda insisted again on the figure of Antiochus IV, through which Balas hoped to accredit himself. Mørkholm rightly noted24 that the presence of the official epithets is discontinuous in the monetary Seleucid legends, and how it can vary from mint to mint, depending on the quality of the metal. Of course the civil authorities could have a great influence on the choice of the legends, just like the titles to give to the kings, but in Theopator’s case, at least, I would see a plan organized by the court in the diffusion of this term. First of all, we have to realize that Theopator is found almost exclusively on high nominals, that is gold staters25, tetradrachms and silver drachms. The bronzes usually bear the short legend Basileos Alexandrou, and not because the space on coins was not enough. In fact, a drachm or a stater are of smaller size compared to a bronze coin worth 4 or 8 chalkoi (the chalkoi, in the ancient Attic weight system, are the bronze fractions of the silver obolos. 1 obolos equals 8 chalkoi; 6 oboloi = 1 drachm). So Theopator, being an aulic term, finds a place on noble metals, which, except for certain exceptions, are destined to a very wide monetary circulation, and not civic. Placing Theopator on gold and silver coinage means, on one hand, to further ennoble the sense, on the other hand, more pragmatically, to ensure a wider possible circulation of the propagandistic message. Furthermore Theopator is used only on coins of Attic weight of Alexander, and not on coins of Phoenician or Ptolemaic foot26, coined in Coele-Syria under Lagid influence. Following the alliance between Balas and Ptolemy VI, the Se-

23 The rapid end of the reign of Balas was due, on one hand, to the return on the political stage of Demetrius II, in 147 B.C., who, with the help of the general Lasthenes, had reorganised an army, on the other hand, to the loss of his powerful alley Ptolemy VI. After that, perhaps for an impulse of the soul, perhaps following an imprudent advice of his minister Ammonios, Alexander tried to kill him by treachery at Ptolemais. Logically the anger of Ptolemy was very great. Ptolemy regretted giving in wedding his daughter Cleopatra Thea to such a miserable fellow, and gave her in marriage to Demetrius II. He invaded Coele-Syria pressing Balas, who was finally defeated in the battle at the river Oinoparas in 145 B.C., near Antiochia (Strab. XVI, 8). Alexander fled away to Arabia, but an Arab chief, maybe in accordance with two officers of Balas, cut his head off and sent it to Ptolemy, who after being delighted by this sight, expired for some deadly wound caught during the Oinoparas’ battle (Ioseph. Ant.Iud. XIII, 116-119; Diod. XXXII, 9). So Demetrius was free from any rival with one strike. In general, the historiographical judgment about Balas is very modest, and also the ancients saw him as a weak person. Diodorus, for example, writes (XXXIII, 3) that Alexander for his $DA3!%B!6$B)&,5*)J4C,5*)was unable to govern. Balas weakened the Seleucid empire particularly in Palestine as in Media. 24 Mørkholm 1984, p. 98; Muccioli 2001, p. 310. Similar reflections on the titling of Balas are already present in Babelon 1890, pp. 124-126, who however does not examine deeply the presence of Theopator on coins. 25 Gold staters of Alexander Balas are very rare. I would like to mention a beautiful exemplar kept in the Bibliothèque Nationale, collection Beistegui n. 38, published by Babelon 1934. This piece (8.41g) lacks monograms but the mint is Antiochia. 26 The Phoenician weight was a standard weight system in antiquity. It uses a didrachm (or siclos) of about 7.5g, and a drachm of about 3.7g, so it is lower in respect to the Attic drachm, which weights circa 4.3g. On the ancient weight systems: Head 1911, pp. XXXIII-LV.

Royal Ideological Patterns

373

leucid struck silver coins even at the principal ports of Phoenicia27, like Berytus, Sidon, Tyrus and Ake-Ptolemais. But the coins of these important centres generally follow the Phoenician weights, and from the iconographic point of view they bear the Ptolemaic eagle. Theopator is not present on these coins, and I think it is an important fact to realize that Alexander’s propaganda was carried out in the cities of Syria, where the influence and the memory of Antiochus IV were surely greater than in the geographic areas near the Ptolemaic kingdom. I suggest that the weight system is the real discrimination of the presence, or not, of Theopator. In fact, Sidon, a Phoenician city, struck coins even with Theopator28, but only on tetradrachms of Attic weight (2), and not on those of Phoenician ones (3). In the eastern Seleucid mint of the empire, Ecbatana, modern Hamad n29, capital of Media, where Alexander struck coins from 150 to 148/47 BC, until the city fell into the hands of Mithradates I king of the Parthians (171139/38 B.C.)30, principally drachms and small bronzes were coined (in great quantity by Balas), whilst tetradrachms were preferably coined at Seleucia on the Tigris31. In exception to what we have said about the bronzes, which is that they do not bear the name of Theopator, at Ecbatana, as shown by Le Rider, they bear the complete legend: Basileos Alexandrou Theopatoros Euergetou, even when the dimensions of the coins are very small.32 A possible explanation of this apparent contradiction is that being Ecbatana a mint destined to produce coins of modest value, the propaganda of Alexander regarding his presumed lineage from Antiochus IV had to adapt to smaller denominations. We can not exclude that the pres27 For the double weight system used in Coele-Syria and Phoenicia by the Seleucids, see Le Rider 1995, pp. 391-404. 28 A rare tetradrachm of the Phoenician city of Aradus (Bibl. Nat., coll. Luynes, n. 3348) bears the title of Theopator, but it is struck on Attic weight as those of Sidon. 29 Brown 1997, pp. 80-84. 30 The occupation of Media by Mithradates I (171-139/38 B.C.) in 148/47, profiting of Balas’ weakness, is testified by a Greek epigraph, dated 149/48, in which is mentioned a “Viceroy of the Upper Satrapies”, so the Parthian invasion of Media must be placed a few time later (Will 1982, p. 403; Bivar 1983, pp. 32-35; Wolski 1993, pp. 79-81; D!browa 1998, pp. 36-37; Simonetta 1968, pp. 28-29; 2001, p. 75). Moreover, the mint of Ecbatana continued to coin for Balas until 148/47, as has been shown by Le Rider 1965, pp. 316-319 and 338-340, following a prior study of Jenkins 1951. The Parthian war for Media is briefly summarized by Iustinus (XLI, 6, 6-8), in few elusory words, often quoted by historians: “Dum haec apud Bactros geruntur, interim inter Parthos et Medos bellum oritur. Cum varius utriusque populi casus fuisset, ad postremum victoria penes Parthos fuit. His viribus auctus Mithridates Mediae Bacasin praeponit, ipse in Hyrcaniam proficiscitur”. 31 Le Rider 1960, pp. 32-33; 1965, pp. 339-340; 1999, pp. 94-95. 32 Le Rider 1965, pp. 338-340 (Pl. LXVII, nn. 27-29) has published and attributed some bronzes of Balas, with an elephant surmounted by a rook on the reverse, to the mint of Ecbatana. The attribution of Le Rider is based on stylistic confrontation with coins of sure attribution to Ecbatana, and on technical data (in particular, the orientation of dies and the scalloping of the edge of the coins, typical features of the Ecbatana’s mint). According to Le Rider also the presence of a great deal of small bronze fractions of the obolos is a characteristic of Ecbatana, which used to coin low nominals. To the bronzes catalogued by Le Rider, we have to add another coin type (perhaps worth one chalkos), with on the reverse a bee and the complete legend of Balas (Houghton-Spaer 1998, n. 1592).

374

Andrea Gariboldi

ence of the title of Theopator on the bronzes was not addressed also to the near Parthian population. It would have been, if we believe in this prospective, a sort of “reinforced” propaganda on the extreme borders of the empire. What is certain is that the Parthians totally perceived the term Theopator, so much to adopt this even on their coinage. We must be grateful to the analysis of Le Rider, who has shown that the first Parthian drachms with Theopator belong to the reign of Phraates II (139/38-128 B.C.), and not to that of Mithradates I, although this is the communis opinio. In fact, comparing the drachms that bear the beardless bust of Arsakes (5), and on the reverse Arsakes seated on the omphalos, with the legend Basileos megalou Arsakou theopatoros, with the drachms having a bearded portrait of Phraates II (6), and the same legend, one can notice the same disposition of the legend, palaeography of the letters and orientation of the dies, moreover the borders of the coins are dotted and the flan is wide and thin.33 The mint proposed for these coins is Hecatompylos, the capital of the Parthians, for similar stylistic reasons, like the head on obverse facing left or the presence of a separating line between the words of the reverse.34 Thus, in this monetary series, the beardless type precedes the bearded one. Other drachms which have a beardless head on the obverse, with the epithet of Megas or Theos (4), therefore should be attributed to Mithradates I35. The extremely rare coins of Mithradates I with Theos, a term that could have been suggested to Mithradates either from the coins of the king of Bactria, Antimachus I (175-170 B.C.), or from the Seleucid coins, are from the mint of Hecatompylos too, and Theos is to be considered the premise for the other following Parthian coins with Theopator. Phraates II could, just like Balas had already done, claim to have had a father who was a God. In fact, in addition to the coins of Mithradates I with the title of Theos, we have to consider those documents from Nis which could imply the cult of the souls of the dead kings, a tradition that will be peculiar to the Sasanians. Some ostraca bear the inscription mtrdtkn(y) / Mihrd tak n, “the work of Mithradates”, and suggest the cult of the soul of Mithradates, worshipped, like

33 Le Rider 1965, pp. 316-319, in particolar p. 316, notes 5,6,7; Le Rider 1960, p. 28, note 4. 34 Simonetta 1968, pp. 32-33; 42-43; Sellwood 1983, pp. 281-282. Also Le Rider 1965, pp. 319-320, agrees that this Parthian mint should be placed in the North-East of Iran, probably in Hyrcania. 35 Le Rider 1960, pp. 27-28: « la plupart des monnaies à la tête imberbe, sinon toutes, ont été frappées sous le règne de Mithridate I »; 1965, pp. 316-319 ; Simonetta 1968, pp. 32-33. Otherwise the position of Le Rider, who believes that the Parthians never coined before Mithradates I, is completely surpassed after the publication of the Bujn"rd hoard, in the valley of the river Atrek, in the North-East of Iran. This hoard, of nearly 1500 coins, contains pieces attributable to Arsakes I and Arsakes II. Moreover some coins present Aramaic inscriptions, so it is possible to talk about “neoiranism” from the very beginning of the Parthian royal dynasty (see Abgarians-Sellwood 1971; Sellwood 1983, pp. 279-281 (Pl. I, 2); Gnoli 1989, pp. 116119; Wolski 1993, pp. 69-70, 98, note 4; Panaino 2001, pp. 112-113). We have to note that Simonetta 1968 was already, at that time, on a different position in respect to Le Rider.

Royal Ideological Patterns

375

other kings, in royal fire temples.36 Phraates II struck coins with Theopator at both Hecatompylos and Ecbatana37. The monetary hoards show that the Seleucid coins in Mesopotamia and in Parthia circulated together with the Parthian ones38, so the title of Theopator might have had many occasions to be known also by the Parthians, whom partially for imitation, partially because they probably had to turn against populations in which the Greek element was still dominant (in fact they maintain the Greek language on the coins of this period), and in part because Phraates was surely son of a father whose soul was, at least, worshipped like divine, it was useful and convenient to adopt, among others, the same regal title. Moreover we have to take into account that Demetrius II (145-125 B.C.) fell into the hands of the Parthians in 139, and was taken prisoner and sent to Mithradates in Hyrcania. The Arsacids cleverly treated him well, and even gave to Demetrius his daughter Rhodogune in marriage39. The captivity of Demetrius II among the Parthians lasted about for all the period of the reign of Phraates II (Demetrius was set free by Phraates in 129), so there were very close contacts between Seleucids and Parthians, and not only warlike ones. One of the regal titles of Demetrius II was Theos (besides Philadelphos and Nikator), and the circumstance that he stayed friendly with the Parthians so many years could have influenced also the Parthian titling (the Theos of Mithradates I and the Theopator of Phraates II). The influence was also inverted, in fact Demetrius II on some coins of his second reign (129/125) curiously appears bearded like a Parthian king (7)40. A good Parthian politics was to try not to change many things in respect to the Seleucids, and in fact in economy they adopted the Attic weight system, with an admiring precision. For example, Mithradates I, who had just conquered Ecbatana, struck a series of reduced weight bronzes, with the same mark of value

36 Lukonin 1983, p. 694; Wolski 1993, p. 94; Schmitt 1998, pp. 168-170. Isidorus Characenus 11, reports that there was an ever-burning fire of Arsakes at Asaak (Wiesehöfer 1996b, p. 61, note 49; Boyce 1987, p. 541). 37 Simonetta 1968, pp. 41-45. 38 See, for example, Newell 1924; Le Rider 1960, pp. 24-28, Pl. III (Treasure n. 2, which contains a tetradrachm of Balas, n. 17, dated 150/49, terminus post quem for the hollowing of the hoard in Susa, and a drachm of Mithradates I, n. 19, beardless type); see Le Rider 1999, for the excavation coins from Seleucia on the Tigris. 39 Bivar 1983, pp. 34-37; Wolski 1993, pp. 82-85; App. Syr. 67, 356; 68, 360; Iust. XXXVIII, 9, 3; Macc. I, 14, 1-3. On the titles of Demetrius II: Muccioli 1995. 40 Gardner 1878, p. 77, 18; p. 78, 23 and other coins. Recently Mittag 2002 writes that the beard of Demetrius II is not a Parthian custom, but that it is a sign of his devotion to Zeus. I remark that when the bearded head on the coins (but also in general in Greek art) is diademed, it is the representation of a king, while Zeus usually wears a crown of wreath (Gariboldi 2000, pp. 31-63). See also Svenson 1995, p. 424, n. 365, Taf. 64 (coin of bearded Demetrius II with diadem), and p. 425, n. A1.5, Taf. 65 (coin of Antiochus IV with head of Zeus with crown of wreath).

376

Andrea Gariboldi

corresponding to those of Alexander Balas, who had reduced to half those of Antiochus IV41. Much more impressive was Mithradates’ act, always to favour the trade with the Greeks, after having conquered also Seleucia on the Tigris in 140 B.C., to coin tetradrachms, in perfect Hellenistic style, with a typical Greek subject, like Heracles, and with the addition of the new regal title of Philhellen42. Even the portraits of Mithradates, in the mints of Greek cultural tradition, like Seleucia, Ecbatana and Susa, are always facing the right side, while at Hecatompylos, in the centre of Parthia, they are facing left43. This means that the Parthians, as far as the monetary system is concerned, at least and above all in their initial stages of the rule among the Greek people, wanted to maintain the status quo. Mithradates I, as stressed by Wolski44, is certainly the real founder of the Parthian empire and the one who led the Arsacid dynasty towards an absolute monarchy, assuming for the first time the title of MLKYN MLKA / xš h n xš h, “King of Kings”45, and expanding his kingdom both East and West, but we have to remember that these achievements were also possible thanks to an astute and opportune “philhellenism”. In this intelligent continuity, I think, the Parthian adoption of Theopator must be explained, rather than excessively emphasizing the superhuman aspect of the Iranian kingship, which, even if it allows a divine cult of the king, clashes with the most orthodox Zoroastrian religious thought, which can not but see a superior being above the king, who is at the most conceivable like a divine representative, but is not God.46 41 Le Rider 1994, pp. 17-34, in particolar p. 25. Balas redoubled the value of the coined bronze in respect to silver, so his monetary politics, followed also by Mithradates I, tends to a general growth of the fiduciary value of the coins. 42 Sellwood 1983, p. 282 (Pl. 1, 10); Wolski 1993, pp. 72-73; Wiesehöfer 1996b, p. 60. D!browa 1998, pp. 40-41. Mithradates I bestowed also political privileges to Seleucia on the Tigris, among them the right to possess a municipal bronze coinage (Le Rider 1999, pp. 82-83). 43 The remark that the portrait of Mithradates facing left is in opposition to the custom of the Seleucids to portrait themselves facing right, so many times stressed by modern scholars (see Göbl 1978, I, p. 94; Wolski 1993, p. 98; Panaino 2001, p. 113), is true, but it is important to say also that in all Parthian mints of Greek tradition, which are the majority, the portrait of Mithradates is always facing the right side. I think that this “opposition sensible à la pratique des Séleucides” should be a little lessened. 44 Wolski 1983; 1990; 1993, pp. 97-101 and passim. 45 See Wolski 1993, p. 99; Wiesehöfer 1996a, p. 121; 1996b, p. 59; and Schmitt 1998, p. 168, Panaino 2001, pp. 113-114. The title of “King of Kings” for Mithradates I is testified by a pahlavi inscription on the triumphal rock relief at Hung-i Naur"z# in X"zist n, which shows Mithradates I (mtrdt MLKYN MLK (sic)) on horseback and the “Satrap of Susa Kamnaskires” (kbnškr šwš PHTA) standing. The relief is dated about 140 B.C., at the time of Mithradates’ conquest of Elymais. For a different interpretation of this relief see Invernizzi 1998, who believes that the figure on horseback could be Demetrius II, sustained by Kamnaskires against Mithradates (see also Wiesehöfer 2002, pp. 118-120). On Parthian coins, as is well known, the title of K.-0L91-)K.-0L912)appears only from Mithradates II (124/23-88/87 B.C. onwards): Sellwood 1983, p. 285 (Pl. 2, 10). 46 Lukonin 1983, pp. 683-698; Wiesehöfer 1996b, p. 62, writes about a “divine right” (Gottesgnadentum) of the Persian ruler and underlines the influence of the Hellenistic ruler-cult

Royal Ideological Patterns

377

If we try to discover, in fact, which other Parthian kings adopted Theopator on coins, or even Theos, we realize that we do not go beyond the first century B.C.47, taking into consideration also the case of Artabazos (48/47 B.C.), the king of Characene (8). And it is exactly when Hellenism ended, which nourished in itself, and spread, the premises of this theocratic conception of the kingship.

on Arsacid kingship; a similar position is expressed by Gnoli 1998. Recently Panaino 2003, pp. 272-273, has remarked that this Hellenistic influence on the Iranian kingship is nevertheless superficial and above all directed to the Greek people subject to the Parthians. We cannot exclude, in fact, the possibility that the title of !"%* and that of !"#$%&'()actually were propagandistic devices targeting the Greek cities and peoples, but which did not affect the core of the Parthian royal ideology. The Parthian titles of !"%*)and !"#$%&'()are seldom used on coins, and clearly for propagandistic reasons towards the Greeks, like in general is shown by the Parthian monetary system, which is without doubt more “Hellenized” in the West of the empire. This political capability naturally facilitated not only cultural interactions but in primis economic relationships. 47 This has been freshly noted by Panaino 2003. The title of Theos was assumed in the Parthian dynasty first by Mithradates I, and after only by Phraates III (71/70-58/57 B.C.) and Mithradates III (58/57 B.C.), to whom we could add the very particular case of Thea Musa (2 A.D.), the only queen, ex slave of Augustus, who had the privilege to be portrayed on Parthian coins, having married her own son Phraates V (Sellwood 1983, Pl. 6, nn. 4-5; Gariboldi 2003, p.13). The title of Theopator, which I would exclude from the titling of Mithradates I (contrarywise, Sellwood 1980, p. 35, influencing many other scholars, ascribes this title to Mithradates I, but he is not totally sure: “Perhaps an issue of Phraates II”), belongs to Phraates II, Artabanos I (128-124/23 B.C.), Gotarzes I (91/90-81/80 B.C.), Sinatruces (?) (78/77-71/70 B.C.) and Darios (?) (about 70 B.C.). One must keep in mind that the period of Parthian history from 91 to 57 B.C., the so-called “Dark Age”, is very confused and uncertain, so any date and attribution is in some way precarious and should be assumed with caution (Simonetta 2001). To these Parthian kings we have to add Artabazos of Characene, who, according to a unique tetradrachm dated 49/48 B.C., from the Basra hoard, had the title of Theopator too, clearly of Parthian origin (Le Rider 1959, pp. 248-250, Pl. XXII, n. 55). The same coin has been published also by Sellwood 1983, p. 311, Pl. 13, 5, and Alram 1986, n. 505. Finally, the interesting article of Mariq 1958, pp. 378-383 deserves mention, who believes that Theopator is the Greek translation of the Parthian bagpuhr and of the Kushan title M$H"#"4(", “son of god”, comparable with Skt. devaputra-. This interpretation (followed, for example, by Le Rider 1965, p. 316, note 7; Tubach 1990, p. 377-378) rises nevertheless some philological perplexity (Panaino 2003, pp. 273-274). In fact Theopator has not the same significance of devaputra (not literally at least). A similar consideration can be done about a parallelism which could be made between Theopator and the Syrian bar’al h! (son of the Gods), referring to the king of Edessa Abgar VII (109-116 A.D.), in the Acta Martyrum of Šarb!ls (Tubach 1990, pp. 377-378; Cureton 1864, p. 42). If we give attention to the geographical proximity of the Kushan kingdom to India, where the king can be a deva-, and to the chronological gap between the use of Theopator among the Parthians (not beyond the I century B.C.) and the assumption of the term devaputra in the regal titling of Kanishka (first half of II century A.D.), it seems clear that a direct Hellenistic influence of the word Theopator on devaputra must be taken with caution.

378

Andrea Gariboldi

Figures:

Fig. 1

Fig. 2

Fig. 3

Fig. 4

Royal Ideological Patterns

Fig. 5

Fig. 6

Fig. 7

Fig. 8

379

380

Andrea Gariboldi

List of figures: 1) Tetradrachm of Alexander I Balas and Cleopatra Thea, mint of Seleucia Pieria. (Houghton-Spaer 1998, n. 1483). 2) Tetradrachm of Alexander I Balas, mint of Sidon, Seleucid Era 165 = 148/7 B.C. (Houghton-Spaer 1998, n. 1515). 3) Tetradrachm of Alexander I Balas, mint of Sidon, Seleucid Era 164 = 149/8 B.C. (Houghton-Spaer 1998, n. 1514). 4) Drachm of Mithradates I, mint of Hecatompylos (?) (Simonetta 1968, Tav. III, n. 42). 5) Drachm of Phraates II, mint of Hecatompylos (?) (Simonetta 1968, Tav. IV, n. 14). 6) Drachm of Phraates II, mint of Hecatompylos (?) (Simonetta 1968, Tav. IV, n. 16). 7) Tetradrachm of Demetrius II, mint of Antiochia, Seleucid Era 186 = 127/6 B.C. (Gardner 1878, p. 77, 15). 8) Tetradrachm of Artabazos of Characene, Seleucid Era 264 = 49/8 B.C. (Alram 1986, Tf. 16, n. 505).

Royal Ideological Patterns

381

Bibliographical References Abgarians M.T.- Sellwood D.G. (1971), A Hoard of Early Parthian Drachms, The Numismatic Chronicle 11, pp. 103-134 (Pl. 20-23). Alram M. (1986), Nomina Propria Iranica in Nummis. Iranisches Personennamenbuch IV, Wien. Alram M. (1987), Die Vorbildwirkung der arsakidischen Münzprägung, Litterae Numismaticae Vindobonenses 3, pp. 117-142. Allouche-Le Page (1956), L’art monétaire des royaumes bactriens, Paris. Babelon E. (1890), Catalogue des monnaies grecques de la Bibliothèque Nationale. Les rois de Syrie, Paris. Babelon J. (1934), La collection de monnaies et médailles de M. Carlos de Beistegui, Paris. Belloni G.G. (1996), Monete romane e propaganda, Scritti di Archeologia, Storia e Numismatica, Milano, pp. 387-415. Bevan E.R. (1902-1904), The House of Seleucus, London. Bikerman E. (1938), Institutions des Séleucides, Paris. Bivar A.D.H. (1983), The Political History of Iran under the Arsacids, The Cambridge History of Iran 3 (1), The Seleucid, Parthian and Sasanian Periods, Cambridge, pp. 21-99. Bohm C. (1989), Imitatio Alexandri im Hellenismus, München. BouchÉ-Leclercq A. (1913-14), Histoire des Séleucides, Paris. Boyce M. (1987), Arsacid Religion, Encyclopaedia Iranica II, Costa Mesa, pp. 540-541. Breccia E. (1904), Il diritto dinastico nelle monarchie dei successori d’Alessandro Magno, Roma. Brown S.C. (1997), Ecbatana, Encyclopaedia Iranica VIII/1, Costa Mesa, pp. 8084. Carsana C. (1996), Le dirigenze cittadine nello stato seleucidico, Como. Charbonneaux J.-Laumonier A. (1955), Trois portraits d’Alexandre I Balas, Bulletin de Correspondance Hellénique 79, pp. 528-538. Cureton W. (1864), Ancient Syriac Documents, London. D!browa E. (1998), Philhellên. Mithridate Ier et les Grecs, Electrum Vol. 2, Kraków, pp. 35-44. D!browa E. (1999), L’expédition de Démétrios II Nicator contre les Parthes (139138 avant J.C.), Parthica 1, pp. 9-17. Ehling K. (1995), Alexander II Zabinas – ein angeblicher (Adoptiv) Sohn des Antiochos VII oder Alexander I Balas ?, Schweizer Münzblatter 45, pp. 2-7. Frye R.N. (1964), The Charisma of Kingship in Ancient Iran, Iranica Antiqua IV, pp. 36-54. Gardner P. (1878), A Catalogue of Greek Coins in the British Museum. The Seleucid Kings of Syria, London. Gariboldi A. (2000), Simboli e ideologia del potere in età romana, La corona e i simboli del potere, Rimini, pp. 31-63.

382

Andrea Gariboldi

Gariboldi A. (2003), La monetazione sasanide nelle Civiche Raccolte Numismatiche di Milano, Comune di Milano. Gnoli Gh. (1989), The Idea of Iran. An Essay of its Origin, Rome. Gnoli Gh. (1998), L’Iran tardoantico e la regalità sassanide, Mediterraneo Antico I, 1, pp. 115-139. Göbl R. (1978), Antike Numismatik, München. Grainger J.D. (1997), A Seleucid Prosopography and Gazetteer, Leiden-New York-Köln. Head B.V. (1911), Historia Numorum (sic!), Oxford. Herrmann P. (1960), Die Inschriften römischer Zeit aus dem Heraion von Samos, Mitteilungen der Deutsch Archäologische Institut (Athens) 75, pp. 121-122 (for Vespasian and Titus). Herrmann P. (1987), Milesier am Seleukidenhof. Prosopographische Beiträge zur Geschichte Milets im 2. Jhdt. v. Chr., Chiron 17, pp. 171-192. Houghton A. (1983), Coins of the Seleucid Empire from the Collection of Arthur Houghton, New York. Houghton A. (1988), The Double Portrait Coins of Alexander I Balas and Cleopatra Thea, Schweizerische Numismatische Rundschau 67, pp. 85-93. Houghton A.-Spaer A. (1998), Sylloge Nummorum Graecorum. Israel I, London. Invernizzi A. (1998), Elymaeans, Seleucids, and the Hung-e Azhdar Relief, Mesopotamia 33, pp. 219-259. Jenkins G.K. (1951), Notes on Seleucid Coins, The Numismatic Chronicle, pp. 121 (Pl. I-II). Le Rider G. (1959), Monnaies de Characène, Syria 36, pp. 229-253 (Pl. 19-22). Le Rider G., Göbl R., Miles G.C., Walker J. (1960), Numismatique Susienne. Mémoires de la mission archéologique en Iran, Tome XXXVII, Paris. Le Rider G. (1965), Suse sous les Séleucides et les Parthes. Mémoires de la mission archéologique en Iran, Tome XXXVIII, Paris. Le Rider (1967), Monnaies de Taxila et d’Arachosie. Une nouvelle reine de Taxila, Revue des Études Grècques, pp. 331-342. Le Rider G. (1994), Antiochos IV (175-164) et le monnayage de bronze séleucide, Bulletin de Correspondance Hellénique 118, pp. 17-34. Le Rider G. (1995), La politique monétaire des Séleucides en Coelé Syrie et en Phénicie après 200, Bulletin de Correspondance Hellénique 119, pp. 391-404. Le Rider G. (1999), Séleucie du Tigre. Les monnaies Séleucides et Parthes, Monografie di Mesopotamia VI, Firenze. Lukonin V.G. (1983), Political, Social and Administrative Institutions, Taxes and Trade, The Cambridge History of Iran 3 (2), The Seleucid, Parthian and Sasanian Periods, Cambridge, pp. 681-746. Maricq A. (1958), La grande inscription de Kaniska, Journal Asiatique 246, pp. 345-394. Mittag P.F. (2002), Beim Barte des Demetrios – Überlegungen zur parthischen Gefangenschaft Demetrios’ II, Klio, Band 84, Heft 2, pp. 373-399. Moore W. (1993-94), The 9:;.<=912 Coinage of Alexander I Balas, Four Seleucid Notes, American Journal of Numismatics 5-6, pp. 54-59 (Pl. 7-8).

Royal Ideological Patterns

383

Mørkholm O. (1960), A Posthumous Issue of Antiochus IV of Syria, The Numismatic Chronicle, pp. 25-30 (Pl. 1). Mørkholm O. (1983), A Posthumous Issue of Antiochus IV of Syria, The Numismatic Chronicle 143, pp. 57-63 (Pl. 9). Mørkholm O. (1984), The Monetary System in the Seleucid Empire after 187 B.C., “Ancient Coins of the Graeco-Roman World. The Nickle Numismatic Papers, Waterloo Ont., pp. 93-113. Muccioli F. (1995), Gli epiteti di Demetrio II, re di Siria, Simblos 1, pp. 41-55. Muccioli F. (1996), 9:;.
384

Andrea Gariboldi

Tubach J. (1990), Theos und Theopator als Beiname edessenischer Könige, Lingua Restituta Orientalis. Festgabe für Julius Assfalg (Ägypten und Altes Testament 20), hrsg v. R. Schulz und M. Görg, Wiesbaden, pp. 376-378. Volkmann V.H. (1923), Zur Münzpragung des Demetrios I und Alexander I von Syrien, Zeitschrift für Numismatik 34, pp. 51-66. Volkmann V.H. (1925), Demetrios I und Alexander I von Syrien, Klio 19, pp. 373-412. Wiesehöfer J. (1996a), Ancient Persia from 550 BC to 650 AD, London-New York. Wiesehöfer J. (1996b), “King of Kings” and “Philhellên”: Kingship in Arsacid Iran: Aspects of Hellenistic Kingship, Aarhus, pp. 55-66. Wiesehöfer J. (2002), -4B"6%>,A6*)und))$D#"(6%$)C(,+$%&'B. Antiochos IV. Und die Heiligtümer der Elymais, Widerstand- Anpassung- Integration. Die griechische Staatenwelt und Rom. Festschrift für Jürgen Deininger zum 65. Geburtstag (Herausgegeben von N. Ehrhardt und L.M. Günther), pp. 109-120. Will E. (19822), Histoire politique du monde hellénistique, 2 Vols., Nancy. Wolski J. (1977), L’Iran dans la politique des Séleucides, Acta Antiqua Academiae Scientiarum Hungaricae 25, pp. 149-156. Wolski J. (1983), Sur le « philhellenisme » des Arsacides, Geriòn 1, pp. 145-156. Wolski J. (1990), Le titre « Roi des Rois » dans l’idéologie monarchique des Arsacides, From Alexander the Great to Kül Tegin (ed. by J. Harmatta) Budapest, pp. 11-18. Wolski J. (1993), L’empire des Arsacides, Acta Iranica 32, Lovanii. Wroth W. (1903), A Catalogue of the Greek Coins in the British Museum. Catalogue of the Coins of Parthia, London.

COMMERCE AND CONFLICTS OF RELIGIONS IN SASANIAN IRAN BETWEEN SOCIAL IDENTITY AND POLITICAL IDEOLOGY Antonio Panaino In the present contribution I would like to tackle a problem strictly regarding the social ideology of the Mazdean culture that played a significant impact on the ethno-religious history of Pre-Islamic Iran. This problem concerns both the basic patterns of the social ideology developed by Zoroastrian priests and the politicoeconomic framework in which this tradition clashed with the Manichaeans. It is well known that Sasanian Iran was a class society,1 in some respects feudal,2 having the king on the top of the social pyramid followed by the nobles (with a complex and well articulated hierarchy), the priests (who in their own turn had a special and powerful articulation), the warriors and then the farmers and shepherds. Besides the full-rate citizens they also had half-citizens (i.e. freeborn Iranians outside of their agnatic group and of their community or converted to other religions) and non-citizens like slaves,3 who were considered as a “thing” but in any case possessing some particular rights because of their human condition.4 I do not want to analyze this complex situation here but only the condition in which the tradesmen, who in some cases were also “citizens”, were considered according to the Sasanian ideology. Sasanian economy and its social stability doubtless profited their basic income from agriculture and stock-raising and conneced it with a strong social prestige. The king5 and the nobles had latifundia, but also the Church, and in particular the Fire Temples, possessed rich properties, slaves, animals, and, of course, they were allowed to receive offerings and gifts of many kinds. All these means 1 2

3 4 5

Christensen, 1944: 97-103, 518-526; Perikanian, 1983: 631-634. See Christensen, 1944: 16-27, 103-129, 206-218, 258-259; Widengren, 1957a; 1967. It is useful to underline here that, according to Altheim - Stiehl (1954: 131-174), it is only with the tax reform of Xusraw I that the Sasanian feudal system began, because they assumed that only at that time the so-called Grundherrenschaften and their owners (Grundherren) were partly substituted with owners directly encharged by the king. Grignaschi (1971: 123) thought that a stricto sensu feudal component, according to the precise meaning attributed by Cahen (1950), can be seen in the Sasanian society; but Grignaschi, differently from Cahen, assumed that a feudal organization was not incompatible with a nomadic or semi-nomadic society. On the Aramaic origin of the Arabic term ‹ar !, and in particular on its diffusion in Iranian languages, see Henning, 1935. Perikanian, 1983: 634-640; Macuch; 1981: 79-84; many passages about slavery and slaves are attested in the M day n " Hazar D dest n, see Macuch, 1981 and 1993. Cf. also the very deep analysis offered by Colditz, 2000: 108-165 on the word bandag. Perikanian, 1983: 636-634; on the special condition of the sacred slaves (hierodouloi), some of them belonging to nobility, see again Perikanian, 1983: 640-641. Cf. Colditz, 2000: 135137. Some scholars, like Løkkegaard (1950: 58) have assumed that all the land was formally considered as belonging to the State, but see the different opinion of Grignaschi, 1971: 126. Altheim maintained that only with Xusraw I the obsolete Achaemenid conception of the kingdom as the “house” of the king limited only by the properties (i.e. the other “houses”) of the great nobles, was finally superseded; on this problem see again Grignaschi, 1971: 120.

386

Antonio Panaino

produced of course a significant income.6 Thus, we can say effortlessly that the earth represented the basic source of richness7 and that its possession was considered as a status symbol for nobles and priests. Under this respect both Iranian and Byzantine élites considered landed property as the unique source of richness worthy of a noble.8 Such a kind of cultural and ideological assumption was strongly based in Iran on a consistent number of religious ideas already attested in the Avestan literature and well developed in the Pahlavi texts. Not only the earth was considered like a goddess, more precisely it was associated with Spandarmad (Av. Sp nta !rmaiti),9 daughter and wife of Ohrmazd, but agriculture and stock-raising clearly represented the most respectful productive activities, as the so called “Georgic” chapter of the Wid#wd d10 (i.e. the third fargard of this Avestan nask) shows. Among the first duties to be done according to the Mazdean Religion, a Pahlavi catechism declares: “my third (duty) is to cultivate and till the soil; my fourth to treat all livestock justly”.11 [sid"gar zam"g kišwz r kandan, warz"dan; $ah rom g%spand d d"h warz"dan].12 The wise !durb"d, son of Mahraspand, recommends: “Till the earth and do good, for all men live and are nourished by the tilling of Spandarmad, the Earth”13 [abar zam"g warz ud n#k kun#d $# har kas z"wišn parwarišn " az warz " spandarmad zam"g].14 We could find a number of similar concepts expressed in Pahlavi literature that will simply confirm the existence of a communis sed “pia” opinio. This idea found a direct correspondence in the ideological scheme of the social hierarchy. According to the first chapter of the Škand Gum n"g Wiz r, the “Religion” was like a mighty tree, of which “four offbranches are the four religious castes by which the Religion and secular life are (both) maintained, the priesthood, the warrior caste, the caste of husbandmen, and the caste of the artisans”15 [$ah r š k $ah r p#šag n " d#n k#-š [d#n] g#h n patiš wir y"h#d, " hast sr%g"h, art#št r"h, w stary%š"h hu-tuxš"h].16 “And in the microcosm, which is Man are seen to correspond to these four earthly castes, the head to priesthood, the hands to the warrior caste, the belly to the caste of husbandmen and the feet to the caste of artisan”17 [ud andar g#h n " k%dak " hast mard%m, payd g#n#d pad hom n g"h " #n $ah r p#šag n " g#h n, $iy%n abar

6 7 8 9 10 11 12 13 14 15 16 17

Many temples were built as private pious foundations for the souls (pad ruw n) of the dead; see de Menasce, 1964; Perikanian, 1983: 661-665 See e.g. Løkkegaard (1950: 173) who underlines the most privileged condition of the tenants of fruit plantations. See Carile, 1994: 50; 1996: 49. Gray, 1929: 47-51, in particular 50. Cannizzaro, 1913; 1916: 23-88. Zaehner, 1956: 22. Jamasp-Asana, 1913: 43 Zaehner, 1956: 115, par. 63. Jamasp-Asana, 1913: 151. Zaehner, 1956: 86, parr. 16-17. See de Menasce, 1945: 24, 25. Zaehner, 1956: 87, parr. 20-24.

Commerce and Conflicts of Religions

387

sr%g"h, abar dast art#št r"h, abar aškamb w stary%š"h, abar pay husar tuxš"h].18 According to this scheme, of the four virtues indwelling man, i.e., temperance (x#m), fortitude (hunar), reason (xrad) and energy (tuxš g"h), the “reason corresponds to the caste of husbandmen, for the function of reason is the tilling of the soil and the promotion of a continuous evolution towards the final Rehabilitation. Energy corresponds to the caste of artisans, for it is the greatest stimulant of their trade”19 [abar w stary%š n xrad " hast xrad"h k r"h " warz"dan " g#h n paywastan " % frašgard. abar hu-tuxš n tuxš g"h " hast mahist raw g#n"d r"h "-š n p#šag].20 Although trade and caravans21 played an important role in the Sasanian economy, in particular on the international market between China and the West already from the Parthian period thanks to the Silk Road,22 the priestly ideology remained very conservative and maintained for a long period a very sceptical attitude towards tradesmen and their job. This position, reflecting a “political” view of the clergy, is patently expressed in a long passage of the D#nkard, on which Molé23 and Gnoli24 have rightly attracted scholars’ attention: D#nkard, III, ch. 69:25 Abar mas *ud may nag ud kas k r k r az nig#z " weh d#n. (1) h d andar%n " weh d#n k r ham g n " kirbag ud kirbag n " dahm"h ud dahm"h n " d m abz y#n"d r ud mas k r @an " druz w n"d r"h tar ud g#h n " ahl y"h freh-dahišn"h tar. (2) n " andar 4 p#šag " d#n m zd#sn: andar sr%n"h p#šag n abardom yazišn " yazad n $ šišn"h ["] ud %šmurišn " d#n, wiz"r"h ud d dwar"h kardan ud ab r"g sr%n"g. ud andar art#št r"h asw r n ud pay dag"h ud ab r"g art#št r"g. ud andar w stary%š"h pasušurun"h ud ab r"g w stary%š"g. ud andar hu-tuxš"h n n p k ud xwahl"g r"h ab r"g hu-tuxš"g k r. (3) ud az#r sr%n"g k r t k r n fr%d ud nidom andar ab r"g 3 p#šag ham g miy nag baw#d. ud fr%d ud nidom " k r n w z rag n"h abdom k r " andar w stary%š"h p#šag. (4) u-š andar xw#š s m n " azabar andar dahm"h n " az#r kast r"h paywand. n "-š azabar s m n az n%h k& pad#x"h ud d rišn " mard%m n g%spand n freh az n " mard%m pad g%spand-iz m n#nd ab yišn"g xr"n#nd abar d štan ud waz#n"dan " mard%m ud g%spand ab yišn"g pad#x"h ud d rišn % n%h k& hamb r ud b r "-š andar kem n " pad pad#x"h d rišn " mard%m n g%spand n " pad-iš m nišn hast ab yišn"g n%h k& xr"n#nd r st xr"n#nd ud n%h k& fr%xš#nd ud andar r st fr%xš#d. (5) #d r y $# 18 See de Menasce, 1945: 24, 25. 19 Zaehner, 1956: 87, par. 28. 20 See de Menasce, 1945: 26, 27. 21 Fragner, 1990: 795-798. 22 Miller, 1969, passim. We cannot forget the importance of Sasanian trade in Northerneastern Russia, as shown by Frye, 1972. 23 Molé, 1963: 424-425. 24 Gnoli, 1989: 160, n. 37. 25 Madan: 59, l. 11, 61; Dresden, 1966: 43-44.

388

Antonio Panaino

az-iš abz%n ay r"h " g%spand n mard%m n ud abz y#n"dan " g#h n pad paywastan " k r warzišn "-š n #g % did kirr%g andar dahm"h #d%n pad a-windišn"h az n "-š azabar g#h n mas s&ddar p#šag k r ud n n ud w#š zahišn"h " xw#š ud k#d d"g andar parwarišn"g"h dastwar"h kunišn"h weh d#n dastwar. (6) u-š fr%d nidom k r"h az-iz #d ka az-iš n-iz " andar dahm"h parwand pad awindišn"h " n n ud weh zahišn"h az n k r " andar w stary%š"h ud sr%n"g ud art#št r"h ud hu-tuxš"h dastwar"h . ud s m n "-š % adahm"h parwand xr"dan ud andar ham šahr pad pad#x"h ud d rišn " mard%m n g%spand gar ntar ud gar n win htar pad %rd xw stan " az-iš niy z ud tang"h " amarag n pad paywand u-š w#m r-iz ud s# " mard%m n ud g%spand n-iz t#x az zor#n"dan " an#r pad zanišn " #r n #d r y $#-š tang"h " g#h n zanišn zy n " #r mard%m pad-iš az dahm"h b#r%n ud % kast r"h paywand d r#d t pad gar ntom win h"h weh d#n <wi>z r. “On the various works, the best, the intermediate and the lowest ones, according to the Good Religion. (1) Then, in the framework of the Good Religion, all the works are meritorious deeds, and meritorious deeds are those piously done, and piously done are those (works) increasing the creation. The supreme activity is that mostly overcoming the druz and mostly developing the world of rightness. (2) These (workers) are (visible) in the four classes of the Mazdean Religion:26 in the priesthood, highest class, the worship of the gods, the teaching and the study of the religion, the application of judgement and justice and the other priestly deeds. In the warriorhood, riding, marching and the other military deeds. In the husbandry, the breeding and the other agricultural activities. In the artisan class, the bread cooking and the preparation of the food and the other activities of the artisans. (3) Under the priestly work down till the lowest and least of activities all the works in the other three classes are “intermediate”. And the lowest and least of the works is trade, the last work among those in the class of husbandry. (4) And in its superior limit it belongs to the pious works, (but) for its inferior limit to iniquity. Its superior limit (is based on the condition that), from there where there are more things than necessary to the prosperity and the preservation of human and animal beings, (these) things necessary to the prosperity and the preservation of human and animal beings which are bought, removed and transported there where the storehouses and the banks (shores) that, there, are inside, remain fewer than what is necessary for assuring the prosperity and the preservation of men and animals. There where purchase is done, purchase is done honestly; there where sale is done, sale is done honestly. (5) And because such an activity supports prosperity of animals and men and increases the world by linking their actions each other, the artisan lies within the limits of pious activities (only when he is) in the impossibility of finding out an activity — among these staying above — that is more advantageous for the world in order to gain his own bread and subsistence and which the Good Religion authorizes as a legal means of survival. (6) (But) this 26 See also the Letter of Tansar; cf. Boyce, 1968: 37-38.

Commerce and Conflicts of Religions

389

is the lowest and least activity, also when, although it is placed within the limits of pious activities, it is legal in the impossibility of gaining its bread and subsistence in the exercize of another agricultural, priestly, warrior and artisanal activity. Its limit with unpious activities lies when in the same country, where there is prosperity of things indispensable for the comfort and entertainment of men and animals, there is a pretension for grain of prices higher (than right) and with a great sin. From this (derive) misery and countless distress and consequently illness and troubles to men and animals, enforcing then the sharp edge of the An#r"n with the striking of the Iranians. This (happens) because the narrowness of the world and the damages striking the Iranians are outside of (religious) pity and are connected with iniquity and also with the worst sins declared by the Good Religion”.27 From this passage we deduce not only that trade was considered “the lowest and least” among the legal professions permitted by the Mazdean Religion, but that although its positive effects were some how recognized (importation and exportation of goods necessary to human and animal life), some heavy prejudices infected its role. The final paragraph of chapter 69 of the third book of the D#nkard in fact underlines the dangers of that profession: in particular the dishonesty of commerce and the pretension of earning more than its due imposing higher prices. The only example given in the passage quoted above strictly refers to the grain; this probably means that the tradesmen were suspected of illegal gain with respect to the husbandmen who actually did the basic job for the sustenance of the land and for the production of richness. The text doubtless tries to show that commerce and trade are dangerous activities from the religious point of view because their exercise was too close to robbery. In this framework the worst aspects of trades were considered as an inner support to the enemies of $r"n. It is also interesting to note that “misery and countless distress and consequently illness and troubles to men and animals” were considered as effects of bad, illegal, and of course immoral trade, while there is no mention of any problems directly connected to the production of grain and other means of sustenance. It is clear that the priestly ideology states that the sacred activity of agriculture does not imply in se any immorality; furthermore we do not find any mention of the unequal division or distribution of the properties or of the income coming from the agricultural work, but the responsibility is attributed to the final distribution of grain etc., i.e. to the market. This conclusion doubtless reflects an ideological prejudice more than the economic interests of the landlords and of the great owners of cultivate lands, who were the social pillars of the Zoroastrian culture; in fact, the latifundia produced a surplus that was necessarily sold out. It is clear that these bold suspects against the tradesmen correspond also to a number of conflicts between the rich landlords, who considered commerce a socially low and vulgar activity, and an important class or social group of tradesmen, who in any case had an important economic role in Sasanian Iran and were organized in 27 See also the translations by Molé, 1963: 424-425, and of de Menasce, 1973: 75-76.

390

Antonio Panaino

associations or companies.28 In fact we cannot believe that commercial activities were a minor item in the economy of Pre-Islamic Iran, and that the merchants, some of them probably very rich, who were involved in these trades, did not contribute to the development of the Sasanian central and provincial treasures with the taxes they paid. We cannot forget that the Sasanian customs barrier was a significant instrument of power but that the Sasanians did not exercize any kind of blind and autocratic economy. In the third article (kata£ tri¢thn ta¢cin) of the treaty of the peace negotiated after the Lazic war29 by Peter the Master of Offices, as delegate of Justinian,30 and Zik Yazdgušnasp, as delegate of Xusraw I,31 in 562, it was established that both Roman and Sasanian tradesmen were allowed to import and export their goods, but that all these stocks had to pass through the Persian customs offices. According to article four,32 it was also established that official representatives and commercial letters might freely use the foreign post system33 and that all the goods might be imported and exported without paying any custom duty.34 Although this liberalization of the market was compensated through an annual payment35 of 30.000 golden pieces (tria/konta xilia¢daj 36 37 e¦thsi/aj xrusi/ou nomi/smatoj) or — as some sources attest — of 500 28 See Pigulevskaja, 1963: 178-181. 29 Frye, 1983: 327; Bury, 1929, 2: 113-123.Very important is the analysis of this treaty offered by Winter, 1987: 67-72. 30 We may recall that it was Ernst Stein (1919: 140; 1920: 82-87) who assumed the influence of a Sasanian model on the thema-constitution developed under Heraclius, but already based on some administrative reforms carried through by Justinian, while Darkó (1937: 135-147) assumed a common “Turanian” background. See in particular Løkkegaard, 1950: 65. 31 See apud Menander Protector (Bekker - Niebuhr, 1829: 360; Müller, 1851: 212). See also the new edition with English translation offered by Blockley, 1985: 70-71. Cf. Güterbock, 1906: 57- 105; Bury, 1929, 2: 121-123. 32 See apud Menander Protector (Bekker - Niebuhr, 1829: 360; Müller, 1851: 212; Blockley, 1985: 70-71). Cf. Güterbock, 1906: 57- 60; Bury, 1958: 121-123; Dodgeon - Lieu, 2002: 132. 33 About the existence of a Sasanian post system see Løkkegaard, 1950: 159; Dodgeon - Lieu, 2002: 132. 34 See Christensen, 1944: 125. 35 As Carile remarks (1994: 54; 1996: 47, 54), this amount was given to the Sasanians in compensation of the economical damage suffered after the transfer of Lazica, and consequently of the unique Persian access to the Black Sea, to Byzantium. See also Iluk, 1985. 36 See apud Menander Protector (Bekker - Niebuhr, 1829: 352; Müller, 1851: 208-209; Blockley, 1985: 70-61). As Güterbock (1906: 63-65) already suggested, the fact that Menander mentions only 30.000 nomismata cannot be explained as a mistake, but with the probable assumption that he was referring to an older golden issue (i.e. the aureus of Diocletian), that was 1/60 and not 1/72 of libra. See also Carile, ibidem. Güterbock (ibidem) insists on the fact that the reference to 30.000 ... nomi/smatoj (and not nomi/smata) is given to a unity of measure of account and not to the coin itself. See also Dodgeon - Lieu, 2002: 131-132. 37 See Johannes Epiphaniensis: xrusi/ou li/traj pentakosi/aj e¦f aiÒj eÓmprosqhn gego¢nasin ai¸ spondai/ (Müller, 1851, F.H.G. 4, 274) “500 pounds of gold which the agreement established before”; Theophylactus Simocatta, 3, 9: a¦n” eÓtoj eÁkaston pentakosi/aj li/traj xrusi/ou — aÁj Ioustiniano£j basileu£j taiÍj sunqh¢kaij diwmolo¢ghsen “the annual payment of 500 pounds of gold, which the emperor Justinian had conceded in the agreement” (tr. of M. and M. Whitby, 1997: 86); Theophanes, 245: a¦na£

Commerce and Conflicts of Religions

391

golden librae, that is to say about 36.000 nomismata, to the Sasanian crown by Byzantium, it shows that Xusraw probably tried to support a better circulation of goods and stocks, and that in any case this activity was among his main political interests. But this deep attention for markets and trades was not a later trend in Sasanian politics; we may in fact recall another fitting example emerging from the peace settlement between Diocletian and Nars#s (298 or 299 AD) according to the version of Petrus Patricius.38 Nars#s actually accepted all conditions imposed by the Romans but strongly protested against the point of the agreement imposing that only “the city of Nisibis, which lies on the Tigris, should be the place for transactions” (eiÕnai de£ to¢pon t%¤n sunallagma¢twn Ni/sibin th£n po¢lin 39 parakeime¢nhn t%Í Ti/gridi). The Sasanian care in controlling the commercial roads doubtless confirms the political attention of the crown to the income resulting from import/export exchanges with foreign countries” as their strenuous attempts preventing any direct trade between Centro-Asiatic peoples and Byzantium.40 On the Western border,41 Byzantium and the Sasanian Empire were continuously in conflict42 not simply for “spiritual” reasons, but because of the direct domination of the commercial roads, both by earth and by sea, e.g. in Caucasus and in the Transcaucasian area, but also in Syria, Egypt and Arabia.43 The presence of various important sources (gold, silver, copper, rock-crystal, rare pearls etc.), confirmed also by Chinese travellers,44 but also the exportation towards China and the East of carpets and fard, precious stones and valuable cloths, corals and other fine and expensive goods, no doubt show that the artisans’ works and the related trades played a first level role in Sasanian economy.45 In addition the partial control46 of the silk trade and the Iranian production of silk products from imported Chinese silk allowed Sasanians to be leaders of the exportations towards the West, where they tried to impose a kind of monopw¢lion47 imposing high prices this enormous income decreas a lot only after the 6th century A.D. when the Byzantines became able to develop an

eÓtoj pentakosi/ouj li/traj xrusi/ou “500 pounds of gold for year”. Cf. Dodgeon - Lieu,

2002: 131-134. 38 Petrus Patricius, fragment 14 (Müller, FHG IV, 1851: 189); see also Dodgeon - Lieu, 1991: 133. Cf. also Winter, 1987 and Winter - Dignas, 2001: 205-207. Cf. also the later regulations established in 408/9 A.D.; see also Cod. Iust. IV 63, 4. I have to thank Prof. J. Wiesehöfer for this kind information. 39 See in particular the detailed discussion of this treaty offered by Winter, 1987: 47-58. 40 Cf. also Carile, 1994: 50-56. About espionage on the border and trades activities see Lee, 1993. 41 See Millar, 1993. 42 See Dodgeon - Lieu, 1991. 43 Pigulevskaja, 1969: passim; Miller, 1969. See Carile, 1994: 50-52; 1996: 48-49 with more details and other bibliography. 44 See in particular Beal, 1885, II: 277-278. 45 Christensen, 1944: 126. 46 We shall recall that the Sogdians preserved their independence and that they controlled the most eastern part of the Silk Road; see Haussig, 1983: 169-171; Frye, 1983: 351-355. 47 See, on the contrary for the Byzantine reaction, Pigulevskaja, 1969: 85 and passim.

392

Antonio Panaino

autonomous production of silk.48 Shipping trades also were another important item in Sasanian economy already since the times of Ardaxš%r;49 Sasanian ships were significantly present in many Oriental seas and their activities were in ruthless competition — as already remarked — with the Roman trades.50 Thus the Islamic conquest of Sasanian Iran found a developed society, where the process of urbanisation with its markets and bazaars was very significant.51 In addition to all these facts we shall underline that a w z rbed (Parth. w žarbed; Gr. a¦gorano¢moj), i.e. “the chief of the bazaar”, a kind of administrative officer, was considered worthy to be mentioned in the trilingual inscription of Š"buhr I at the Ka‘ba % Zardošt, 52 although he appears in a low position of the list.53 These data confirm the idea that the contempt attested in Pahlavi texts also in later times after the Arab invasion did not represent the political and economic interests of the crown as actually reflected in Sasanian politics. It was just a conservative ideological position, based on ancient patterns and on an ideal model of society, even if not directly corresponding to that attested in Avestan texts, very archaic and obsolete. The overwhelming impact played by the market society in Sasanian Iran through the multi-ethnic role played by Jews54 and Christians, whose activity continued also during the Arab domination,55 probably emphasized this ideological prejudice by the Zoroastrian priestly class, whose nationalism56 conditioned some moments of Iran history. We shall just briefly mention the importance of these controversial trends in Sasanian society during the first century of the Manichaean history, where the clerical Mazdean persecution against Mani and his followers found its most seminal field, not only in the new and weak king, Wahr"m I, but more significantly in the noble landlords. The Zoroastrian religion in fact considered agriculture, as we have seen, one of the most sacred activities, while for the Manichaeans it was a kind of sin, a sort of violence against the earth; thus, the progressive diffusion of Manichaeism represented, as Gnoli has rightly underlined,57 a concrete danger for the pillars of Sasanian feudal power and economic sources of income, while it is not peculiar if such a religion was very successful among tradesmen.58 Such a dangerous doctrine was well understood by 48 49 50 51 52 53 54 55 56 57 58

Christensen, 1944: 128. Christensen, 1944: 128. Reinaud, 1863: 267-268. See Lombard, 1971: 140-149; Pigulevskaja, 1963: 158-194. Cf. also the catalogue of the provincial capitals of the $r"nšahr which the Pahlavi text Šahr st n"h " 'r n dealt with (Marquart, 1931). See Huyse, 1999, I: 62; II; 176-177; cf. Christensen, 1944: 129. We have to remark the existence of a w stary%š n-s l r or w stary%š-bed, “the chief of the poll tax”, well known from Arabic sources; see Christensen, 1944: 122-123 and passim. See Widengren, 1957; 1960; 1961; Neusner, 1983; 1986. See Lombard, 1971: 223-253. See Gnoli, 1989: 156; cf. also Gnoli, 1984. See Gnoli, 1984: 43 and 1989: 160, who mentions, quoting Theodor bar Q&n% (“merchandise of calm and peace”; see Cumont, 1908: 77; Jackson, 1932: 230, n. 2), the positive and metaphorical meaning attributed in Manichaean scripts to the “merchandise”. See Adam, 1961: 118-119.

Commerce and Conflicts of Religions

393

Zoroastrians who expressly mention it, e.g., in the D#nkard, III, 200,59 where among the twelve advices of the Sasanian wise man, !durb"d % Mahrasp"nd"n, the sixth one states: ... #k pad"rag n " ahl y"h- r st r durb d az a-d d"h kuštan " g w n ud g%spand n pahr#z handarz[#n"d], druz xastag m n" pad g#h n a-warzišn"h dawistan d rišn " hamist mard%m n ftan g%spand ab g mard%m ab#s"h#n"dan dawist.60 “Contrary to that which the restorer of righteousness, !durb"d, declared (namely) the abstention from unlawful killing of cattle and small cattle, the crippled demon M"n% in his clamouring about non-agriculture in the world, in his rejecting of the maintenance of mankind as a whole, clamoured that the small cattle should be destroyed together with mankind ”.61 It is unnecessary to recall that these accusations do not explain the basic reasons of the Manichaean program of purification of the light imprisoned in the earth, in the matter and then in the darkness, but from the opposite and antagonist Zoroastrian point of view they can give an idea of what the Sasanian clergy thought of Manichaeism. Apropos of this situation, Gnoli has rightly noted how this — in some respect — archaic and conservative society, although full of many contradictions62 (that will later explode in the antagonism between the most important landlords and the little noble landowners [dehg n]),63 should have been scandalized and shocked by these new and subversive teachings. On the contrary, for a person like Mani, of Iranian origin, but educated in the Mesopotamian area, where the urban economy was very rich and developed, these ideas appeared quite sound.64 But while the different socio-cultural background of the first Manichaeans did not produce a real and crude turmoil in the Sasanian society, the heavy economical situation exploded after seven years of drought and famine during the kingdom of P#r&z and the severe conditions imposed by the Hephthalites determined new politico-religious trends (generally connected with the Mazda-

59 Madan, 216; Dresden, 1966: 170, ll. 4-7. Text according to Olsson, 1991: 279. 60 For a more detailed analysis of the passage see de Menasce, 1945: 231. I follow here the translation given by Olsson, 1991: 282. 61 See also the translation of de Menasce, 1973: 219-220. 62 Gnoli (1984: 43) assumes that in the late Parthian period the economic and political situation knew an evolution comparable to that attested in the colonatus of the Roman Empire (with reference to Mazza, 1973: 205-216; 1979: 460-474). 63 Their condition knew a sensible improvement when, after Xusraw’s reform, they were, as Frye (1984: 326) writes, “paid and equipped by central government”. This way they directly depended upon royal authority and not upon the great nobles, whose fidelity to the crown was not so sure, as already remarked by Pigulevskaja (1937). According to Altheim - Stiehl (1954: 46-50), the tax reform of Xusraw should have reduced the economical power of the noble landlords, bringing to the royal treasury a higher and direct income. 64 Gnoli, 1984: 44.

394

Antonio Panaino

kites),65 which stirred up and shacked the Iranian world. Although the precise origin of Mazdak’s doctrine, if deriving either from Mazdeism of Manichaeism, has been disputed,66 in any case it reversed the basic patterns of social inequality, imposing a sort of apparently crude “communism”, aiming at the distribution of landed properties and of women. Mazdakism, which, I think, was a Zoroastrian heresy, probably with Gnostic (also thus only lato sensu connected with Manichaean) and Kabbalistic elements,67 clearly represented a revolt against the great feudal and noble lords with a certain support by the peasants,68 whose conditions were probably very poor.69 But the strong repression of that movement by Xusraw I did not correspond to a restoration; the new king introduced in fact a radical tax reform with some military and administrative innovations, that, although some of its aspects still raise problems and a complex debate70 (in particular as regard its possible relations with the tax reform introduced by Diocletian),71 re-establishing more equity and giving the dehg n new privileges and put them under the direct authority of the crown.72 But the political effects of these social proto-revolutionary movements were felt also in Byzantium. As Carile remarks,73 following and improving a suggestion advanced by Jarry,74 the circumstance that the praefectus Erythrios and another patricius named Ateneos suggested to Justinian, during the bellum persicum, to adopt Mazdakism,75 in order to conquer Asia, has to be seriously taken into consid65 We have of course to take into consideration the fitting distinction proposed by Patricia Crone (1991) between the first kingdom of Kaw"d I, whose politics does not seem to have been directly determined by Mazdak, and the second one, when the role of Mazdak was boldily effective. 66 While Christensen (1925) assumed that Mazdak was a Manichaean, Altheim (1961: 61-80; 1963; cf. also Altheim - Stiehl, 1954: 189-206) underlined his Zoroastrian origin, but with a strong emphasis on a Greek Neo-Platonic influence; other supportive elements of the Zoroastrian background of Mazdakism have been offered by Molé (1961; 1962: 188-206) and more recently by Shaki, 1970; 1985; we may also recall two very important monographic contributions offered by Klíma (1957; 1977) that deal particularly with the socio-political aspects of Mazdakism; see also Pigulevskaja, 1963: 195-230. For the impact of Mazdakism on some sects of the Islamic period see in particular Sadighi (1938) and Yarshater (1983). 67 See more recently Shaked, 1994: 125-131 and Gnoli (forthcoming). Very important is the historical reconstruction of the facts offered by Crone, 1991, who rightly distinguished between a first period in which it was only king Kaw"d who imposed some economic and social reforms, in particular against the nobles and their harems, while only in a second period, after the king’s reconquest of power, Mazdak would have leaded the social protests. 68 Frye, 1983: 322-333. 69 On the existence in the Sasanian period of a poor class of farm workers, socially weak and practically deprived of personal freedom, see Løkkegaard, 1950: 172-174. 70 For a very deep reflection on the scholarly discussion in the light of the Arabic sources, see in particular Grignaschi, 1971. Cf. also Løkkegaard (1950) and Dennett (1950: 14-16). 71 This hypothesis has been advanced by Pigulevskaja, 1937 and, with a different framework by Altheim - Stiehl, 1957: 35-53. Against it see Hahn, 1959. Cf. also Grignaschi, 1971. 72 See Frye, 1983: 325-326. 73 1994: 50; 1996: 49-50. 74 See Jarry, 1968: 335-337. Cf. also Carile 1978: 59-60. 75 The source for this episode is represente by John bishop of Nikiu (VII century), who makes references in his Chronicle (see Zotenberg, 1833: 389-390) to the speech of Addaeus and

Commerce and Conflicts of Religions

395

eration. In fact it could mean that some Byzantine élites understood that a change in the social hierarchy, with a more influent support to commerce and tradesmen, generally snobbed also by the Western aristocracies, might open the way for a social and cultural unification of East and West. It has to be underlined the interesting circumstance, noted by Pigulevskaja,76 Altheim77 and also by Grignaschi,78 that Kaw"d’s politics, who heavily damaged the highest noble families when he was supporting the Mazdakite movement,79 played a direct impact on the restarting of foundation of royal cities to which some administrative provinces were directly annexed. These data confirm the complexity of the economical history of the Sasanian Empire and show some of the inner contradictions opposing the interests of the greatest nobles and those of the dehg n, as well as the rich landlords and tradesmen. Thus, it seems that the Church and the crown that should have been theoretically in agreement, did not always share the same perspective, and certainly in the last period of the Sasanian empire their evaluation of the urban economy and of the market system was not ideoIn logically conclusion coincident we may at note all. that, although in some cases Sasanian politics and clergy ideology agreed, as in the case of the persecution against the Manichaeans, the social doctrine of the Mazdean Church, in particular its scorn for tradesmen and their works, did neither limite the commercial activities nor it stopped royal supports for tradesmen, as is it confirmed by some crucial events of Iranian history and also by the great monetary circulation,80 generally in silver, developed in Sasanian Iran. The anti-tradesmen prejudice remained limited to a religious and conservative bias,81 that the priests preserved, at least in their religious books, for some centuries after the collapse of the Empire. But this “traditional” attitude changed under the compelling impact of the Zoroastrian emigration towards India, where the new Parsi community flourished in areas where commercial activities probably existed already since the Sasanian period. In these new foreign lands Zoroastrians found their fortune as artisans and tradesmen, being the property of latifundia very difficult for them there. In this context that had, completely changed with respect to that of their original homeland, Parsis insisted on the natural reliability stemming from the basic “dogmata” of their religion: “good thoughts”, “good words” and “good deeds”. This simple credo

76 77 78 79 80 81

Aetherius with the Byzantine Emperor; both nobles were related by Johannes to the doctrine of a certain Masedes, who cannot be nobody else but Mazdak. Erythrios’ antagonism towards the administrative politics of the emperor Zeno has been discussed by Jarry (1968: 242-244); we can also recall that Erythrios’ wife (cf. also Ioan. Malalas, p. 423) was condemned to death as Manichaean after the edict of year 527. The penetration of Manichaean doctrines in Byzantium is confirmed by Michael Syriacus (ed. Chabod, 2, p. 191). See again Jarry, 1968: 343 and the considerations by Carile, 1978: 54-61. Pigulevskaja, 1937; 1963: 209-218. Cf. already Bartol’d, 1923: 56-57. Altheim in Altheim - Stiehl, 1954: 189-206; 1957: 31-35. Grignaschi, 1971: 121. A probable relation between the Mazdakite revolt, interpreted as a peasant protest and Xusraw’s reform, has been suggested by Pigulevskaja, 1963: 195-230. Lombard, 1971: 119-136. About the Silk Road see now Alram, 2002: 40-44. See Boyce, 1970.

396

Antonio Panaino

was presented as a good witness, like a sort of patent or guarantee of their own honesty in trades and affairs and no discredit was socially attributed to the main new source of income. A new homeland imposed a new scale of values.

Commerce and Conflicts of Religions

397

Bibliographical References Adam, A. (1961) Manichäismus, pp. 102-119. In Handbuch der Orientalistik. I, 8, 2. Leiden - Köln. Alram, M. (2002) Die Geschichte der Seidenstraße im Spiegel der Münzen. Mitteilungen der Österreichischen Numismatischen Gesellschaft, 42/2, pp. 3445. Altheim, F. (1961) Geschichte der Hunnen. Bd. 3. Berlin. Altheim, F. (1963) Mazdak and Porphyrios. History of Religions, 3/1, pp. 1-19. Altheim, F. - Stiehl, R. (1954) Ein asiatischer Staat. Feudalismus unter den Sasaniden und ihren Nachbarn. Wiesbaden. Altheim, F. - Stiehl, R. (1957) Finanzgeschichte der Spätantike. Frankfurt am Main. Bartol’d, V.V. (1923) K istorii krest’janskich dviženij Persii (On the History of peasants’ insurrections in Persia). Sbornik v $est’ pjatidesjatiletija nau$noj žizni N.I. Kareeva. Petrograd. Reprinted in Bartol’d, V.V. (1971) So$inenija. Tom VII. Raboty po istori$eskoj geografii i istorii Irana. Moskva, pp. 438449. Beal, S. (1885) Si-Yu-Ki. Buddhist Records of the Western World. Translated from the Chinese of Hiuen Tsiang (A.D. 629) by S. Beal. In two volumes. Boston. Bekker, I. - Niebhur, B.G. (1829). Corpus Scriptorum Historiae Byzantinae. Deixippi, Eunapii, Petri Patrici, Prisci, Malchi, Menandri historiarum quae supersunt e recensione I. Bekkeri - B.G. Niebuhri. Berolini. Blockley, R.C. (1985) The History of Menander the Guardsman. Introductory Essay, Text, Translation, and Historiographical Notes. Liverpool. Boyce, M. (1968) The Letter of Tansar. S.O.R. 38. Roma. Boyce, M. (1970) Toleranz und Intoleranz im Zoroastrismus. Saeculum, 21/4, pp. 325-343. Bury, J.B. (1929) History of the Later Roman Empire from the Death of Theodosius I to the Death of Justinian. Two Vols. New York. Cahen, Cl. (1957) La Féodalité et les institutions politiques de l’Orient Latin, pp. 167-191. In Accademia Nazionale dei Lincei. Atti del XII Convegno “Volta”. Roma. Cannizzaro, F.A. (1913) Il Capitolo georgico dell’Avesta. Vendîdâd III. Messina. Cannizzaro, F.A. (1916) Il Vendidad. Messina (reprinted with a contribution of A. Panaino, Milan 1990). Carile, A. (1978) Consenso e dissenso fra propaganda e fronda nelle fonti narrative dell’età giustinianea, pp. 37-93. In L’imperatore Giustiniano. Storia e Mito. A cura di G.G. Archi. Milano. Carile, A. (1994) Materiali di Storia Bizantina. Bologna. Carile, A. (1996) Il Caucaso e l’Impero Bizantino, pp. 9-83. Il Caucaso; Cerniera fra Culture dal Mediterraneo alla Persia (secoli IV-IX). 20-26 aprile 1995. Settimane di Studio del Centro Italiano di Studi sull’Alto Medioevo. XLIII. Spoleto.

398

Antonio Panaino

Christensen, A. (1907) L’empire des Sassanides. Le peuple, l’état, la cour. København. Christensen, A. (1925) Le règne du Roi Kaw dh I et le communisme mazdakite. København. Christensen, A. (1944) L’Iran sous les Sassanides. Copenhagen. Colditz, I. (2000) Zur Sozialenterminologie der iranischen Manichäer. Eine semantische Analyse im Vergleich zu den nichtmanichäischen iranischen Quellen. Wiesbaden. Crone, P. (1991) Kav"d’s Heresy and Mazdak’s Revolt. Iran, 29, pp. 21-42. Cumont, F. (1908) Recherches sur le manichéisme. Brussels. Darkó, E. (1937) Influences touraniennes sur l’évolution de l’art militaire des Grecs, des Romains et des Byzantins. Byzantion, 12, pp. 118-147. Dennett, D.C. (1950) Conversion and Poll-Tax in Early Islam. Cambridge (Mass.). Dodgeon M.H. - Lieu, S.N. (1991) The Roman Eastern Frontier and the Persian Wars (AD 363-630. A Narrative Sourcebook. London - New York. Dodgeon M.H. - Lieu, S.N. (2002) The Roman Eastern Frontier and the Persian Wars. Part II. AD 226-363). A Documented History. New York (reprint 1994) Dresden, M.J. (1966) D#nkart. A Pahlavi Text. Facsimile Edition of the Manuscript B of the K. R. Cama Oriental Institute Bombay. Wiesbaden. Fiorani Piacentini, V. (1984) La presa di potere sassanide sul Golfo Persico tra leggenda e realtà. CLIO, 20/2, pp. 173-211. Fragner, B. (1990) Caravan, pp. 795-798. In Encyclopædia Iranica. Vol. IV. Ed. by E. Yarshater. London and New York. Frye, R.N. (1972) Byzantine and Sasanian Trade Relations with Northeastern Russia. DOP, 26, pp. 263-269. Frye, R.N. (1983) The History of Ancient Iran. München. Frye, R.N. (1993) Commerce in the Parthian and Sasanian Periods, pp. 61-64. In Encyclopædia Iranica. Vol. VI. Ed. by E. Yarshater. Costa Mesa. Gnoli, Gh. (1984) Universalismo e nazionalismo nell’Iran del III secolo, pp. 3154. In Incontro di Religioni in Asia tra il III e il X secolo d.C. A cura di L. Lanciotti. Firenze. Gnoli, Gh. (1987) The Idea of Iran. An Essay on Its Origin. Rome. Gnoli, Gh. (forthcoming) Nuovi Studi sul Mazdakismo. In Atti del Convegno sul Tema: La Persia e Bisanzio. 14-18 ottobre 2002. Roma. Goodblatt, D.M. (1979) The Poll-Tax in Sasanian Babylonia. Journal of the Economic and Social History of the Orient, 22, pp. 233-294. Goubert, P. (1951) Byzance avant l’Islam. I. Byzance et l’Orient sous les successeurs de Justinien, l’empereur Maurice. Avec une préface de L. Brehier. Paris. Gray, L.H. (1929) The Foundations of the Iranian Religions. Bombay. Grignaschi, M. (1971) La riforma tributaria di ›osr& I e il feudalismo sassanide, pp. 87-147. In La Persia nel Medioevo. (Roma, 31 marzo — 5 aprile 1970). Roma.

Commerce and Conflicts of Religions

399

Güterbock, K. (1906) Byzanz und Persien in ihren diplomatisch-volkerrechtlichen Beziehungen im Zeitalter Justinians. Ein Beitrag zur Geschichte des Völkerrechts. Berlin. Hahn, I. (1959) Sassanidische und spätrömische Besteuerung. AAASH, 7, pp. 14960. Haussig, H.W. (1992) Die Geschichte Zentralasiens und der Seidenstrasse in Vorislamischer Zeit. Darmstadt. Henning, W.B. (1935) Arabisch ‹ar ‚. Orientalia, 4, pp. 291-293. Huyse, Ph. (1999) Die dreisprachige Inschrift Š buhrs I. an der Ka‘ba-i Zardušt (ŠKZ), 2 Vols. London. Iluk, J. (1985) The Export of Gold from Roman Empire to Barbarian Countries from the 4th to the 6th Centuries. Münstersche Beiträge zum antiken Handelsgeschichten, 4, pp. 79-102. Jamasp-Asana, J.M. (1913) The Pahlavi Texts. Vol. II. With an Introduction by B.T. Anklesaria. Bombay. Jackson, A.V.W. (1932) Researches in Manichaeism. New York. Jarry, J. (1968) Hérésies et factions dans l’empire byzantin du IVe au VIIe siècle. Le Caire. Johannes Epiphaniensis (1851) Fragmenta Historicorum Graecorum, pp. 200269. Herausgegeben von C. Müller. Band IV. Paris. Klíma, O. (1957) Mazdak. Geschichte einer sozialen Bewegung im sasanidischen Persien. Praha. Klíma, O. (1961) Mani’s Zeit und Leben. Prag. Klíma, O. (1977) Beiträge zur Geschichte der Mazdakismus. Dissertationes Orientales 37. Praha. Lee, A.D. (1993) Information and Frontiers. Cambridge. Løkkegard, F. (1950) Islamic Taxation in the Classic Period with Special Reference to Circumstances in Iraq. Copenhagen. Lombard, M. (1971) L’Islam dans sa première grandeur. Paris. Macuch, M. (1981) Das sasanidische Rechtsbuch “M takd n i haz r d tist n” (Teil II). Wiesbaden. Macuch, M. (1993) Rechtskasuistik und Gerichtpraxis zu Beginn des siebenten Jahrhundert. Wiesbaden. Markwart, J. (1931) A Catalogue of the Provincial Capitals of 'r nšahr (Pahlavi Text, Version and Commentary). Ed. by G. Messina. Roma. Mazza, M. (1973) Lotte sociali e restaurazione autoritaria nel III secolo d.C. Bari. Mazza, M. (1979) Terra e forme di dipendenza nell’impero romano, pp. 441-493. In Terre et paysans dépendants dans les sociétés antiques. Colloque international tenu à Besançon les 2 et 3 mai 1974. Paris. Menander Protector (1851) Fragmenta Historicorum Graecorum, pp. 200-269. Herausgegeben von C. Müller. Band IV. Paris. Menasce, J. de (1945) Škand-Gum n"k vi$ r. La Solution décisive des doutes. Texte pazand-pehlevie transcrit, traduit et commenté. Fribourg-en-Suisse. Menasce, J. de (1964) Feux et fondations pieuses dans le droit sassanide. Paris. Menasce, J. de (1973) Le troisième livre du D#nkart traduit du pehlevi. Paris.

400

Antonio Panaino

Millar, F. (1993) The Roman Near East 31 BC - AD 337. London. Miller, J.I. (1969) The Spice Trade of the Roman Empire. Oxford. Molé, M. (1961) Le problème des sectes zoroastriennes dans les livres pehlevis. Oriens, 13-14, pp. 1-28. Molé, M. (1962) Une histoire du mazdéisme est-elle possible ? Notes et remarques en marge d’un ouvrage récent. RHR, 81, pp. 161-218. Molé, M. (1963) Culte, mythe et cosmologie dans l’Iran ancien. Le problème zoroastrien et la tradition mazdéenne. Paris. Müller, C. (1851) Fragmenta Historicorum Graecorum collegit, disposuit, notis et prolegomenis illustravit C. Mullerus. Volumen Quartum. Parisiis. Neusner, J. (1983) Jews in Iran. In The Cambridge History of Iran. Vol. III/2. Cambridge, pp. 909-923. Neusner, J. (1986) Israel’s Politics in Sasanian Iran. Lanham - New York - London. Olsson, T. (1991) The Refutation of Manichaean Doctrines in D#nkard 3.200, pp. 272-283. In Manichaica Selecta. Studies presented to Prof. J. Ries on the occasion of his seventhieth Birthday. Ed. by A. Van Tongerloo - S. Giversen. Lovanii. Perikanian, A. (1983) Iranian Society and Law, pp. 627-680; Political, Social and Administrative Institutions: Taxes and Trade, pp. 681-746. In The Cambridge History of Iran. Vol. 3 (27. The Seleucid, Parthian and Sasanian Periods. Ed. by E. Yarshater. Cambridge. Pigulevskaja, N. (1937) K voprosu o podatnoj reforme Chosraja Anušervana (On the Tax Reform of Xusraw Anušervan). Vestnik Drevnej Istorii, 1, pp. 141153. Pigulevskaja, N. (1963) Les villes de l’état iranien aux époques parthe et sassanide. Paris (Russian edition, Goroda Irana v rannem srednievekov’e, Moskva – Leningrad 1956). Pigulevskaja, N. (1969) Byzanz auf den Wegen nach Indien. Aus der Geschichte des byzantinischen Handels mit dem Orient vom 4. bis 6. Jahrhundert. Aus der Geschichte des byzantinischen Handels mit dem Orient vom 4. bis 6. Jahrhundert. Überarbeitete deutsche Ausgabe. Berliner Byzantinische Arbeiten, Bd. 36. Berlin - Amsterdam (Russian edition, Vizantija na putjach v Indiju, Moskva - Leningrad 1951). Reinaud, J.T. (1863) Relations politiques et commerciales de l’empire romain avec l’Asie orientale. Paris (reprint New York 1972). Sadighi, Gh.H. (1938) Les Mouvements Religieux Iraniens an IIe et IIIe siècle de l’hégire. Paris Shaked, Sh. (1994) Dualism in Transformation. Varieties of Religion in Sasanian Iran. London. Shaki, M. (1970) The Social Doctrine of Mazdak in the Light of Middle Persian Evidence. Ar.Or., 46, pp. 289-306. Shaki, M. (1985) The Cosmogonical and Cosmological Teachings of Mazdak, pp. 527-543. In Papers in Honour of Professor Mary Boyce. Acta Iranica 25. Leuven. Stein, E. (1919) Studien zur Geschichte des byzantinische Reiches. Stuttgart.

Commerce and Conflicts of Religions

401

Stein, E. (1920) Ein Kapitel vom persischen und vom byzantinischen Staate. Byzantinisch-Neugriechiche Jahrbücher, 1, pp. 50-87. Theophylact Simocatta (1997) The Historiae of Theophylact Simocatta. An English Translation with Introduction and Notes by Michael and Mary Whitby. Oxford (first ed. 1986). Theophylactus Simocatta (1834) Theophylacti Simocattae Historiarum Libri octo recognovit Immanuel Bekkerus. Corpus Scriptorum Historiae Byzantinae editio emendatior et copiosior consilio B.G. Niebuhrii C.F. instituta auctoritate Academiae Litterarum Borussicae continuata. Theophylactus Simocatta, Genesius. Bonnae. Theophylactus Simocatta (1972) Theophylacti Simocattae Historiae. Edidit C. De Boor editionem correctiorem curavit explicationibusque recentioribus adornavit P. Wirth. Stutgardiae. Widengren, G. (1957a) Recherche sur le féodalisme iranien. Orientalia Suecana, 5 (1956), pp. 79-182. Widengren, G. (1957b) Quelques rapports entre Juifs et Iraniens à l’époque des Parthes. Vetus Testamentum. Suppl. IV, pp. 197-241. Widengren, G. (1960) Iranisch-semitische Kulturbegegnung in parthischer Zeit. Arbeitsgemeinschaft für Forschung der Landes Nordrhein-Westfalen. Heft 70. Köln und Opladen. Widengren, G. (1961) The Status of the Jews in the Sassanian Empire. Iranica Antiqua, I, pp. 117-162. Widengren, G. (1967) Der Feudalismus im alten Iran. Männerbund — Gefolgswesen — Feudalismus in der iranischen Gesellschaft im Hinblick auf die indogermanischen Verhältnisse. Köln und Opladen. Winter, E. (1987) Handel und Wirtschaft in S"s"nidisch-(Ost-)Römischen Verträgen und Abkommen. Münstersche Beiträge zur Antiken Handelsgeschichte, 6/2, pp. 46-74. Winter, E. - Dignas, B. (2001) Rom und das Perserreich. Berlin. Yarshater, E. (1983) Mazdakism, pp. 991-1024. In The Cambridge History of Iran. Vol. III/2, Cambridge. Zaehner, R.C. (1956) The Teachings of the Magi. A Compendium of Zoroastrian Beliefs. London - New York. Zotemberg, H. (1833) Chronique de Jean, évèque de Nikiou. Paris.

VIII. SPEZIELLE ASPEKTE/SPECIAL ASPECTS

TRADE AND COINAGE ON THE ANCIENT ‘SILK ROUTE’ Richard N. Frye Ignorance is the first requisite of the historian- ignorance which simplifies and clarifies, which selects and omits, with a placid perfection unattainable by the highest art.- Lytton Strachey The early history of Asia has been characterized as a struggle between the steppe (nomads and/or pastoralists) and the sown (settled folk). From the story of Cain and Abel in the Old Testament to the recent turmoil in Afghanistan, this opposition has been a dominant theme of the relation between societies. Granted that different life styles or religions frequently led to strife, invasion or migrations, more important from the earliest of times, I suggest, has been commerce and trade between the two groups. If we look at the written remains from the area between Gansu, in western China, and Mesopotamia, however, they are overwhelmingly religious in nature, as though people everywhere spent most of their days praying and in rituals. One reason for this impression is the restriction of writing to priests, while scribes mainly concentrated their efforts on accounts and records, few of which were preserved. In any case, in trying to reconstruct a secular past we have few sources, and must rely much on the results of archaeology. Always using caution, we may also by analogy rely on later records to illumine the past. Let me begin with a quotation from an eleventh century ‘Mirror for Princes’, the Qabus-nameh of Kai Kavus, a ruler in Tabaristan. In advice to his son, and speaking of merchants, he says: “To benefit the inhabitants of the west they import the wealth of the east, and those of the east the wealth of the west, and by so doing become the instrument of the world’s civilization. None of this could be brought about except by commerce.”(Levi 1952, 156) How far back can we trace this kind of belief? I propose that we can differentiate between states and societies which regarded merchants highly, and those which undervalued or even denigrated them. By merchants or traders I do not mean shopkeepers, but those who engaged in long distance trade, and that probably existed from pre-historic times. Archaeology can help us in this investigation; for example, the discovery of art objects made of lapis-lazuli in early dynastic tombs of Egypt attests to very early long-distance trade. This is not in dispute, but what is sought in these few pages is the effect of government policy in the form of taxes and controls, and of coinage, on the development of trade and commerce over the vast area covered by the ‘Silk Road.’ Let us begin with generalities. It is proposed that long distance trade was primarily in luxury objects, although some other items were always in great demand, such as spices, as a kind of substitute for refrigerators in antiquity. Great rewards had to justify large outlays of capital, not to mention effort and risks by traders. Before the Achaemenid Empire there is little archaeological evidence of organized trade between distant lands, such as Mesopotamia and China. Individuals, or even caravans, may well

406

Richard N. Frye

have gone on long trips, but we have no records. The mountain massifs of the Tien Shan, Kunlun, Pamirs, and Himalayas deterred extensive, active contacts over them. With the coming of the Greco-Bactrians, however, trade increased and the east Asian and west Asian worlds met. Trade became more complex, with questions of forms of financing commercial enterprises, customs and barriers to trade, modes of transport, the roles of states, of groups of merchants, and of intermediaries in trade, all indicate the complexity of trade in ancient periods. In China, from early times, merchants were not well regarded, and many were foreigners, from the lands to the north and west. Nomadic rulers, on the other hand, realized that trade was vital for the prosperity of their subjects, and generally merchants were well regarded and well received in their domains. Not that plunder and conquest were absent from their history, but these were exceptions, since the exchange of goods between pastoralists and settled folk meant prosperity for all. Unfortunately history is the record of wars and conquests, much like newspapers today which highlight tragedies. Parallels between China and the Near East are instructive, since both areas faced threats of invasion by nomads, as well as similar attitudes regarding trade between the steppe and the sown. When dynasts, originally nomadic or pastoralist by origin, ruled in both areas, international trade seems to have flourished, such as under the Achaemenids and Parthians in the Near East, and the Han, Tang and Yüan (Mongol) dynasties in China. In contrast, the early Sasanians and the Ming rulers of China were more concerned with internal affairs and agriculture than with trade, which resulted in taxes, customs and other barriers for long distance merchants. In spite of much destruction, the Muslim Arabs and the Mongols both saw a flowering of trade in their domains. Can we understand earlier history by projecting backward more recent events? Coinage came into being as a concomitant of trade, making internal trade, as well as between lands, simpler. But coinage required a strong state and trust between all involved in commerce, as well as with state officials. Sudden changes in history are usually made by ‘fanatic’ individuals, such as Alexander, Napoleon and Stalin, but long term developments, as the rise and fall of states, at times seem to be the consequences of economic failures. Frankly I am puzzled about the relation between local copper coinage and silver and gold issues. It seems the value of the former was determined by the state, whereas gold and silver was subject to the market, since from time immemorial people distrusted the debasement of those metals in coins of the realm. In the Near East the breaking or even biting of silver and gold coins was intended to determine the purity of the gold or silver in the coins. The reason why Sasanian coins were so widely circulated in the pre-Islamic world of the Near East and Central Asia, was the policy of the government to maintain a high standard of purity in their coinage, a practice not followed by their neighbors. If it is true, on the whole, that governments set the value of local copper coinage, but the market was influential in determining the value of precious metals, then only coins of the latter would travel. Other factors, however, were

Trade and Coinage

407

not absent in determining values. The apparent preference for silver over gold by nomadic peoples has remained an enigma for me. Yet the early abundance of Scythian gold objects from kurgans in South Russia is followed by the dominance of silver on the steppes (Frye 1971, 255-62)! Why? Tacitus (Tac.Germ. 5) remarked that the Germans preferred silver to gold, and the same phenomenon is recorded when the Arab Muslim army captured the Sasanian treasury in Ctesiphon. The Romans and Indians valued gold, and India throughout history has maintained a high value for gold over silver. Political events, or the supply of gold or silver, of course, had an influence on prices or coinage, but the different preferences of people for gold or for silver is striking. This kind of irrational or psychological preference cannot be ignored in reconstruction of the past. Why were some people known as skilled merchants while others were not? In Central Asia the Sogdians and Khwarazmians were the traders par excellence. Their geographic location, and their life in oases, which were not centers of agricultural or craft production, almost ordained them to become middlemen or traders, especially between settled and nomadic peoples. In the Near East, however, similar conditions were less important, but centers of handicraft production also needed middlemen to distribute their wares. It is understandable why the sea faring Greeks occupied the role of traders in the west, while for the east the Armenians were well placed to act as middlemen for products from the lowlands. Over centuries Greeks and Armenians gained a reputation as shrewd traders, while Iranians, as well as people of the ‘Fertile Crescent’, were more bound to the soil. Jews became money changers and bankers, rather than merchants, but this concentration may have occurred in Islamic times, because of that religion's position on lending and interest. Much needs to be done in recovering the economic history of Asia in early times, and the remarks above are intended merely as a catalyst for young scholars.

Bibliography R. Levy, A Mirror for Princes, London 1952. R. N. Frye, Sasanian Silver and History, in: E. Bosworth, ed., Iran and Islam in Memory of the Late Vladimir Minorsky, Edinburgh 1971.

A “NEW” SOURCE FOR LATE ANTIQUE PAGANISM Jaakko Hämeen-Anttila Our sources on Late Antique paganism in rural Northern Iraq are few and far between. A handful of inscriptions in a variety of languages, some notes in Christian hagiographies which are notoriously difficult to date and to evaluate and some problematic accounts in Arabic historical texts are the material with which scholars are wont to work, and the results are meagre enough. Yet there is a rather large corpus which might be of value in studying the intellectual atmosphere of the area in Late Antiquity and Early Islam. This “Nabatean corpus” – which has nothing to do with the Nabateans of Petra1 – has been a bone of contention for almost a century and a half. This is not the place to recount the history of Western scholarship on the issue or to review its results,2 but suffice it to say that we seem to have reason to date this corpus, or at least the main parts of it, to the sixth century A.D. or soon thereafter. The original texts were written in some sort of Aramaic, called “Ancient Syriac” in the text itself, and they were translated into Arabic by Ibn Wa¥shiyya (d. 318 A.H. = 930 A.D.).3 The purpose of this paper is not to prove the relative authenticity of the corpus, which has been done by me, at least to my own satisfaction, in another paper,4 but to give a short description of the varied contents of the main text of the corpus, the Nabatean Agriculture (al-Fil ¥a an-Nabaðiyya, abbreviated in the following as Nab. Agr.).5 This work is a large compendium of agronomical literature, in the modern edition taking up almost 1500 pages. The major part of the text is of botanical and agronomical interest only, but the pseudonymous authors of the original,6 as well as the Arabic translator, Ibn Wa¥shiyya, added to this much material that is valuable for the study of Late 1 2 3

4 5 6

Nabað in Arabic refers to the non-Arabic rural population of the Near East, and especially Iraq, who spoke different Aramaic dialects. The question of the authenticity of this corpus has been studied in Hämeen-Anttila (2002/2003) and the history of earlier scholarship in Hämeen-Anttila (2003 b) It might be mentioned in passing that the arguments adduced by Toufic Fahd in favour of this relative authenticity of the corpus (see the articles of Fahd, collected in Fahd 1998), are, to my mind, far from conclusive and often erratic. Nevertheless, the main text of the corpus does date from Late Antiquity as proven, I hope, by my own study, Hämeen-Anttila forthcoming a. The translator's preface where it is told by the translator, Ibn Wa¥shiyya, how the text was translated into Arabic, has been translated in Hämeen-Anttila 2002b. By “relative authenticity,” I mean that the text was indeed translated from some Syriac or Aramaic dialect into Arabic by Ibn Wa¥shiyya. The text itself claims to be considerably older, and in this sense, of course, it is not authentic. Hämeen-Anttila 2002/2003. Among the more important texts of the Nabatean corpus are Kit b as-Sum!m and Kit b Asr r al-falak. The original is told in the Preface to have been a multilayered compilation, the main authors of the layers being ºaghr th, Yanb!sh"dh and Q!th"m", the final editor of the “Ancient Syriac” original. None of these names can be identified and are clearly “coded” (see HämeenAnttila 2002/2003).

Jaakko Hämeen-Anttila

409

Antique paganism, semipopular philosophy and ancient folklore, to mention the most important fields of interest of the authors and the translator. The themes presented below have partly been studied by me in extenso in other articles, or will be so in future ones.7 The magico-religious themes are very prominent throughout the work. The deities are astral and the names used for them are the standard Arabic names for the “stars” (the Sun, the Moon, and the five visible planets). Other deities mentioned by name in the text are Nasr and Tamm!z; the former is mentioned only briefly (Nab. Agr., p. 296) in the description of the ritual lamentation of the latter (Nab. Agr., pp. 296-298),8 which is the most accurate description of the ritual known from Arabic sources and also the last detailed testimony for the Weiterleben of the ritual lamentation. Tamm!z and Nasr are, however, not typical of the religious worldview of the text. The other deities are astral, and the text mentions several prayers to be addressed to these deities, e.g., a lengthy one to Saturn, given in the Preface of ºaghr th (Nab. Agr., pp. 10-11) which opens the “Ancient Syriac” original and is preceded only by the translator's Preface. The passage shows a clear tendency towards monotheism:9 The Preface of ºaghr th Glorification and exalting, prayer (½al t) and service («ib da) be from us, whilst we are standing upright on our feet, to our god, the living (al-¥ayy), the eternal (al-qad"m), who has always been and will always be (lam yazal wa-l yaz l), the only possessor of lordship over all things, the great god (al-il h al-kab"r). There is no god but god (All h) alone and there is no companion to him,10 the great, the everlasting in his heaven, whose power is effective. All might, majesty and greatness belong solely to him. He comprises everything, he has power over 7

I am preparing a translation of the non-agronomical passages of the text, which will appear in a few years. 8 The passage has been translated in Hämeen-Anttila 2002a, together with other relevant material from both the Nabatean corpus and other Arabic sources. 9 The beginning of the passage would seem to be addressing the Sun but later it becomes obvious that the god referred to is Saturn (Zu¥al). It seems to me that the prayer uses the expressions of solar monotheism to soothe another god, Saturn. Cf. also the passage translated below, footnote 20. A syncretistic system such as that exhibited by the Nab. Agr., should not be expected to express itself systematically with clearcut slots for each god in the pantheon. On the contrary, these systems tend towards fluidity and flexibility, so that the role of a god in a certain context very much depends on the focus of the passage in question. Cf. also Fauth 1995, 31-32. 10 This Islamic formula is absent from several manuscripts. Note that the use of Islamic vocabulary in the Arabic text does not, at least not necessarily, imply an Islamic origin. In translating the text into Arabic, Ibn Wa¥shiyya did not have any standardized pagan religious vocabulary at his disposal but had to use Islamic vocabulary which he may, furthermore, have used on purpose, to make the text more palatable for the mainly Islamic readership.

410

“New” Source for Late Antique Paganism

everything and to him belongs everything, both visible and invisible. To him belongs everything on earth and on high.11 He furnished 12 the earth (with life) from his life and made it alive, and it remains in existence (baqiyat) through his continued existence (bi-baq 'ihi). He furnished water with his might and his power and made it exist (abq ), so that it persists (d ma) through his persistence. He made firm the earth and it will remain so for all eternity, and he made water run its course (ajr ) like he runs his course, so that the water runs alive like his life,13 cold because of the greatness of his power (sulð n) over coldness. The earth is heavy (thaqulat) in addition to being in existence (baq »), because of the heaviness of his movement. If he wished it, he could make everything into something other than what it is. But he is wise and acts upon his wise potency (quwwa)14 and he is knowledgeable and his knowledge permeates everything (alkull). Blessed art thou, O lord of the heaven and everything else. Your noble and beautiful names (asm »uka l-kar"matu l-¥usn )15 be hallowed. We serve you and pray (to you) because of your eternity (qidam) and nobility,16 and we ask you by your names and your eternity and your nobility that you keep our reason firmly on its course, as long as we are alive, and that you treat gently with our bodies, after life has left them, in (the state of) corruption and that you drive away worms from our flesh (after our death) because you are an eternal and merciful lord. Yet you cannot show your mercy because of your sternness because you can also be a remorseless tyrant. Your arm is long and not slow in making your deeds effective. You are the lord: when you give someone something, there is no one who could detain it and there is no one who could give it (against your will). You are the lord and the only possessor of lordship, the sole possessor of power (sulðãn), the lord of the planets and revolving stars (rabb al-kaw kib wa»n-nuj!m ad-d »ira) which move their circular movement (as-s »ira f" daw »ir). They flee the sound of your movement and they are afraid because of you. 11 Variant: on the low earths and in what the highest sphere surrounds and what is between them and below the soil. 12 In one manuscript a variant passage begins here which emphasizes that god brought into being all existence through his various qualities, including his knowledge and his mercy (e.g., “He extended the existence from the overflow of His existence and made the spheres circulate through the greatness of his power (…)”). 13 The mention of living waters should not mislead the reader. Although there is a certain resemblance between Mandaean religion and the religious beliefs mentioned in the Nab. Agr., there are also obvious differences. The Nabateans were neither Mandaeans nor £arr"nian º"bians, although all three religious groups obviously derived many of their religious ideas from the same or similar sources. The religious map of the Near East contained these three pagan groups which prospered well into Islamic times and, in the case of Mandaeans, continue even today. 14 The text reads: f «ilun bi-QWTH »L-£KMH, which Fahd emends in his edition to f «ilun biquwwatihi *l-¥ak"ma (»L-£KMH). One might as well emend this to: bi-QWT[[H]] »L£KMH and read: bi-quwwati l-¥ikma “with the power of Wisdom.” Still, the emendation of Fahd is possible and may even be preferable. 15 The expression al-asm » al-¥usn is strongly Qur»"nic (Qur. 7:180). 16 Or: generosity (karam).

Jaakko Hämeen-Anttila

411

[p. 11] We ask you to keep us safe from your anger and to hold your assaultive power (saðwa) from us and to have mercy on us and to preserve us from your great wrath (shirra). O god (All humma), we hold your assaults from us by your beautiful names (bi-asm »ika l-¥usn ); you have mercy on whosoever uses them as a means to your mercy. So have mercy on us, have mercy on us by your might, by your high, lofty and majestic name, O you who are high, lofty and majestic. It is upon you, O noble one (al-kar"m «alayka). By my life, we ask you to have mercy on us. Amen. Beware (pl.) of the evil (sharr) of this god when he is angered or is located to the west of the Sun or is veiled by its rays or is in the middle of its retrogradation (ruj!« ). Pray then to him with this prayer which we have just prayed. While you are praying, offer to his idol (½anam) a burnt offering (dakhkhin!), consisting of old hides, grease, strips of leather (qud!d) and dead bats (al-khushsh f17 almawt ). Burn (a¥riq!) for him fourteen dead bats and an equal amount of rats. Then take their ashes and prostrate yourselves (fa-sjud!) on them in front18 of his idol. Prostrate yourselves to him on a black stone with black sand and seek refuge with him from his evil, because, O my brethren and beloved ones, he is the cause (sabab) of the perishing of all that perishes, the cause of the decay of all that decays, the cause of the perdition of all that is destroyed, (the cause of) the grief of all grieved ones and the weeping of all weeping ones. He is the lord of19 evil and sin and filth and dirt and poverty. This is what he does to men (abn »al-bashar) when he is angered, but when he is content he gives them the remaining existence (baq »), long life, fame after their death, acceptance in the eyes of those who look at them and sweetness of speech.20 His anger is (to be afraid in situations) like I just described to you (sg.), 17 According to Lane, s.v., khushsh f should be singular, but Ibn Wa¥shiyya uses it as a collective noun with the nomen unitatis khushsh fa. 18 The text reads: bayna ½anamihi. This most probably is a mistake for bayna ½anamihi. 19 The text reads: wa-h ribu sharrin wa»l-fisq etc., which does not quite make sense. The translation is based on an emended reading: wa-*huwa rabb [ash]-sharr wa»l-fisq. 20 Two of the manuscripts give here an additional passage of a strong monotheistic tendency, where Zu¥al is seen as an instrument of the Highest God to whom he is totally subservient. The passage reads: Then he said: Beware opposing, disobeying or angering this (read h dh for hun ) god because nothing can stand against his anger. Pray («alaykum bi»½-½al ti wa»d-du« ) to this great god who is the lord of lords, and stand humbly in front of him, seek refuge in him from him and declare that all might and power belong to him for there is no might nor power except his (fa-innahu l ¥awla wa-l quwwata ill bihi). Prostrate yourselves to him in his temples which have been erected for his service (f" hayãkilihi l-man½!bati li-«ib datihi) and offer to him pure offerings, pure of all filth and free from all impurity (wa-qarrib! lahu min al-qarãb"ni z-zakiyyati ð-ðãhira min al-adnãsi albariyyati min al-akd r). With these you will receive his blessing (baraka) and you may wish for his mercy. Beware Zu¥al because he is one of his servants and his subjects and his creatures (min marb!b tihi wa-musakhkhar tihi wa-makhl!q tihi). His station is known and his cycles (adw ruhu) are preserved (ma¥f!þa). Seek refuge in this god from his evil and his ominousness (shu»m). His actions among men are done with the permission of his Lord.

412

“New” Source for Late Antique Paganism

but his contentment is (to be expected) when he is to the east of the Sun or in the middle of his station (istiq ma) or in places which agree with his actions or in the full speed of his travel (f" sur«ati sayrihi) or in ascendance in the cycle of his ascendance (f" ½u«!dihi f" d irati ½u«!dihi). — Ab! Bakr ibn Wa¥shiyya says: This means: in the sphere of his zenith (f" falaki awjihi).21 If you pray to him when he is angered, repeat your prayer and the sacrifice (qurb n) when he is (again) content and remind him of the earlier prayer and repeat its mention to him, so that you might come off well from his evil. Amen. Know that he is the one who gives prosperity to the soil and it is he who gives the growth or its opposite to the plants. He revealed (aw¥ ) to the Moon22 what I have put down in this book of mine and the Moon revealed it to his (own) idol, and I was taught it by the idol of the Moon, just like I now teach it to you (pl.). Preserve this because it is your life on which you rely and (on it depends) the growth of your fields and your fruits which are the basic preservation (m dda) of your life and your hope, during your life, of comfort, affluence, safety [p. 12] and general health (al-« fiya al-kulliyya). Know that I have prayed to this god, Zu¥al, and in my prayer I have asked his idol to benefit with this book of mine everyone who reads it. The idol revealed (aw¥ ) to me: “Your prayer (du« ») has been heard and your offering has been accepted.” I did this because I felt sorry for the sons of my kind (abn » jins") for the anguish of their scant living and the abundance of their misery. Seek refuge from this (misery) with the Sun by long and repeated litanies (ta«awwudh) so that he may perhaps benefit you because he is beneficial to you, and seek refuge with this god [Zu¥al] from his evil with long litanies (ta«awwudh) because he will benefit you against scant living and the sorrow caused by that. The text of the Nab. Agr. consists of passages of different intellectual levels, ranging from popular religion of the local farmers to more highflying philosophical speculation derived from Hellenistic ideas. Accordingly, the astral speculation is of two types. Aside from the more magically flavoured astral religion, which is exemplified by the prayers, intended to influence the gods, there are passages based on astral fatalism: the stars and their mutual relations shed almost mechanistically their influence on the earth. Variety is also caused by monotheistic tendencies within the text, where sometimes other stars are seen more or less as various potencies or intermediaries of one Supreme God. Whether this is a local development of “pagan monotheism”23 When he is angered because his Lord is angered, then (upon men will come) weeping and wailing (? nath"j), sorrow and lamenting, poverty and humiliation, anguish and impurity, dirt and blackness and stench. But when he is pleased because his Lord is pleased, then (upon men will come) length of life (read al-a«m r for the text's al-a«m l) and elevation of name after death, fame and acceptance in the eyes of those who look at them and eloquence of speech. 21 The additional notes by Ibn Wa¥shiyya are usually clearly marked, as here. 22 Variant: to me. 23 For the tendency towards often solar monotheism in Late Antiquity, see, e.g., Teixidor 1977, Tubach 1986, Fauth 1995, and Athanassiadi–Frede 1999.

Jaakko Hämeen-Anttila

413

or has been caused by Jewish or Christian influence is difficult to say, but a certain “Biblical” influence is obvious in the text, especially in the use of Biblical names such as Adam (Ãdamã), Seth (¨sh thã), Noah (N!¥ã) and Abraham (Ibrãh m), who obviously owe their names and some of their characteristics to Biblical tradition, although they are far removed from their Biblical namesakes.24 Likewise, the text discusses in several places the question of prophecy and revelation, including incubation (e.g., Nab. Agr., pp. 1238-1246). It remains to be studied to what extent these are indebted to Jewish or Christian influences, and to what extent they may reveal vestiges of a local pagan tradition.25 In addition to this “higher” level of religion, we have a wide selection of magical operations, charms and talismans described in the text.26 Some of these, like many of the charms against hailstorm (e.g., Nab. Agr., 1062-1065), go back to Hellenistic sources,27 some obviously are purely speculative with little basis in local habits, but the majority most probably describe existing habits in the countryside and thus contain valuable additions to our knowledge of the magicoreligious beliefs of the area and, especially, the peasants, who otherwise are not particularly visible in the preserved literature. An interesting case of strong affinity with Late Antiquity as known from other sources28 is the strong position of itinerant magicians (sa¥ara), whose black magic is feared, and though they clearly dislike them, the authors do not dare to oppose them openly (e.g., Nab. Agr., 147, and elsewhere). The magical easily changes into philosophical speculation. An especially interesting case of this is the creation of an artificial man,29 which may have been influenced by, or have influenced, the Jewish tradition which ultimately led to the Golem legend, so widely spread in Jewish folklore. In the Nab. Agr., the creation of an artificial man is placed within the larger context of spontaneous generation, well known from Greek sources. The Hellenistic influence is at its most obvious at the philosophical level of the book. The philosophical ideas of the authors are dominated by the Elementenlehre and the theory of humours, as interpreted by them, and interwoven with astral speculation. This layer consists of highly individual and sometimes aberrant philosophy, which does not reveal a great philosophical mind, but might be of interest concerning the reception of Hellenistic philosophy in semi-learned circles, perhaps among the minor landed aristocracy. Among the various philosophical 24 25

26 27 28 29

For Adam, see the mythical story of Adam and Wheat (Nab. Agr., 448-453), translated in Hämeen-Anttila forthcoming a. One should note both the Manichaean (as well as the Elchasaite) and the Islamic parallels, which show how widely the idea of revelation was spread roughly at the time of the compilation of this text. It should also be noted that the Islamic revelation is not simply a branch of the Biblical tradition but most obviously was also influenced by a local, Arabian tradition. See Hämeen-Anttila 2000. These are very briefly described in Hämeen-Anttila 1999. Rodgers 1980. Cf., e.g., Trombley 1993-1994, II, 41 (“…such beliefs became a source of great anxiety”), and passim, see the index, s.v. sorcerers and sorcery The passages have been translated and studied in Hämeen-Anttila 2003a.

414

“New” Source for Late Antique Paganism

asides there is a long discussion on the soul (Nab. Agr., 918-932), which is worth comparing to Classical and Islamic sources, although it remains philosophically speaking inferior to the general level of philosophy at the time. Yet, it seems to me that the diffusion of philosophical ideas outside the spheres of professional philosophers is an understudied field and would deserve more attention than has hitherto been given to it. If we continue to review some main aspects of the book from the sacral to the secular, we next come to various rituals and regulations. There is an interesting description of New Year's Eve rituals (Nab. Agr., 538-541) which, broadly speaking, coincides with what we know of the £arrãnian pagans down to the Islamic times, albeit differing in details, so that the description cannot have been taken from any Arabic source describing the £arrãnians but must be independent of that tradition.30 Likewise, there are descriptions of idols and their worshiping, communal prayers, feasts, fasts, temples and the services therein, the use of cultic music, incubation and dream oracles, and various other themes. Most of these passages are relatively short and sometimes difficult to set into any context, but in general they offer much material for study. The veneration of sacred trees receives some attention, and it seems that the word “idol”(½anam) may often, in fact, refer to sacred trees, which act as mediators of divine revelation. Cultic and agricultural calendars, which we also know from Syriac tradition, are discussed in the book (e.g., Nab. Agr., 207-209). The authors of the book seem to have been specifically interested in burial customs and the problem of corruption of bodies.31 They discuss not only “Nabatean” burial customs but also review those of other peoples of the time. Both mummification and burial in salt to attain mummification receive some attention, as does cremation and burials in jars or sarcophagi. Food regulations,32 including some resembling the Pythagorean ones, are also found in the text, as well as information on regular peasant diet and even substitute foods which may be eaten during times of famine. The regulations, however, do not contain any prohibition against eating pork or drinking wine, thus showing little affinity with Islamic regulations. Another group of themes worth mentioning are those related to folklore and literature. Travellers' tales, stories about jinn, literary debates,33 and many other stories are found in the text. A specific mention might be made of the story (Nab. Agr., 1254-1256) of a courtier who is ordered by the king to kill one of the royal wives but who spares her life and later returns her to the king and proves that he himself is impotent. This “Snow White episode”34 is known from several Islamic sources, often told of the Sãsãnid king Ardash r and his courtier, and the story 30 This has been studied in Hämeen-Anttila 2002a, together with the Tamm!z ritual. 31 I have studied this topic in a Finnish article (Hämeen-Anttila forthcoming b), later to be published in an enlarged English version. 32 Studied in Hämeen-Anttila forthcoming a. 33 It has usually been argued that no Syriac debates were directly translated into Arabic, and the examples of the Nab. Agr. seem to be the only known exception to this. 34 Aarne-Thompson K. 512.2.

Jaakko Hämeen-Anttila

415

usually contains a reference to selfcastration by the courtier before receiving the custody of the woman to put an end to any possible gossiping concerning the wife's fidelity during the time of her absence.35 The theme of selfcastration is already known from Lucian's De Syria Dea (the story of Kombabos, 19-27), where it is told as an aetiological myth for the selfcastration of the Galloi. The version of Lucian, though, lacks the “Snow White episode;” here Kombabos has to castrate himself after the king has put his wife in his charge during the building of a new temple, and the courtier castrates himself, knowing that the amorous lady will bring him under suspicion if he will not be able to prove his chastity.36 This brief review by no means exhausts all the material of the work, but it has, I hope, demonstrated the importance and interest of this little-known text as well as the other texts in the Nabatean corpus. The bulky Arabic text itself is not easily available to non-Arabists, and my aim is to produce a selected and annotated translation, containing the non-agronomical material of the text. The analysis of this text as well as the whole Nabatean corpus is complicated by the pseudonymity of the authors, the various layers of the text and the process of editing and translating through which it has gone before reaching the final stage, the Arabic text from 930. This complexity has perhaps been one of the main reasons why the text has not received the attention it deserves, as well as 35 Cf. Ritter 1978, 511, with reference to að-Ðabar (see Bosworth 1999, 24-26, and Nöldeke 1879, 26-30); ps.-al-Majr ð , Gh yat al-¥ak"m, 389-390 (and its translation, Ritter–Plessner 1962, 397-399: a considerable proportion of the Ghãyat al-¥ak"m is, like this passage, taken from the Nab. Agr.); al-A¥dab, Dhayl Thamarãt al-awrãq II, 257-260 (here King Ardavan has been corrupted into malik Ba¥r al-Urdunn, the King of Jordan), and «Aððãr»s Ilãh"-nãme, vv. 59916049 (£ikãyat-i Ardash"r, 20/4) (translated in Granata 1990, 368-371). To these one may add Firdaus , Shãhnãma, 479-481 (translated in Levy 1985, 271-272), and ad-D nawar »s alAkhbãr að-ðiw l, 85-86. Late Islamic variants and parallels without reference to Ardash r are relatively easy to find, see, e.g., «Aðð"r's Manðiq að-ðayr, vv. 4293-4455 (translated in Avery 1998), and Chauvin 1901, 208. In Islamic sources the story is usually told of Ardash r-I P"pak"n and the daughter of King Ardavan. The story is found in the Pahlavi legendary history K rn mag-i Ardash"r (see Nöldeke 1878, 57-63), but without the motif of selfcastration. It may be relevant for the dating of the Nab. Agr. to draw attention to the fact that in Islamic literature the motif of selfcastration is prominent, whereas in the older Pahlavi story, as in the Nab. Agr., this is missing. Thus, the pre-Islamic Kãrnãmag and the Nab. Agr. seem to belong to one branch, the later Islamic versions to another. An early, related version of this tale is found in Ahiqar, see, e.g., Lindenberger 1985, 496. 497, which predates all other versions and provides an indigenous starting point for the development of the motif, although this version naturally lacks any references to potential jealousy and, consequently, to selfcastration or impotence. Yet it is worth noting that the slave killed in Ahiqar's stead is a eunuch. 36 Note that the pre-Islamic date of the story of Ardash r does not necessarily indicate that the story in the Nab. Agr. was taken from Persia. On the contrary, the versions of Ahiqar and Lucian prove that similar tales were circulating in Syria even earlier, and it may thus be that the story of Ardash r itself has been influenced by some Syro-Mesopotamian tradition. Thus the version of the Nab. Agr. may well be indigenious. The name Kombabos in Lucian is also higly interesting and its possible relation to either Humbaba, the monstruous guardian of the Forest of Cedars in the Epic of Gilgamesh, or the goddess Cybele has been a matter of controversy.

416

“New” Source for Late Antique Paganism

perhaps the fact that it has fallen between two fields of study: the text may mainly interest scholars in the field of Late Antique studies, but it has been available only in the Arabic original, which did not much interest the Arabists of the 20th century, with a few exceptions. I hope that the English translation may provide an impetus for future studies on the text by non-Arabists.

Jaakko Hämeen-Anttila

417

Bibliography al-A¥dab, Mu¥ammad ibn Ibrãh m (s.a.), [Second] Dhayl Thamarãt al-awrãq. Printed in the margins of: al-Ibsh h , al-Mustaðraf f" kull fann mustaþraf. I-II. Bayr!t: Dãr al-Fikr s.a. Athanassiadi, Polymnia – Michael Frede (eds.) (1999), Pagan Monotheism in Late Antiquity. Oxford: Clarendon. «Aððãr, Ilãh"nãme. Ed. Fu»ãd R!¥ãn . 5th printing. Tihrãn: Intishãrãt-i Zawwãr 1376 A.H.Sh. «Aððãr, Manðiq að-ðayr. Ed. Sayyid ºãdiq Gauhar . Ðihrãn: Shirkat-i Intishãrãt-i «ilm u-farhang . 6th edition 1368 A.H.Sh. Avery, Peter (tr.) (1998), Far"du»d-D"n «Aððãr, The Speech of the Birds. Cambridge: The Islamic Texts Society. Bosworth, C.E. (tr.) (1999), The History of al-Ðabar". V: The Sãsãnids, the Byzantines, the Lakhmids and Yemen. Bibliotheca Persica. State University of New York Press. Chauvin, V. (1901), Bibliographie des ouvrages arabes relatifs aux Arabes. V: Les Mille et une nuits (deuxième partie). Liège–Leipzig: Vaillant Carmanne– Harrassowitz. ad-D nawar , al-Akhbãr að-ðiwãl. Ed. «I½"m Mu¥ammad al-£"jj «Al . Bayr!t: D"r al-kutub al-«ilmiyya 1421/2001. Fahd, Toufic (1998), = vol. III of Ibn Wa¥shiyya, Kit b al-Fil ¥a. Fauth, Wolfgang (1995), Helios Megistos. Zur synkretischen Theologie der Spätantike. Religions in the Graeco-Roman World 125. Leiden–New York– Köln: Brill. Firdaus , Sh hn me. Ed. N"h d Farsh"d Mihr. 2nd printing. Tihr"n: Nashr-i Mu¥ammad 1378 A.H.Sh. Granata, Maria Teresa (tr.) (1990), Far"d al-D"n »Aðð r, Il poema celeste. BUR poesia. Milano: Rizzoli. Hämeen-Anttila, Jaakko (1999), Ibn Wa¥shiyya and magic. Anaquel de Estudios Árabes 10: 39-48. Hämeen-Anttila, Jaakko (2000), Arabian prophecy. in: Martti Nissinen (ed.), Prophecy in its Ancient Near Eastern Context. Mesopotamian, Biblical, and Arabian Perspectives. SBL Symposium Series. Atlanta: SBL, pp. 115-146. Hämeen-Anttila, Jaakko (2002a), Continuity of pagan religious traditions in tenth-century Iraq. in: A. Panaino-G- Pettinato (eds.), Melammu Symposia III. Milano, pp. 89-108. Hämeen-Anttila, Jaakko (2002b), Mesopotamian National Identity in Early Arabic Sources. Wiener Zeitschrift für die Kunde des Morgenlandes 92: 5379. Hämeen-Anttila, Jaakko (2002/2003), The Nabatean Agriculture: Authenticity, Textual History and Analysis. Zeitschrift für Geschichte der ArabischIslamischen Wissenschaften 15: 249-280

418

“New” Source for Late Antique Paganism

Hämeen-Anttila, Jaakko (2003a), Artificial Man and Spontaneous Generation in Ibn Wa¥shiyya's al-Fil ¥a an-Nabaðiyya. Zeitschrift der Deutschen Morgenländischen Gesellschaft 153: 37-49. Hämeen-Anttila, Jaakko (2003b), A Mesopotamian Corpus - Between Enthusiasm and Rebuttal. Remota relata. Essays on the History of Oriental Studies in Honour of Harry Halén. Studia Orientalia 97:41-48. Hämeen-Anttila, Jaakko (forthcoming a), Ibn Wa¥shiyya on substitute foods. in: Thomas Bauer – Ulrike Stehli-Wehrbeck (eds.), Fs. Grotzfeld. Hämeen-Anttila, Jaakko (forthcoming b), Varhaisesta arabialaisesta hautauksesta [On Early Arabic Burials]. in: Julia Burman – Matti Myllykoski (eds.), [title to be announced]. Helsinki: Suomalaisen kirjallisuuden seura. Ibn Wa¥shiyya, al-Fil ¥a an-Nabaðiyya = Toufic Fahd (éd.), L'agriculture nabatéenne. Traduction en arabe attribuée à Ab! Bakr A¥mad b. «Al" alKasd n" connu sous le nom d'IBN WAH´IYYA (IV/Xe siècle). I-III. Damas: Institut Français de Damas 1993-1998. Lane = E.W. Lane, Arabic–English Lexicon. I-VIII. (London 1863-1893), repr. Cambridge: The Islamic Texts Society 1984. Levy, Reuben (tr.) (1985), The Epic of the Kings. Shah-Nama the national epic of Persia. Revised edition by Amin Banani. Persian Heritage Series 2. London: Routledge & Kegan Paul. Lindenberger, J.M. (1985), Ahiqar. in: James H. Charlesworth (ed.), The Old Testament Pseudepigrapha. I-II. New York: Doubleday. II: 479-507. Lucian, De Syria Dea = A.M. Harmon, Lucian with an English translation. V: 337-411. The Loeb Classical Library. Cambridge, Massachusetts: Harvard University Press [and] London: William Heinemann 1961. (pseudo)-al-Majr ð , Gh yat al-¥ak"m = Pseudo-Ma¢r ð : Das Ziel des Weisens. Hrsg. Hellmut Ritter. Studien der Bibliothek Warburg XII. Leipzig–Berlin: Teubner 1933. Nöldeke, Theodor (1878), Geschichte des Artaqchµ"r i Papakan. Bezzenbergers Beiträge zur Kunde der Indogermanischen Sprachen. (Göttingen). IV: 22-69. Nöldeke, Theodor (1879), Geschichte der Perser und Araber zur Zeit der Sasaniden. (Leyden: Brill), reprint: Leiden: Brill 1973. Ritter, Hellmut (1978), Das Meer der Seele. Mensch, Welt und Gott in den Geschichten des Far"dudd"n «Aðð r. Nachdruck mit Zusätzen und Verbesserungen. Leiden: Brill. Ritter, Hellmut —Martin Plessner (1962), “Picatrix” Das Ziel des Weisens von Pseudo-Ma¢r"ð". Studies of the Warburg Institute 27. London: The Warburg Institute—University of London. Rodgers, R.H. (1980), Hail, frost, and pests in the vineyard: Anatolius of Berytus as a source for the Nabatean Agriculture. Journal of the American Oriental Society 100: 1-11. Teixidor, Javier (1977), The Pagan God: Popular Belief in the Greco-Roman Near East. Princeton: Princeton University Press.

Jaakko Hämeen-Anttila

419

Trombley, Frank R. (1993-1994), Hellenic Religion and Christianization c. 370529. I-II. Religions in the Graeco-Roman World 115. Leiden–New York– Köln: Brill. Tubach, Jürgen (1986), Im Schatten des Sonnengottes. Der Sonnenkult in Edessa, £arr n und £aðr am Vorabend der christlichen Mission. Wiesbaden: Harrassowitz.

TRACING THE BIBLICAL ACCOUNTING REGISTER: TERMINOLOGY AND THE SIGNIFICATION OF QUANTITY Baruch A. Levine No economy can grow in scope and complexity unless adequate accounting methods are developed to record its activity, and to communicate accurate information about the extent of its wealth. The Economist of April 26, 2003 contains a special report entitled “The future of accounts” (pp. 61-63), which discusses “the crisis in accounting” in the United States, and what is being proposed to correct for the loss of faith in current procedures. Alongside those who merely seek to fix what is wrong in the current system are others who propose more pervasive change: Looking further into the future, however, some see the crisis in accounting as an opportunity to change the shape and content of accounts more fundamentally (page 61; italics mine). The report goes on to say that present-day economies, on a global scale, have become too complex for the existing accounting systems, which seem unable to record with clarity and accuracy such factors as revenue recognition, market value, the reliability of estimates, and the like. When this happens, new forms and methods must be put in place so as to manage further economic development. The generative role of written accounts in antiquity was succinctly analyzed by C.C. Lamberg-Karlovsky (1999), in a study of some of the earliest Mesopotamian household economies, showing how the utilization of accounts contributed to urban growth, both economic and political. Long before the invention of writing, as a matter of fact, the use of figurative seals had made extended communication and recording possible. Over the millennia, the great economies of the ancient Near East, those of Egypt, Syria and Mesopotamia, produced myriads of administrative records and fiscal accounts, and even the smaller societies of the West-Semitic sphere, operative during the Late Bronze and Iron Age, left financial records that are highly informative. In a broader sense, information about ancient economies can be retrieved across generic lines, not only from records specifically fashioned for this purpose. One can glean such information from epics and chronicles, treaties and law codes, and rituals and narratives. To do so makes it necessary, however, to perfect proper methods for evaluating the realism of such sources, so as to correct for ideological Tendenz and imaginative depiction. Thus it is that we can approach biblical texts, as an example, with economic questions in mind, if we have reliable methods to distinguish between history and tradition. An excellent paradigm is the study of Ezekiel’s oracles against Tyre and Sidon (Ezekiel 26-28) by Igor Diakonoff (1992), in which that scholar verifies, in historical terms, that the Phoenician citystates traded in the very commodities enumerated in the biblical prophecies during the contemporary period. In the same vein, my former student, Martin Corral (2002), inspired in large measure by Diakonoff’s example, accomplished an informative doctoral dissertation, in which he elucidates the economic

Baruch A. Levine

421

background of these same prophecies of Ezekiel. For my own part, I have investigated the economic aspects of land tenure and urbanism in biblical Israel, endeavoring to evaluate the realism of the biblical references (Levine 1996, 1999). In the present study it is my purpose to explore biblical accounting terminology, as well as the systems of quantity signification employed in biblical reports, as we have them. My interest in ancient accounting stems from the comparative study of biblical cult and ritual, directing my attention to Near Eastern temple records and economic texts, which often tabulate allocations for cultic use. This interest was first expressed in a study of the priestly Tabernacle texts of the Pentateuch (Levine 1965), and has since informed much of my work. It should be borne in mind that there are virtually no original records in the Hebrew Bible; all have been adapted in some degree to narrative style, making it necessary to visualize what their original form might have been. The challenge is to establish a correlation between biblical terminology and formats, and those employed in epigraphic texts discovered in archeological excavations. Because the extent of Hebrew epigraphy is so limited, and because inscriptional materials in the most proximate Canaanite languages of the biblical period are also scarce, it becomes necessary to reach out to comparative sources, principally to Aramaic and Phoenician-Punic epigraphy, but also to a wider range of western sources in several languages and scripts. My ultimate objective is to identify the “register” of adapted biblical accounting texts, and their constituent formulas. In a recent study of Egyptian writing systems, my colleague, Ogden Goelet, defined “register” as follows: Register is a term used to describe the variety of language employed according to such social factors as class and context. For example, the way in which people speak and write in academic discourse, in religious contexts, or in legal documents are all considerably different from each other and different from how those same individuals might speak in their daily lives. Each situation represents a different register (Goelet 2003: 4). In earlier studies, I have been able to trace some biblical cultic terminology back to the royal administration. Thus, the term !"# “regular, daily offering” (Exod 29: 42) essentially means “daily ration, allocation” (2 Kings 25: 29), specifically, what royal captives of the Babylonian king received. The cult of the First Temple of Jerusalem was sponsored by the royal establishment, and the same was true in northern Israel, and the Second temple served as the central administrative agency in the post-exilic period, under Persian imperial rule. It should be no surprise, therefore, coming from the other direction, to find that most biblical accounting terms, and numeration sequences are concentrated in courtly and priestly texts. This is their “register.” Selected Biblical Accounting Terms

422

Biblical Accounting Register

Note: The list of terms to follow will not include numbers and fractions, or weights and measures, both of which are of importance in comprehending biblical accounting procedures. The reader is referred to two recent, and informative entries in the Anchor Bible Dictionary (1992): “Numbers and Counting “ by Joran Friberg ( 4: 1139-1146), and “Weights and Measures” by Marvin A Powell (6: 897-908). These articles provide extensive bibliography, and are comparative in scope. 1) $%& (= ’ ¥!z) “(amount/unit) withheld” (Num 31:30, 47; 1 Chron 24:6). The Hebrew verb ’-¥-z means “to hold, take hold” so that the Qal passive participle, ’'¥!z would mean “held, taken,” hence, in context: “held apart, withheld.” 1 Chron 24:6 yields a clear meaning, even though the Massoretic text probably reflects a scribal error. This reference comes within a register of priestly “divisions,” and the listing of their respective assignments. Thus, we read: (&-#!( *"#!&) $%& %&, *$+)&) $%& %& “One patrilineal family ‘held’ for Eleazar, and one ‘held’ for Ithamar.” (The error was undoubtedly triggered by the similarity of the word for “one” and the verb “to hold.” The Aramaic cognate of Hebrew ’-¥-z is written with a daleth, as ’-¥-d, in later phases of that language). The sense of $%& in the passage from Chronicles is best defined as: “reserved, held apart; selected.” This meaning is attested for the comparable Palmyrene Aramaic Pe´il form: ’¥yd (PAT, Glossary, 336). As an example:’[t]r ’¥yd “a place reserved”- for a certain person (PAT 51, s.v. BS III, 68:1). As for Numbers 31, it is a war narrative belonging to the priestly stratum of Pentateuchal literature. Within this chapter, verses 25-54 ordain the division of the spoils of war, a large portion of which were to be donated in support of the cult. The formulation of the text is discrete: “And from the half-share ( #!-%"", ) assigned to the Israelite people you shall appropriate one (unit) withheld out of fifty ( .!/"%0 1" $%& %& ), “and so forth (Num 31: 30). Further on, in Num 31: 47, where the fulfillment of this instruction is acknowledged, the word order is reversed: .!/"%0 1" %& $%&0-#&.literally: “the (unit) withheld, one out of fifty.” Quite possibly, this set of meanings goes back to Akkadian leqû “to take,” which in mathematical texts can mean “to subtract, take off; extract a square root” (CAD L, 136, s.v. leqû, meaning 1d). It bears notice that Old Aramaic ’-¥-z at times functions as a loan translation of Assyrian laq ’u in the sense of “to receive, acquire by purchase,” and that this meaning in fact establishes the functional equivalence of the two verbs (Fales 1986: 179). In turn, Biblical Hebrew $%& would represent a back-formation of the Aramaic, not at all improbable during the Late Biblical period, to which both of the biblical references belong, in our view. 2) Verbal Pi‘‘el (/% (=¥išš"b ) “ to reckon, keep an account”( Lev 25:27, 50, 52, 27:18, 23; 2 Kings 12:16). This specialized connotation derives from the basic sense of the root ¥-š-b, namely, “to figure out, conceive.” Its turns out that the chronicle of temple renovations, 2 Kings 12, is the locus of technical usage conveyed by the Pi‘‘el ¥išš"b. The relevant passage reads: “And they do not keep an accounting of the men ( .!/2&0 #& ,(/%! &), ), through whom they remit the

Baruch A. Levine

423

silver to be paid to the craftsmen, for these perform under terms of trust” (2 Kings 12:16). For the rest, we have only the 3rd masculine singular, in the inverted perfect, occurring in priestly laws governing land tenure. Thus, Lev 25: 27: “He shall compute ( (/%, ) the years since its sale.” Or, Lev 27: 18: “The priest shall compute for him ( 1030 ,) (/%, ) the silver according to the years remaining.” The term 1,(/% occurs three times in Koheleth (7,25,27, 9:10), where it seems to mean “a reasoned calculation.” In his search for wisdom and meaning, the Sage arrives at such awareness in steps: “One by one to arrive at a reasoned calculation ( #%& 1,(/% &-") #%&) ”- Koh 7:27). In Post-biblical Hebrew usage, the term 1,(/% was taken to mean “account, calculation” (Kasovsky 1957, 2: 737-738), and Pi‘‘el forms continued to be used with the same Biblical Hebrew connotation. Later dialects of Aramaic also attest nominal forms. Thus, the term ¥šbn occurs in the great Tariff from Palmyra, line 155 (=PAT 1259= C3913), and see ibid., Glossary, 369, s.v. ¥šb v., and ¥šbn, and DNWSI 411, s.v. ¥šbn1 . In the same Tariff, line 53 we read: mks’ dy q#b’ ’py dnr ¥yb lmt¥šbw “The tax on butchers must be computed in dinars” The form lmt¥šbw represents the Ithpa‘‘al, a reflex of the Pa‘‘el. Also note the form &2(/,% “account, calculation” in Jewish Babylonian Aramaic (DJBA 443). The term 1(/% occurs in an Aramaic signature to a Greek legal document from the Babatha archive at Nahal Hever: 0&"#)# 1!*2 563 1, 47 1(/%) .. 1" #)(4 ! “That I have received from PN .. on account; a deposit of silver (in the amount of) 300 dinars” (Greenfield 1989:141, s.v. no. 17, line 41). Important evidence also comes from Punic sources, which attest the title, or office known as (/%", plural .(/%" “accountant, treasurer; the exchequer.” (PhPD 277278, s.v MHŠB). Thus KAI 160 lists various officials associated with the sodality, including: #+/ (/%" “the treasurer/ accountant of the sodality (apud PhPD 277, and cf. ibid, 476, s.v. Š‘T). More specifically, the plural .(/%" (cf.Latin quaestores), taken as a collective, can designate the exchequer, the agency that imposes fines, and collects taxes.” The legend on some Carthaginian coins from Sicily attests this title. 3) )3 (= k$l) “total.” The technical meaning is restricted to contexts in which quantities are tallied, and where it would be insufficient merely to translate “all, all of-.” Our attention is directed, therefore, to the very types of biblical texts that give evidence of having been adapted from records. We may compare Sumerian šu.nigin, Akkadian nap¦ ru, Ugaritic tgmr (DUL 2003: 861-862), all of which mean “total.” Clear examples of this technical sense include the following: (a) The absolute form )3 (=k8l):[a1 ] Jos 21: 39: +(*& .!*+ )3 “Total: towns - four.” [a 2] 2 Sam 23:39: 0+(/, .!/)/ )3 “Total: thirty seven” (following the list of David’s elite warriors). [a3] 2 Chron 26:12: .!7)& )!% !*,(9) #,(&0 !/&* *76" )3 #,&" //, “Total number of the heads of the patrilineal (households), of elite warriors: two thousand and six hundred.” (b) The construct form )3 (=kol): [b1] Gen 46:22: */+ 0+(*& /72-)3 “Total of persons: fourteen.” (cf. Gen 46:26-27, Exod 1:5). [b2] Num 2:9: .!7)&-#//, 5)& .!2"/, 5)& #&" 0 ,0! 02%") .! 470-)3 .#&(-) #,&"-+(*&, “Total of the musters of the Judahite encampment: 186,400,

424

Biblical Accounting Register

by their divisions.” Numbers 7, the record of the Tabernacle dedication, attests both the absolute and construct forms. Also note 0+/#, .!/)/ 0&" )30 “The total: one hundred thirty and nine,” concluding a list of personnel (Ezra 2:42, and see below, “The Signification of Quantity”). 4) 63" (=mekes) “customs, tax rate” (Num 31: 37-41); cf. feminine 063" (=miks h) “quota, calculated amount” (Exod 12:4, Lev 27:23). In the war narrative of Numbers 31, this term refers to the rate of taxation to be applied to spoils of war, so as to determine what percentage of the spoils was to go to the priests and Levites (see above, no.1, $%& ). On the precise meaning of the feminine form, 063" in Lev 27:23, see below, no.8, under :*+. In Exod 12:5, #,/72 #63"( is best translated “ according to the quota of persons, “namely, according to the number of persons in the household, so many sheep shall be offered. The connection to accounting is indicated by use of the verb ¥išš"b “to reckon, keep an account” in Lev 27:23. The priest was to calculate the value of the field depending on how many years remained until the Jubilee. Punic attests a likely cognate, MKS (= m$k"s?) “customs official.”(PhPD: 281, s.v. MKS II). Akkadian attests m kisu “tax collector” (CAD M I:129-130), and verbal mak su “to collect a tax, a share” (CAD M I: 127-128), and the term miksu “tax, share of the yield” (CAD M II: 6365). Of considerable interest is the fact that Aramaic also attests the term 63" in two actual accounts, one a brief record from Saqqara, dated 416 B.C.E. (TAD III, C 11), and the other from Elephantine (TAD III, C 28), an extensive record pieced together from many fragments, and dated to the 3rd century B.C.E. TAD III, C11 contains two headings: 6 #2/( .!4 !$ &763 “silver/funds ‘on hand’ in year six” (line 1), and: 6 #2/( .!4 !$ 563 1*#! 0,0 “The surplus of funds ‘on hand’ in year 6 was-“ (line 8). One entry under the latter heading reads: &763 " )+ 56,#& !$X *( !6&;7 “The sum that was added on the tax of PN, son of PN” (line 8). A second reads: 6 #2/( ,76,#! !$ &!*(9 63" “Tax of the men who will be added in year 6” (line 10). TAD III, C28, records several types of transactions, including sales of wine and wheat, and deposits of various sorts. Column 4 (consisting of lines 47-50) is not entirely comprehensible; it lists quantities of unidentified items in the house of a person named Yashib, and “in our house,” as well as .!/,%2 , presumably “objects of bronze,” and then in line 50 we read: 4 / 8 1/*3 63"( &$ / “This year, (owed) in tax: karš 8, shekels 4.” The most elaborate Aramaic source relating to the term mks is the great Tariff from Palmyra (PAT 0259= C3913), variously preserved in Greek and Palmyrene Aramaic. The Tariff is dated 147 C.E. and was written on stone slabs. It was issued by the council (Greek boul", Aramaic bwl’ ), and provides us not only with a Greek equivalent for Aramaic mks, namely, telos, but with composite terminology, including: nmws’ dy mks’ “the law of taxation” (col.II, line 1), the formulas mks’ gby “the tax shall be levied” (col. II, line 14), mks’ ¥yb’ “liable for tax, owes tax” (col.II, line 146, and cf. the negative: mks’ l’ ¥yb’ “not liable for tax.”), and more. The determined plural, mksy’ “taxes” is also attested (col.II, line 194), and the nomen agentis, participial mks (=m k"s) “tax collector.”

Baruch A. Levine

425

It is clear that Aramaic mks derives from Akkadian miksu (Kaufman AIA 72), but the question remains as to the derivation of Hebrew mekes, fem. miks h. In our view, the priestly Torah texts in which these terms occur exclusively are postexilic, and date from the Achemenid period, which dating, if correct, would suggest that this terminology may have entered Hebrew via Aramaic, not directly from Akkadian. In any event, the term mekes is connected to the Aramaic accounting system, evidence its frequent occurrence in later Aramaic dialects. Note the rare occurrence of feminine 063" in a Hebrew tenancy agreement from Murabba‘at, originally edited by J. Milik in DJD II, 1961, 122-134; Yardeni 2000, 107, s.v. Mur 24, col. VI, line 11). 5) #!(*" (= marbît), also: #!(*# (= tarbît) “interest, increment” Lev 25: 36-37, Ezek 18:8, et passim; Prov 28:8). All attested forms derive from the Common Semitic root r-b-3rd –weak - rabû in Akkadian, r-b-y (secondarily Hebrew r-b-h ) in West-Semitic. “to grow, increase.” The primary law in Lev 25:36-37 pertains to indebtedness incurred by a fellow Israelite, in which case it is forbidden to charge interest, or to take a ‘bite,” (Hebrew :/2). More specifically, the term #!(*" applies to foodstuffs that are supplied to one in need, in which case no increment could be demanded in repayment (see Levine 1989: 178, s.v. Lev 25:36). The formula is: #!(*"( 1#2 “to give out with interest.” In a sort of “Holiness Code,” presented as a wisdom mashal, Ezekiel 18 includes among the virtues of the righteous person the avoidance of #!(*# (Ezek 18:8), whereas the proverbial, wicked son is guilty of this very offense (Ezek 18:13). Finally, Prov 28:8 cautions the greedy that their unjust gain will ultimately be lost to a truly generous person: “He who aggrandizes his wealth by ‘bite’ and interest ( :/2( #!(*#(, ), will have amassed it to (the benefit of) one who is gracious to the needy.” The Aramaic cognate &/0#!(*" “interest, increment,” is well- attested in Aramaic loan documents from Elephantine (DNWSI: 690, s.v. mrby, and TAD II, xxxiv, Glossary. s.v. mrby). In no. 9, below, it is explained that this term contrasts with /(&)* “capital, principal sum.” In Elephantine Aramaic we find the formula: 0#!(*"( (0! -“to give out (=to lend) with interest,” parallel with the Hebrew - 1#2 #!(*"( (Lev 25: 37, cf. TAD II, B3.1, lines 2-3). In another loan document from Elephantine (TAD IV, D2.18, lines 1-2), we read that the obligation of paying interest was considered part of the overall debt, so that one’s heirs inherited the interest obligation as well as the principal. The same terminology is evident in Judaean Desert documents from the 1st and 2nd centuries C.E. Late Hebrew and Aramaic attest the form #!((!)* “interest.” Thus, in a Nabatean-Aramaic debenture, Papyrus Yadin 1, line 19, we read: 0#!(*, 02 &!632 1,3/", “And the mortgage on these properties, and its interest” (JDS III: 178, and cf. in JPA and JBA (DJPA 513; s.v. !(*; DJBA 1073, s.v. &#!(!* ). In the COMMENTARY to Papyrus Yadin 1 (JDS III: 192-193, s.v. lines 1618) the specialized sense of the verb r-by, namely, “to accrue as interest” is explained against the background of the Elephantine Aramaic material. We may add that this provides the most direct link to Akkadian usage of the cognate verb

426

Biblical Accounting Register

rabû “to grow, increase.” CAD R: 43-44, under rabû A, meaning 4, cites many sources, from various periods, where this verb refers specifically to the accrual of interest. Also see Y.Muffs 1969; reprint 2003: 185 for a discussion of the functional equivalence of the Aramaic and Akkadian formulas. Thus, Akkadian KÙ.BABBAR ina mu¦¦ija i-rab-bi = Aramaic - 563 !)+ 0(*!, “The silver of will accrue (as interest) against me / to my debit” (cf. TAD II, B4.2, line 2). 6) Aramaic 0472, determined: ǘ (=nipq%t ’ ) “expenditure, costs; what was paid out” (Ezra 6:4,8), literally” “what goes out,” from the Aramaic verb n-p-q. This term has a long and full history in the Official Aramaic of Elephantine (DNWSI 743-744, s.v. npqh) It is also attested at Palmyra, in the masculine plural npqyn. The most recent Nabatean evidence comes from Nahal Hever, in P.Yadin 1, line 40: 0472, &* )3, “And any return or expenditure (or: “any ‘scattering’ or expenditure)” See JDS III: 198-199, where there is reference to Arabic nafaqatun “expense, maintenance” at Hirbet Mird. Also see DJPA2 358. 7) 5 +, in 5 +0 (= h ‘$d"p) “which is in excess; surplus.” (Exod 16: 23, 26:12-13, Lev 25:27, Num 3:46, 48-49, Hiph‘il 5! +0 “to exceed” in Exod 16:18). Biblical Hebrew usage refers to excess of number and quantity, namely “surplus,” which is our interest here, and also to measurements, such as greater length. The provisions of Lev 25:27 may be explained as follows: All sales of ancestral land were functionally equivalent to long-term leases, which would terminate at the next, scheduled Jubilee year. One who wished to redeem land he had sold under stress was obliged to compute (the Pi‘‘el ¦išš"b; see no. 2, above) the value of the crop years since its sale, “and pay (only) the excess ( 5 +0-#& (!/01) to the one to whom he had sold it.” In other words, the redeemer of the land could deduct for the years that the purchaser had already benefited from his purchase, and didn’t have to pay the entire purchase price to get his land back. Numbers 3 ordains that the tribe of Levi is to be devoted to Tabernacle service in payment to the God of Israel for having spared the firstborn of the Israelites in Egypt. A census indicated, however, that there were 273 more firstborn Israelites than there were adult, male Levites, so that five shekels a head, totaling 1, 365 shekels, had to be collected from the firstborn of Israel and remitted to Aaron, the priest. Those 273 firstborn are referred to as .!,)0 )+ .!7 +0 “who were in excess of the Levites” (Num 3:46). We also find formulas such as .0( .!7 +0 !, 7 “the redemption payments of those among them who were in excess” (Num 3: 48), and .!,)0 !, 7 )+ .!7 +0 “those in excess of the redemption payments of the Levites” (Num 3:49). Imagine an account like the following: Total firstborn males among the Israelites. (one month of age and over) : 22,273 Subtract total males among the Levites (one month of age and over): 20, 000 .!7 +0 “those in excess:” 273 .!, 7 “redemption payments” (at 5 shekels a head X 273) : 1,365 shekels

Baruch A. Levine

427

Comparative evidence on the root ‘-d-p is elusive. All we have are later Hebrew and Jewish Aramaic forms based on this root, and a very rare, though often cited Arabic cognate,
428

Biblical Accounting Register

assessment on the land ( >*&0-#& :!*+0 ),” and that “he exacted from the people of the land the silver and gold to be paid Pharaoh Neco, according to each man’s assessment ( ,3*+3 /!& ).” There is additional West-Semitic evidence bearing on forms of the root ‘-r-k. We will begin with Ugaritic usage, citing KTU 2 4.728, lines 1-3: ‘rk. b‘l. ¦lb dt. l ytn. šmn “Prepared account of citizens of ¤LB (Aleppo?) who did not deliver oil” (DUL 182, s.v. ‘rk I, n.m.). Although this source does not attest the specific meaning “value, equivalent” for the term ‘rk, its occurrence in and list of persons who have not met required deliveries makes it relevant to the biblical term under discussion. Later Punic evidence demonstrates the survival of the old West – Semitic vocabulary, but it is relatively sparse, and at times difficult to interpret confidently. In a Neo-Punic statuary inscription from Tripoli in North Africa, dated to the early 1st century B.C.E., we read: “The senate and the entire nation of Lepcis mutually resolved to pay back to that gentleman, to Aderbal, for his contributions at the expense of the city, in accordance with the full valuation ( !7) &)"& :*+ )3) of [the statue , as is] incumbent upon them” (KAI 119, lines 4-6, apud PhPD 387). Under a separate entry, Krahmalkov (PhPD 387) lists the feminine form ‘RKT which he renders “bureau of public works, following a suggestion by M.Dahood that 03*+ means “building.” An alternative interpretation, followed by others (cf. DNWSI 888, s.v. ‘rkh) would take the form #3*+ to mean: “bureau of assessment.” One Phoenician and two Punic sources attest this form. Thus, RSF 7 (1979), no.48, col. I, lines 1-2 (from Nebi Yunis): “This is the Molk-offering table that the bureau of assessment (#3*+0)… devoted and presented to their lord, Esmun.” A Punic text from Malta (KAI 62, lines 1-4), dated to the 2nd century B.C.E., reads as follows: “The people of Gaulos rebuilt these three sanctuaries during the time of the chief of the bureau of assessment [Latin Censor] (#3*+ * & * #+(), PN son of PN.” Finally, KAI 130, lines 5-6, also from Tripoli, tentatively dated 180 C.E. reads: “The bureau of assessment in charge of the ports (.$%"0 )+ /& #3*+) made four of the benches with (funds derived from) fines.” In summary, the specialized meaning of ‘-r-k “to assess,” and related nominal forms, belong to the West-Semitic vocabulary, not specifically to the Aramaic vocabulary, as is true of many of the accounting terms examined here. Biblical terminology is utilized extensively in Rabbinic Hebrew sources, where legislation governing priestly activity is a major concern, and even rarely in JBA and in Syriac ( DJBA 881, s.v. 1# :*+ , LS2 548) for the same reason. 9) /&* (= r$’š) “capital, principal, original amount” (Lev 5: 24, Num 5:7). Biblical usage is limited to two priestly Torah texts (in Rabbinic Hebrew “head” is replaced by “horn,” Hebrew 1*4). Operative verbs are Pi‘‘el .)/ “to pay out, repay,” and (!/0 “to make restitution.” Thus Lev 5:24, speaking of one who had taken a false oath regarding the misappropriation of assets: “And he shall repay it equal to the amount of its principal ( ,/&*( ,#& .)/, ), adding to it one fifth of the amount.” Or, Num 5:7, speaking of one who misappropriated sancta: “And he must make restitution for his liability equal to the amount of its principal ( #& (!/0,

Baruch A. Levine

429

,/&*( ,"/&), adding to it one fifth of the amount.” In 1911, the Assyriologist, Arthur Ungnad, first noted the equivalent connotation of the Akkadian term qaqqadu “head, principal sum” (CAD Q: 109-111, under meaning 6). The correspondence of Akkadian and West- Semitic usage is quite remarkable; in both, “principal” is contrasted with “interest,” ?ibtu in Akkadian, and the accompanying verbs in Akkadian also mean “to pay, repay” (ap lu, mullû, and the like). There is considerable comparative evidence from Aramaic sources, where /(&)* similarly means “principal, capital,” and &#!(*" means “interest” (cf. no.5, above) Quite possibly, the biblical usage of Hebrew /&* to mean “principal” is Aramaistic. Thus, in an Aramaic loan document from: Elephantine (5th century B.C.E.) we read, regarding the compounding of interest: %3 % &/*3 &#!(*" 0(*! &/*) &#!(*" #;" 10 “Should the interest reach the (amount) of the principal, the interest (on the interest) shall increase at the same rate as the (interest on the) principal” (TAD II: 54, B3.1, lines 6-7, and see above, in no. 5, #!(*" , for additional references). A similar clause appears in a broken loan document, TAD II, B4, lines 4-5: %*!( %*! :) !02")/&, 0(*!, /&* 0,0! #!(*" 0( :) 1#2& &) !$ &%*!, “And any month in which I do not pay you interest, it shall become principal, and shall accrue (as interest), and I will pay it to you month by month.” In a business letter from Elephantine (3rd century B.C.E.), we read: !/&* )+ #")/ 1*4+ “I completed payment covering the principal sums of the real property” (TAD IV: 36, D1.17, line 5 = Cowley 82). The same formula, 1*4+ /&*. “the principal sum of the real property” occurs in a later Nabatean-Aramaic legal document from Nahal Hever, Papyrus Yadin 1, line 15, dated ca. 103 C.E., (JDS III:178). In a deed of pledge from Wadi Daliyeh (late 4th century B.C.E.) we read: 1 )4/ &763 /&*) ;%!#! “It shall be weighed out as the principal amount of silver; shekel, 1”( DJD XXVIII: 98, s.v.WDSP 10:7 [text broken]). 10) 02,3# (=t%kûn h) “weighted, measured currency; convertible wealth” (Nah 2:10; [for different nuances see Ezek 43:11, Job 23:3], and cf. 13#"0 5630 “the weighted silver” in 2 Kings 12:12).The term 02,3# has been studied in depth by J.C.Greenfield (2001: 258-262, and literature cited), and we may review his findings in the context of biblical accounting terminology, adding some considerations of our own. Speaking of the flooding of Nineveh at the time of its siege, the prophet declares: Plunder silver! Plunder gold! There is no limit to the ready currency ( 02,3# ); It is a weighty (hoard) of every precious object! (Nah 2:10). The etymology of 02,3# , a term also occurring in Aramaic legal documents from Elephantine (see further) warrants clarification. Ultimately, this form may go back to k-w-n “to stand;” more immediately, it derives from a probable secondary root t-k-n “to contain; to measure, weigh.” In Isa 40:12, the Pi‘‘el 14# is parallel with

430

Biblical Accounting Register

m dad “to measure,” and in Ezek 43:10 they measure the #!23# “plan” of the Temple. Other forms exhibit related meanings (HALAT:1596-1597, s.v. 13# v., 13# s.). The form 02,3# is one of many Tau-preformatives in Hebrew and Aramaic (cf. 0*,"# (no. 9, below), and literally means: “that which has been weighed, measured.” Functionally, 02,3# compares with *%6) *(+ 563 “silver transferable to/ current with merchants” (Gen 23: 16), namely, in a form that merchants will accept, such as ingots, or weighted coins. In fact, earlier in the same account, in 2 Kings 12:5, we find the designation *(,+ 563 “silver currency”(see above, no. 7, s.v. :*+). In 2 Kings 12: 12, the form 13#" (= m%tukk n) is denominative of 02,3# , namely: “made into weighted units.” As noted by Greenfield, the parallel passage recording payments to craftsmen in 2 Kings 22:4 reads: “Go up to Hilkiahu, the chief priest, and let him melt down (read: :#!, = w%yatt"k) the silver that has been brought into the Temple of YHWH.” Once the silver had been converted into ingots, or weighted coins, it was dispensed as payment to the craftsmen. Applying this to the statement in 2 Kings 12:12, we read, with Greenfield and others: wayyi#rû “they cast,” namely, they cast the silver that had been collected from the people. The term 02,3# occurs in two Aramaic legal documents from Elephantine.(TAD II, B2.6, and B3.8) in both the absolute and the determined form ( ,3# ,0#2,3# ). Pace Greenfield, there is no reason to regard it as a Hebraism. It is more likely a common Hebrew-Aramaic term, which actually draws our attention to Aramaic accounting terminology. TAD II, B2.6 and B3.8 are both contracts of marriage, wherein the items of dowry “brought in” by the wife include: 563 !$ 02,3#: “weighted coins/ingots of silver,” followed by the specification of value as karš and ¥allur, both measures of weight, along with shekels. This silver was in addition to clothing and other commodities made of cloth, as well as bronze objects. In summary, both the biblical and the Elephantine contexts pertain to accounting. In renovating the Temple in Jerusalem, funds had to be provided in negotiable form to pay the craftsmen. In fact, 2 Kings 12:16, 22: 7 both employ the key verb hišš"b “to reckon, keep an account” (see above, no.2). In the Elephantine marriage contracts the value of the “cash” contributed by the bride is designated “t%kûn h of silver.” Greenfield directs the reader to important sources of information on methods of casting and minting weighted coins in the Achemenid period, and refers to hoards of such coins and ingots from all over the ancient Near East (Greenfield 2001, notes 13, 16). 11) 0*,"# (= t%mûr h) “item of exchange” (Lev 27: 10, et passim). The form with Tau-preformative connotes the result of the Hiph´il *!"0 “to exchange, replace” (for cultic usage, cf. Lev 27: 10, 33, Ezek 48:14), namely, that which was exchanged. This term is widely used in Rabbinic sources, in laws dealing with cultic materiel. The underlying verb, Hebrew m-w-r, may be cognate with rare NB m ru “to buy,” which, in context, functionally connotes “to barter, exchange” (CAD M I, 317, s.v.

Baruch A. Levine

431

m ru), and is listed as an Aramaic loanword. Although it is attested in Syriac (LS2 377, s.v. mr), it is not a typical, Aramaic word. The above accounting terms, when studied in comparative perspective, indicate that procedures operative in ancient Israel were representative of a West-Semitic system, especially evident in Aramaic and Phoenician-Punic records. The Signification of Quantity Accounts register quantities with cardinal numbers (and fractions), sequenced in different ways. Certain languages employ dual forms to register two of an item. In the ancient Near East, as in other systems, ancient and more recent, we find two, primary sequences: (1) quantity + item [ Example: “five (5) cows”], and (2) item + quantity. [ Example: “cows – five (5)”]. A second factor is the type of numeral employed in a given record. In ancient Near Eastern records we find two, primary types: (1) ideographic numerals, in which case what is written signifies a certain number [Example:”1,” “2”, “3”], (2) non-ideographic, or word numerals, in which case what is written spells out the word for that number [Example: “one”, “two”, “three”]. There are variations on these primary categories, representing specific formats. For example, in certain types of administrative lists numerals may not function as direct modifiers of nouns, but merely to record quantities, or totals of commodities, personnel, and the like, that have been identified in the title of the record. In other words, instead of registering: “Personal Name – cows, 5,” the record will be look something like the following: Archers: Place Name A – 5, Place Name B – 6 Place Name C – 7, etc It needs to be said that of the two features under discussion, sequence is more significant than the type of numeral used. Whereas it is possible that unrelated cultures would have independently fixed certain forms as ideographic numerals (as for example, a single, vertical marking to signify “1”), the preference for identifying the person, place, or item first, and then the quantity, reflects a discrete perception, or disposition, and may even demarcate between one Kulturkreis and another, as will be seen. And yet, there is a close correlation between the utilization of ideographic numerals and the sequence “item + quantity,” so that the two features are best considered together. Anticipating the discussion to follow, we can say that in the cuneiform writing system (with the exception of the Ugaritic alphabetic cuneiform), “quantity” precedes “item” in accounting records; in other words, the numeral comes before the noun. In contrast, accounts and administrative records from the Aegaean and Eastern Mediterranean, both alphabetic (Ugaritic, Hebrew, Aramaic, PhoenicianPunic) and ideographic-syllabic (Linear A and B) also exhibit the sequence “item + quantity,” variously utilizing both word numerals, and ideographic numerals of various shapes. a) The sequence “item + quantity” in biblical records.

432

Biblical Accounting Register

In manuscripts of the Hebrew Bible there are no ideographic numerals, but it may be that some, or all biblical records which employ the rather abnormal sequence “item + quantity” were modeled after accounts that registered ideographic numerals. The Ugaritic evidence suggests, however, that word numerals might have been employed originally in such records, because there we find exact examples of this pattern (see just below, and under “The Signification of Quantity,” c) In any event, as regards sequence, it is more normal in the Hebrew Bible to find quantity preceding item, meaning that the numeral comes before the noun This sequence can be formulated in two ways: a) with a word numeral in the construct: .!/(3 #+(/ literally: “seven of sheep” (Lev 23:18); b) with a word numeral in the absolute: .!/(3 0+(/ “seven sheep” (Num 28:27). When item precedes quantity, however, only the word numeral in the absolute is employed, as we would expect. It is precisely in texts which exhibit the features of accounts, or records that we find the sequence “item + quantity” most often. To illustrate, let us begin with Joshua 12, which preserves a list of thirty-one kings of Canaanite city-states conquered by the Israelites. %& )&-#!( -" */& !+0 :)" %& 1,*(% :)" ---%&, .!/)/ .!3)" -)3

%& %&

,%!*! :)" .)/,*! :)"

King of Jericho one; King of the Ai, which is near Bethel one King of Jerusalem one; King of Hebron one, etc. ---Total of kings: thirty and one (Jos 12: 9-24, with omissions) In this record, the numerals do not serve as direct modifiers of nouns, but merely to register quantities. Otherwise, this list, as it is formatted in printed Bibles, is probably the least adapted of all biblical records, once we get past its title, which is part of the introductory narrative (Jos 12: 7-8). Another example of the sequence “item + quantity” is to be found in the report of the donations of the tribal chieftains (Hebrew .!&!/2 ) at the dedication of the wilderness Tabernacle. (Num 7: 12-88). We find repetitive entries that are formulated as follows :.!")/0 %($), *4( –.!2/ 0/"% -.!)!& .! ,#+ –0/"% 0/"% -02/-!2( .!/(3 For the sacred gifts of greeting: oxen - two rams - five

Baruch A. Levine

433

he-goats - five yearling lambs- five Here we have word numerals being utilized as direct modifiers of nouns. Still another example is Ezra 1:9-11, a list of Temple appurtenances returned to the Judean Premier, Sheshbazzar, by Cyrus pursuant to his edict: Following is their quantity ( .*76" 0)&, ): golden sashes - thirty silver sashes - one thousand suits of clothes - nine and twenty ( .!*/+, 0+/# ) golden bowls - thirty silver bowls ( of various types) - four hundred and ten other vessels - one thousand Total of vessels ( .!)3-)3) of gold and silver: five thousand four hundred [incorrect] Additional examples of biblical records and accounts employing the sequence “item + quantity” are to be found embedded in the festival calendar of Numbers 28-29; in the genealogies of Genesis 46; in the town lists of Joshua 15, 18, 19; and 21; and in many of the genealogies of I and II Chronicles. 2) The sequence “item + quantity” in 1st millennium West-Semitic epigraphy: We can identify near- contemporary models of the type of texts we are positing as the Vorlage of the above biblical reports. The closest in time and place are Hebrew ostraca, such as those found at Lachish, and at Arad in the Negev, largely dating from the end of the 7th to the early 6th centuries B.C.E. As an example, we take Arad ostracon no.1, written in Paleo-Hebrew script. It is a brief letter to one in charge at Arad, instructing him to provide foreign mercenaries from Kition, on Cyprus, with wine and flour. We provide a hand copy, taken from the editio princeps by Yohanan Aharoni (1975: 12), and his transcription into the customary Hebrew script, followed by our English translation. (Figure 1) Translation of Arad, no.1: (1) To Eliashib: And (2) now then: Provide the Kittim (3) wine; bat 1, [hîn] 3, and (4) register the date. (5) And from the remainder of the flour (6) of first grade you shall (7) mix h$mer 1 of flour (8) to make for them (9) bread. From the wine (10) in bowls you shall provide. Notes: For our purposes, it is most relevant to take note of the markings used as ideographic numerals. In fact, the Arad ostraca attest two, different sets of ideographic numerals, one West-Semitic and the other Hieratic. We are concerned only with the West-Semitic markings. In line 3, we have the acronym ( , for Hebrew: #( (= bat), a liquid measure containing approximately 22 liters. The horizontal marking following the letter ( signifies the numeral “1”, of course, and

434

Biblical Accounting Register

we assume, from similar designations in other ostraca, that the three following markings, signifying the number “3,” refer to the Hebrew liquid measure 1!0, of which six constituted one #(. Hence: “wine, bat 1, [hîn] 3,” as translated. In line 7, the first marking is usually taken as an ideograph representing ¥$mer, or kûr, a measure containing approximately 220 liters, avoirdupois. On the markings, themselves, see. J. Naveh (1992). Most importantly, in this ostracon item precedes quantity, although this is not consistently the case in the Hebrew ostraca from Lachish and Arad. Furthermore, there is an observable flexibility in sequence. Thus, in line 7, we do not find: “flour, ¥$mer 1,” which would be entirely consistent with the formulation of line 2, but rather: “¥$mer 1 of flour.” And yet, we do not find “1 ¥$mer of flour!” The same markings are employed in Aramaic ostraca from Arad, dating from the Persian period, edited by Joseph Naveh (Aharoni 1975:196), which leads us directly to the Aramaic papyri from Elephantine, dating to the 5th century B.C.E., where one likewise encounters the sequence “item + quantity” (see further). We begin with a brief example, merely to show graphically how this type of record appears. TAD IV, D3.26 dates from ca. 400 B.C.E., and is an inventory of some sort. The papyrus is fragmentary, but the three lines that are preserved should suffice as illustration. It preserves a partial list of boards, or planks, with their length, width and thickness specified. We provide Ada Yardeni’s hand copy, with the transcription given in TAD IV:101, accompanied by our translation (Figure 2). Translation: (2) Inside: a [board]: cubits 12; width: cubit 1; thickness: handbreadths 4. (3) Inside, another board: cubits 9, and a half; width: cubit 1; thickness: handbreadth[ (4) Another board: cubits 5; width: cu[bit 1 + handbreadth] 1; thickness: handbreadth[ Notes: The noun %,) is common West-Semitic, and has a variety of meanings. The rendering “board” is only conjectural. In line 2, the word for “thickness” is most likely written with a resh, and is to be read 0*, (=consonantal dwrh = dûr h) (DNWSI 243-244). The word for handbreadth, :/7, is cognate with Akkadian pušku (DNWSI 946). In line 2, we have in addition to the usual markings for 1, a marking for 10, so that “12” is registered as “10 + 2.” By far, the most elaborate example of the “item + quantity” sequence is the so-called “Ahiqar Palimpsest” from Elephantine (TAD III: 82-193; C3.7) discovered and ingeniously restored by Ada Yardeni. It is an extensive customs record, dated ca. 475 B.C.E., and composed of numerous columns. I have selected several lines from a relatively well- preserved section (DV 2, TAD III: 186, lines 1-6). These are provided with Ada Yardeni’s hand drawings, with the given transcription, and our translation. The bracketed restorations in the transcription are fairly certain, being based on recurring, conventional entries (Figure 3).

Baruch A. Levine

435

Translation 1) The [duty] accrued as surplus in year 10, 2) Ov[er and above the du]ty that accrued in year 11: 3) gold: karš 1, š (=š@q lîn) 9, ¦ (=¦allûr) 1, r (= r%b ‘în ) 2. 4) silver: karšîn 100 + 40 + 10 +2, š 9. 5) Ionian wine: bowls 100 + 20 + 9 and a half. 6) Sidonian wine: jugs 100 + 40 + 10, etc. Notes: The acronym * (= r) signifies 1+(* “quarters,” a fraction. Two types of containers are mentioned: (1) 176 (=sappîn) “bowls,” and 1 23 (= Hebrew .! 3 – kaddîm) “jars, jugs.” It has been observed that utilization of the same vessels for particular commodities is not consistent. The sequence “item + quantity,” using ideographic numerals persisted in Aramaic records long after the Achemenid period. It occurs in the great Tariff from Palmyra, to which reference has already been made. The sequence “item + quantity,” using ideographic numerals persisted in Aramaic records long after the Achemenid period. It occurs in the great Tariff from Palmyra, to which reference has already been made. It also bears mention that some of the same ideographic markings for numerals are to be found in Phoenician-Punic records of the Achemenid period, and thereafter, where we also encounter the sequence “item + quantity.” Thus, in the famous tariffs from Marseille, dated ca. 4th century B.C.E, we find entries such as the following: %&( 2 *$ 1 )4/ 563 .203) “For the priests: shekel 1, zar 2, for each one “ (CIS 1, 165, line 7; Cooke 1903: 112); 3) Early western evidence bearing on the sequence “item + quantity.” Whereas the sequence “quantity + item” is a standard feature of cuneiform records, our search for the origins of the sequence “item + quantity” takes us to the Aegean and Eastern Mediterranean of the Middle-to-Late Bronze Age in, first to Linear A, the ideographic- syllabic script of the Minoan language of Crete (ca. 1660-1450 B.C.E.); then to Linear B, the proto-Greek ideographic-syllabic script of Mycenae ( ca. 1450-1200 B.C.E.); and finally, to Ugaritic of the Syrian coastal region( ca. 1400-1200 B.C.E.), with its particular kind of alphabetic cuneiform. Michael Ventris and John Chadwick (1956) deciphered the Linear B script and decoded its language, and they have analyzed script development in the Cretan languages, generally. They conclude that the system of numeral markings used in Linear B is the same as that of Linear A, only more developed (Ventris-Chadwick 1956: 53). What is more, the sequence “item + quantity” in the Cretan scripts harks back to the earlier Cretan ‘hieroglyphs,” such as those of the tablet from Phaistos (see the hand copy in Ventris-Chadwick 1956: 30). This sequence is also evident in Egyptian hieroglyphic writing (Gardiner 1957: 192, s.v. no. 261). Whatever the putative influence of Egyptian models on the Minoan scripts, it is clear that the sequence “item + quantity” is a western convention, which contrasts

436

Biblical Accounting Register

with the eastern, cuneiform convention of registering quantity first, followed by item. To be specific: C.H. Gordon (1966: 26-27, and Plate VIII) cites two Minoan inscriptions from Hagia Triada (nos.88 and 122) that exhibit markings signifying numerals. There are verticals for single digits, and horizontals for “10.” In no. 88, we find a list of six personal names, each followed. By the vertical marking for “1”, followed by a total, which Gordon reads: ku-ro 6 “Total: 6,” shown as: 2 rows of three verticals, one on top of the other. (Figure 4). Gordon associates Minoan ku-ro with Hebrew )3. “total,” and actually cites Jos 12: 24, as well as determined )30 “the total” in Ezra 2:42 (see discussion above, and under “Selected Biblical Accounting Terms,” no.3). The Linear A material is sparse and difficult to decipher with certainty, whereas we possess a sizable corpus of economic and administrative texts, including lists of ritual offerings, in the protoGreek of Linear B. The consistent pattern is “item + quantity,” indicated by an ideographic numeral. The Linear B accounting system is actually quite sophisticated, and it exhibits ideographic numerals to signify large quantities, weights, and volumes.(Ventris-Chadwick 1956: 53-60). On the primary level, the sequence in Linear B is “item + quantity:” “MAN 1, OXEN 6,” not: “1 MAN, etc. To cite a simple example, we reproduce the transcription of no.206 = Gg705 (D 1), appearing in Ventris-Chadwick 1957b: 310, with our translation: It records a ritual offering. 1) ] a-mi-ni-so / e-re-u-ti-ja ME+RI AMPHORA 1 2) ] pa-si-te-o-i ME+RI AMPHORA 1 3) ]-ke-ne ME+RI AMPHORA 1 Translation: 1) Amnisos: To Eleuthia – honey, jar 1 2) To all the gods- honey, jar 1 3) [ broken] – honey, jar 1 Notes: The Linear B script is ideographic-syllabic. Amnisos is a known site near Heraklion, and Eleuthia is the name of a goddess. Vocabulary: me-ri = Greek meli “honey;” and pa-si-te-o-i = Greek p nsi theoi’i “to all the gods,” a frequent formula of address in the ritual tablets (see Ventris-Chadwick 1957b:303, note ‘P’). Now, to contemporary Ugarit, where we encounter a particular kind of alphabetic cuneiform used to write a West-Semitic language. The signification of quantity is complex in economic documents, where three systems are in evidence: (1) Quantity + item, using a word numeral. Example: KTU 2 4.63, line 34: tt. qštm w. tn . ql´m “six archers and two slingers.” This sequence predominates in Ugaritic, and parallels the normal conventions of Biblical Hebrew. (2) Item + quantity, using a word numeral. It appears that this sequence is not attested in Ugaritic where the numeral serves as a direct modifier of the noun, but only for registering quantity. Example: KTU 2 4: 48, lines 1-4, in a list of towns either

Baruch A. Levine

437

receiving or delivering wine, as the list’s total indicates. The units of content are not given. Place Name A -six 1) ¦lb ‘prm. ¿¿ Place Name B - twelve 2) ¦lb qrd. ¿n, ‘šr 3) qmy . arb‘ . ‘šr Place Name C -fourteen 4) ?‘q . arb‘ . ‘šr Place Name D - fourteen (3) Item + quantity, using an ideographic numeral. This sequence is also limited to registering quantity in Ugaritic, but is more frequent than the utilization of word numerals for this type of record. Example: KTU 4: 93, entitled: spr ytnm “a record of cultic servitors,” listing the names of those who received rations of wine, as the total indicates. Once again, the units of content are not given. Lines 2-.5 read: 2) bn . ¦lbym 2 Son of A 2 3) bn . ady. 2 Son of B 2 Son of C 2 4) bn . ‘¿try 2 Son of D 2 5) bn . ¦r&n 2 To summarize the comparative evidence: We observe in certain biblical records signs of a system of quantity signification known in the Aegean and Eastern Mediterranean since early times, and which is most evident in Aramaic accounting during the Achemenid period and thereafter. Summary We have attempted to investigate aspects of the accounting system of biblical Israel in West-Semitic perspective by focusing on specific features: terminology, and the signification of quantity. It turns out that biblical terminology is thoroughly realistic, and that accounting terms as well as formulas used to signify quantity fit in well with what is known from West-Semitic and other non- Semitic, western languages, such as Mycenean Linear B. The accounting terminology connects most closely with records in Aramaic and Phoenician-Punic, as does the sequence “item + quantity.” Most immediately, this sequence is evident in contemporary Hebrew epigraphy. With respect to sequencing, we observe a cultural divide. In cuneiform cultures, one apparently wanted to know quantity first, whereas in the western sphere, one wanted to identify the item first. It’s a contrast between “What?” and “How many/much?” This is not a script-specific distinction. It is not determined by the direction of writing or the type of script employed, nor is it driven by the syntactic character of any particular language, or language family. All we can say is that it is a distinction expressive of a difference in mentality, perhaps of a different perspective on the organization and presentation of data.

438

Biblical Accounting Register

Figures:

Fig. 1 Arad Ostracon no. 1 (From Aharoni 1975:12 Transcription and hand-copy)

Fig. 2 Fragment of an Aramaic Papyrus from Elephantine, dated ca. 400 B.C.E. (From TAD IV: 101. Transcription and hand-copy)

Baruch A. Levine

Fig. 3 From the “Ahiqar Palimpsest” dated ca. 475 B.C.E. (From TAD III:186)

439

440

Biblical Accounting Register

Fig. 4 A Linear A inscription (From Gordon 1966, no. 88, Plate VIII)

Baruch A. Levine

441

Reference Bibliography Ben-Yehudah, Thesaurus = Ben Yehuda, Elieser, Thesaurus Totius Hebraitatis, New York: Thomas Yoseloff, 1960, 8 vols. CAD = The Assyrian Dictionary, University of Chicago. CIS = Corpus Inscriptionum Semiticarum DJBA = Sokoloff, M. A Dictionary of Jewish Babylonian Aramaic, Ramat Gan & Baltimore, Bar Ilan University Press & Johns Hopkins University Press, 2002. DJD = Discoveries in the Judaean Desert, Oxford University Press DJPA2 = Sokoloff, M. A Dictionary of Jewish Palestinian Aramaic, 2nd edition, Ramat Gan & Baltimore and London, Bar Ilan University Press & Johns Hopkins University Press, 2002. DNWSI = Hoftijzer, J., Jongeling, K, Dictionary of the North-West Semitic Inscriptions, Leiden: E.J.Brill, 2 parts. DUL = del Olmo Lete, G., Sanmartin, J. A Dictionary of the Ugaritic Language in the Alphabetic Tradition. Leiden: E.J.Brill, 2003, 2 vols. HALAT = Koehler, L., Baumgartner, W., Hebräisches und Aramäisches Lexikon zum Alten Testament, Leiden: E.J.Brill, 1967-1990. JBA = Jewish Babylonian Aramaic JDS III = Yardeni, A., Levine, B.A., et al., The Documents from the Bar Kokhba Period in the Cave of Letters; Hebrew, Aramaic, and Nabatean-Aramaic Papyri, Jerusalem: Israel Exploration Society , 2002. JPA = Jewish Palestinian Aramaic KAI = Donner, H., Röllig, W., Kanaanäische und Aramäische Inschriften, Wiesbaden: Otto Harrassowitz, 1954, 2 vols. Kaufman, AIA = Kaufman, S. The Akkadian Influences on Aramaic, Chicago: University of Chicago Press, 1974. KTU 2 = Dietrich, M., Loretz, O., Sanmartin, J. The Cuneiform Alphabetic Texts, 2nd edition, Munster: Ugarit Verlag, 1995. Lane = Lane, E. W. An Arabic-English Lexicon, Beirut: Librairie du Liban, 1980, 8 vols. 2 LS = Brockelmann, K., Lexicon Syriacum, 2nd edition, Hildesheim: Georg Olms, 1966 PAT = Hillers, D., Cussini, E., Palmyrene Aramaic Texts, Baltimore and London, The Hohns Hopkins University Press, 1996. PhPD = Krahmalkov, Ch. R., Phoenician-Punic Dictionary, Leuven: Peeters, 2000. RSF = Rivista di Studi Fenici TAD = Porten, B., Yardeni, A. Textbook of Aramaic Documents from Ancient Egypt, Jerusalem: The Hebrew University, 1986-1999, vols I-IV. WDSP = Gropp, D. M., Wadi Daliyeh II: The Samaria Papyri from Wadi Daliyeh, in DJD XXVIII, Oxford. Clarendon Press, 2001, 3-116. Aharoni, Y., 1975, Arad Inscriptions (Hebrew), Jerusalem: Bialik Institute-Israel Exploration Society.

442

Biblical Accounting Register

Corral, M. A. 2002, Ezekiel’s Oracles Against Tyre: Historical Reality and Motivations, (Biblica et Orientalia 46), Rome: Editrice Pontificio Isituto Biblico. Cooke, G.A. 1903, A Textbook of North-Semitic Inscriptions, Oxford: Clarendon Press. Diakonoff, I. M. 1992, “The Naval Power and Trade of Tyre,” Israel Exploration Journal 42: 168-193. The Economist, “Special Report; The future of accounts,” vol. 367, no. 8321, London, dated April 26th 2003 , 61-63. Fales, F.M. 1986, Aramaic Epigraphs on Clay Tablets, Roma: Universita degli Studi “La Sapienza.” Friberg, J. 1992, “Numbers and Counting,” in Anchor Bible Dictionary, New York: Doubleday and Co., 4: 1139-1146. Gardiner, A. 1957, Egyptia Grammar, 3rd edition, London: Oxford University Press. Goelet, O. 2003, “Ancient Egyptian Scripts- Literary, Sacred, and Profane,” in Semitic Papyrology in Context, ed. Schiffman, L.H., Leiden: E.J.Brill, 1- 21. Gordon, C.H. 1966, Evidence for the Minoan Language, Ventor, N.J: Ventor Publishers. Greenfield, J.C. 2001, “The Meaning of TKWNH,” in ‘Al Kanfei Yonah: Collected Studies of Jonas C. Greenfield on Semitic Philology, ed. Paul, Sh.M, et al., Leiden: E.J.Brill, 2 vols., 258- 262. Lamberg-Karlovsky, C.C. 1999, “Households, Land Tenure, and Communications Systems in the 6th – 4th Millennia of Mesopotamia,” in Urbanization and Land Ownership in the Ancient Near East, ed. Hudson, M., Levine, B.A., Cambridge MA: Peabody Museum-Harvard University, 167- 201. Levine, B.A. 1965, “The Tabernacle Texts of the Pentateuch,” Journal of the American Oriental Society 85, 307-318. Levine, B.A. 1989, Leviticus, JPS Torah Commentary, Philadelphia: Jewish Publication Society. Levine, B.A. 1996, “Farewell to the Ancient Near East: Evaluating Biblical References to Ownership of Land in Comparative Perspective,” ‘Privatization’ in the Ancient Near East and Classical World, ed. Hudson, M., Levine, B.A., Cambridge MA; Peabody Museum- Harvard University, 223-242. Levine, B.A. 1999, “The Biblical ‘Town’ as Reality and Typology: Evaluating Biblical References to Towns and their Functions,” in Urbanization and Land Ownership in the Ancient Near East, ed. Hudson, M., Levine, B.A., Cambridge, MA: Peabody Museum-Harvard University. Milik, J.T. 1961, “Textes Hebreux et Arameens, “ in DJD II: Les Grottes de Murabba’at, Oxford: Clarendon Press, 67- 205. Naveh, J. 1975, “Aramaic Inscriptions,” in Aharoni, Y., Arad Inscriptions (Hebrew), Jerusalem: Bialik Institute-The Israel Exploration Society, 165- 203.. Naveh, J. 1992, “The Numbers of Bat in the Arad Ostraca,” Israel Exploration Journal 42: 52-54.

Baruch A. Levine

443

Powell, M.A. 1992, “Weights and Measures,” in Anchor Bible Dictionary, New York: Doubleday and Co., 6: 897-908. Speiser, E.A. 1960, “Leviticus and the Critics,” in Yehezkel Kaufmann Jubilee Volume, ed. Haran, M., Jerusalem: Magnes Press-the Hebrew University, 2945. Ventris, M., and Chadwick, J. 1956, Documents in Mycenaean Greek, Cambridge: at the University Press. Yardeni, A. 2000, Textbook of Aramaic, Hebrew, and Nabataean Documentary Texts from the Judaean Desert, Jerusalem; Ben-Zion Dinur Center for Research in Jewish History, 2 vols. (Hebrew, with English appendix).

MILITÄRGRENZE UND EUPHRATHANDEL. DER SOZIO-ÖKONOMISCHE HINTERGRUND DER TRILINGUEN VON ARSLAN TASH Hannes D. Galter Die vorliegende Arbeit nimmt ihren Ausgang bei einer Bemerkung Wolfgang Rölligs, die er vor einigen Jahren im Kontext einer Bewertung der Textzeugnisse Syriens aus dem 1. Jahrtausend v. Chr. gemacht hat. Er meinte mit Bezug auf die zweisprachigen Inschriften des 9. und 8. Jahrhunderts: „Es überrascht natürlich nicht, dass ein aramäischer Fürst in seinem Territorium bzw. in seiner Residenz einen Text in aramäischer Sprache abfassen lässt, auch wenn er daneben noch das Assyrische verwendet. Ungewöhnlich ist es aber, wenn ein Assyrer zu einer assyrischen Bauinschrift noch eine aramäische Version und eine Kurzform in Hieroglyphenluwisch verfassen lässt.“1 Hierin kann man ihm nur beipflichten, denn die Torlöwen von Arslan Tash (Hadattu) sind in ihrer Art bisher einzigartig innerhalb des Textcorpus assyrischer Monumentalinschriften. Diese Erkenntnis wirft natürlich die Frage auf, warum Ninurta-bel-u½ur, der Gouverneur von Kar-Salmanassar, in einer Provinzstadt wie Hadattu, Inschriften in mehreren Sprachen und Schriften auf die Rückseite von Torlöwen meißeln ließ. Dieser Frage soll in der Folge nachgegangen werden.

Fig. 1: Lage von Arslan Tash, nach Thureau-Dangin et al. 1931

1

Röllig 2000, 182.

Hannes D. Galter

445

Die Torlöwen von Arslan Tash Da die Objekte noch nicht allgemein bekannt sind, sollen sie kurz vorgestellt werden. Das Dorf Arslan Tash liegt ca. 30 km östlich des Euphrat hart an der türkischen Grenze inmitten der fruchtbaren Sarudj-Ebene (Fig. 1). Es erhielt seinen Namen („Löwenstein“) von mehreren zerbrochenen Basaltlöwenfiguren, die verstreut an der Oberfläche des ovalen Ruinengeländes lagen. 1838 besuchte die Chesney-Expedition den Ort. Ihr verdanken wir die erste Beschreibung der Löwenfiguren. Am Ende des 19. Jahrhunderts ließ Hamdy Bey eine Reihe von Orthostatenreliefs nach Istanbul bringen2 und 1928 unternahm François ThureauDangin mit einem Team des Louvre zwei kurze Grabungen. Dabei konnte er Teile der Stadtmauer,3 assyrische Palastanlagen4 und Reste eines Ištartempels5 freilegen. Trotzdem blieb Arslan Tash – ebenso wie die Nachbartells Qara Hlendj und Tell Hadjib – größtenteils noch unerforscht, was wohl auch damit zusammenhängt, dass ein großer Teil des antiken Stadtgebietes von dem heutigen Dorf bedeckt ist. Die kreisförmige Stadtmauer bestand aus einem Lehmziegelmauerwerk auf Steinfundamenten und besaß drei Tore, von denen mindestens zwei Reliefschmuck aufwiesen. François Thureau-Dangin fand bei zwei Stadttoren, dem Osttor und dem Westtor, Überreste von Torlöwenfiguren aus Basalt. Obwohl das Osttor durch den darüber liegenden Friedhof einen sehr schlechten archäologischen Zustand aufwies,6 waren die Löwenfiguren fast vollständig erhalten. Der nach rechts schreitende Nordlöwe wurde aufrecht stehend und fast unversehrt angetroffen. Seit Anfang der 80er Jahre steht er im Hof des Archäologischen Museums von Aleppo (Fig.2).7

2 3 4 5 6 7

Unger 1925, 5-7; vgl. auch Unger 1928. Thureau-Dangin et al. 1931, 68-89. Thureau-Dangin et al. 1931, 16-54; Turner 1968. Thureau-Dangin et al. 1931, 54-68. Thureau-Dangin et al. 1931, 70-73. Vgl. Thureau-Dangin et al. 1931, Tf. VI. Die heutige Sockellänge beträgt 384 cm, die Sockelbreite 82 cm, die Sockelhöhe 50 cm, die Rückenhöhe 246 cm und die Kopfhöhe 260 cm. Ich möchte an dieser Stelle der syrischen Antikenverwaltung danken, dass sie es mir ermöglicht hat, die Löwenfiguren und -fragmente seit 1990 mehrmals zu untersuchen. Die vorliegende Arbeit basiert im Wesentlichen auf Ergebnissen von Forschungsaufenthalten an den Museen von Aleppo, Raqqa und Damaskus sowie in Arslan Tash selbst, die im Frühjahr 1990 stattfanden. Die Lesungen der Inschriften an den Torlöwen konnten in den Folgejahren mehrfach an den Originalen überprüft werden. Mein aufrichtiger Dank für ihre Hilfe und Unterstützung vor Ort gebührt dem damaligen Direktor der Antikenverwaltung Ali AbuAssaf, Direktor Wahid Khayata und Hammidu Hammade am Archäologischen Museum in Aleppo sowie Direktor Murhaf al-Khalaf und Muhammad Maqtasch am Museum in Raqqa.

446

Militärgrenze und Euphrathandel

Fig.2: Der Nordlöwe des Osttores, heute in Aleppo

Der nach links schreitende Südlöwe befindet sich heute mit moderner Kopf- und Schwanzpartie am Nordeingang des Stadtparks von Raqqa (Fig.3).8 Ein Fragment der oberen Kopfpartie im Museum in Aleppo gehört mit großer Wahrscheinlichkeit zu diesem Löwen.

Fig.3: Der Südlöwe des Osttores, heute in Raqqa

Das Westtor war weit besser erhalten.9 Hier hatten sich außer den Torlöwen auch noch zwei Reihen von Orthostatenreliefs erhalten. Der nach links schreitende 8 9

Vgl. Thureau-Dangin et al. 1931, Fig.22 und Tf. VI,1. Die Ausmaße entsprechen jenen des Löwen in Aleppo, allerdings erschwert die moderne Rekonstruktion des Vorderteils genaue Angaben. Thureau-Dangin et al. 1931, 76-89; Albenda 1988, 8-21.

Hannes D. Galter

447

Nordlöwe besteht heute nur mehr aus sieben bis acht Fragmenten (Fig.4), die am Boden der Grabung gefunden wurden.10 Zwei zusammengehörige Teile der Bauchpartie und ein Stück des linken Hinterbeines befinden sich im Museum von Raqqa; der Kopf, ein Stück der vorderen Schulterpartie, die Vorderbeine sowie ein Fragment der hinteren Rückenpartie im Museum von Aleppo. Schon in seinem Vortrag vor der Académie des Inscriptions et Belles-Lettres am 13. Juli 1927 hatte Thureau-Dangin darauf aufmerksam gemacht, dass diese Fragmente auf der Rückseite Inschriften in assyrischer und aramäischer Sprache aufweisen, die Duplikate sind und die, wie er meinte, wahrscheinlich aus der zweiten Hälfte des 8. vorchristlichen Jahrhunderts stammen.11 Ein Basaltfragment mit Spuren einer assyrischen und einer aramäischen Inschrift wurde von Thureau-Dangin 1927 bei den Grabungen am Westtor entdeckt, verschwand aber in der Folge.12 Es könnte zu diesem Löwen gehören.

Fig.4: Der Nordlöwe des Westtores, Rekonstruktion der Fragmente

10 Thureau-Dangin et al. 1931, 74-75. 11 Siehe Weidner 1927 und vgl. den Hinweis in Syria 8, 1927, 366-367. 12 Thureau-Dangin et al. 1931, 87, Nr.3.

448

Militärgrenze und Euphrathandel

Der hintere Teil des nach rechts schreitenden Südlöwen, von dem lediglich ein Teil des linken Hinterbeines angebrochen ist, steht heute mit modernem Kopf und moderner Vorderpartie ebenfalls am Nordeingang des Stadtparks von Raqqa (Fig.5).13

Fig.5: Der Südlöwe des Westtores, heute in Raqqa

Im Museum von Raqqa befinden sich weitere Teile der Figur: ein Fragment der Brustpartie sowie die Vorderbeine. Ein Stück der Schulterpartie wird im Museum von Aleppo aufbewahrt. Thureau-Dangin fand auch noch ein Fragment mit assyrischer Keilschrift, das er in Kopie vorlegte,14 das aber seither verschwunden ist. Da der Text ein Duplikat zur Inschrift des Nordlöwen vom Westtor darstellt, muss es zum Südlöwen gehören. Die Torlöwen wurden in ihren Vorderpartien als Rundskulptur, in ihren hinteren Teilen als Hochrelief ausgeführt. Obwohl sie sich stark an Vorbildern aus dem assyrischen Kernland orientieren,15 weisen sie – ähnlich wie die Orthostatenreliefs aus Arslan Tash – deutlich provinzielle Züge auf.16

13 Vgl. Thureau-Dangin et al. 1931, Tf. XIV,2. 14 Thureau-Dangin et al. 1931, 86 und Fig.28, Nr. 1. 15 Vgl. den Torlöwen vom Tempel der Šarrat nip¦i in Nimrud aus der Zeit Assurnasirpals II., Orthmann 1985, 296f. und Abb. 174. 16 Albenda 1988, 17-24.

Hannes D. Galter

449

Die Inschriften der Löwen Die ursprünglich der Mauer zugewandten Rückseiten der Löwen vom Osttor tragen je drei Inschriften. Sie wurden nur teilweise von Thureau-Dangin publiziert.17 Der Südlöwe in Raqqa z. B. (Fig. 6) weist zuoberst 9 Zeilen in Aramäisch, darunter links 9 Zeilen in Assyrisch und rechts daneben 4 Zeilen in Hieroglyphenluwisch auf.18 Sie sind so angebracht, dass – bedingt durch die Leserichtung – jede Inschrift den Beginn darzustellen scheint. Der Nordlöwe in Aleppo trägt auf der Wandseite Duplikate der drei Inschriften. Sie waren über Jahrhunderte der Witterung ausgesetzt und sind weit schlechter erhalten, als die des Parallelexemplars in Raqqa.

Fig.6: Die Inschriften auf dem Südlöwen des Osttores

Der assyrische Text berichtet darüber, dass Ninurta-bel-u½ur, der Statthalter von Kar-Salmanassar, die Mauer von Hadattu samt ihren Toren errichten und die Löwenfiguren in eben diesen Toren aufstellen ließ. Ein Fluch gegen jenen künftigen Fürsten, der die Inschrift zerstört, beschließt den Text. Der aramäische 17 Thureau-Dangin et al. 1931, 85-89. Wolfgang Röllig hatte bereits 1988 in seinem Vortrag „New Inscriptions from Hadattu – Assyrian and Aramaic“ auf der 35. R.A.I. in Philadelphia auf weitere Fragmente dieser Inschriften aufmerksam gemacht. Vgl. des weiteren Galter 1995, 41; Bunnens 1995, 23-24; Hawkins 2000, 246-248; Röllig 2000, 182-183. 18 Vgl. Hawkins 2000, Tf. 103-105.

450

Militärgrenze und Euphrathandel

Text ist weit schlechter erhalten und daher schwerer zu lesen, scheint aber eine wortwörtliche Übersetzung des Keilschrifttextes zu sein.19 Der hieroglyphenluwische Text, den David Hawkins bereits in seinem Corpus of Hieroglyphic Luwian Inscriptions publiziert hat,20 sieht wie eine selbständige Inschrift aus. In den ersten Zeilen wird über eine einjährige Bautätigkeit des Herrschers von Masuwari (= Til Barsip) in der Stadt Hatata berichtet. Dies stimmt mit dem Anfang des Keilschrifttextes überein.21 Leider ist der Name des Bauherrn – Murphys Gesetz der Assyriologie – abgebrochen. Auch die restlichen Zeilen sind sehr schlecht erhalten, sodass derzeit keine zusammenhängende Übersetzung möglich ist. Sie scheinen von einer göttlichen Gegenleistung oder von einem Fluch zu handeln. Die Löwen des Westtore weisen lediglich je zwei Inschriften auf: links eine assyrische und rechts daneben eine aramäische. Diese befassen sich mit demselben Thema, weichen aber in den Formulierungen zum Teil deutlich von dem Text des Osttores ab. So wird, wie es scheint, die Herkunft (URU É AD-a) Ninurta-belu½urs, äußerst ungewöhnlich, durch eine Aufzählung von Orten angeführt: „ºiranu bei Halahhu gegenüber von Lipapan“ (šá uru½i-ra-ni šá uru¦a-la¦-¦i šá pa-an urulipa-pa-an).22 Der Auftraggeber der Inschriften, Ninurta-bel-u½ur (mdMAŠ-UMUN-PAB/ ’nrtbl½r), bezeichnet sich als b l pa¦ te von Kar-Šulm nu-ašar!du und als Eunuch (ša r ši) des Turt nus Šamši-ilu.23 Er ist am Beginn des 8. Jahrhunderts v. Chr. anzusetzen (um 780 v. Chr.) und ist weder mit dem Eponym des Jahres 877 v.Chr. noch mit der in ADD 90 genannten Person aus dem Jahr 734 v.Chr. identisch. Die Namensform GN-b la-u½ur, „GN beschütze den Herrn“ scheint charakteristisch für Provinzbeamte der zweiten Ebene gewesen zu sein. Man vergleiche nur Aššur-bel-u½ur, einen Eunuchen des Nergal-ereš.24 Doch kehren wir zur eingangs gestellten Frage zurück, was denn nun der Hintergrund für diese einzigartigen Dokumente ist. Die Antwort darauf muss genauso komplex sein, wie die Inschriften selbst. Die multikulturelle und multilinguale Situation in Bit Adini, dem Gebiet um Til Barsip und Arslan Tash, verdankt ihre Entstehung einer Reihe von gesellschaftlichen, ökonomischen und politischen Faktoren,25 von denen ich zwei herausgreifen möchte: die 19 Vgl. Röllig 2000, 183, wo allerdings fälschlich der assyrische Text als über dem aramäischen befindlich beschrieben wird. 20 Hawkins 2000, 246-248 (III.10) und Tf. 103-105. 21 Vgl. Hawkins 2000, 247. 22 Vgl. Thureau-Dangin et al. 1931, 86 und Röllig 2000, 182-183. 23 Die von Lipi"ski 2000, 186 vertretene zeitliche Einordnung Ninurta-bel-u½urs in die Regierungszeit Šamši-Adads V. ist dementsprechend zu korrigieren. Zu ša r ši vgl. Deller 1999 und Grayson 1995. 24 RIMA 3, A.0.104.2008. Der dort angeführten Literatur sind Unger 1927, Abb. 47 und Galter 1990, 47, Fn. 11 hinzuzufügen. Aber auch in höheren Positionen ist diese Namensform zu finden, siehe Bel-Harran-bel-u½ur, RIMA 3, A.0.105.2. 25 Die Diskussion dieses Themas hält seit den 70er Jahren an: Ussishkin 1971; Hawkins 1983; Ikeda 1984; Bunnens 1995; Dalley 2000, 80f.; Sader 2000 sowie Klengel 2000, 27f.; vgl. auch Sader 1987, 47-98; Jasink 1995, 86-96; Lipi"ski 2000, 163-193.

Hannes D. Galter

451

Militärgrenze am Euphrat und den Fernhandel zwischen dem assyrischen Reich und der Mittelmeerküste. Die Militärgrenze am Euphrat Salmanassar III. eroberte Til Barsip im Jahr 865 v. Chr. nach mehrmonatiger Belagerung.26 Zuvor schon hatte er zahlreiche Orte des Landes Bit Adini beiderseits des Euphrats eingenommen, darunter Burmar’ina, Paqarahubunu, TilBašira, Pitru, Alligu, Nappigu und Rugulitu.27 Einige dieser Städte machte er zu „Königsstädten“ (!l!ni šarr"ti), d.h. er ließ Palastbauten errichten und Assyrer ansiedeln. Darüber hinaus erhielten sie neue assyrische Namen: Til Barsip wurde in K!r-Šulm!nu-ašar du, Pitru in Ana-Aššur-ut r-a½bat, Nappigu in L#ta-Aššur, Alligu in A½bat-l!-kunu und Rugulitu in Qib#t-Aššur umbenannt.28 Durch diese Behandlung wurden sie zu den von Roland Lamprichs angesprochenen Brückenköpfen in der Peripherie, die „mit dem Band der Interessensharmonie eng an die Zentralmacht gebunden“ waren.29 In Kar-Salmanassar selbst hielt Salmanassar Hof und empfing Tribute aus den Gebieten jenseits des Euphrats: ki-i ina URU kar-dšùl-ma-nu-MAŠ u½-ba-ku-ni ma-da-tú šá MAN.MEŠ-ni šá a-¦at tam-di ù MAN.MEŠ-ni šá a-¦at ÍD.A.RAD KÙ.BABBAR KÙ.GI AN.NA.MEŠ ZABAR ÚTUL.MEŠ ZABAR.MEŠ AN.BAR.MEŠ GU4.MEŠ UDU.MEŠ TÚG lu-búl-ti bir-me u TÚG.GADA.MEŠ am-¦ur „Während ich in Kar-Salmanassar residierte, empfing ich den Tribut der Könige der Meeresküste und der Könige der Euphratufer: Silber, Gold, Zinn, Bronze, bronzene und eiserne Gefäße, Rinder, Schafe, bunte Gewänder und Leinenkleider.“30 Nach dem literarischen Bericht über Salmanassars Urartufeldzug übergab der König – bevor er nach Urartu weiterzog – seinem Turtanu Aššur-bel-ka’’in die Kontrolle und Verantwortung über die Grenzgebiete am Euphrat: URU.HAL.ºU.MEŠ lu pa-aq-dan-nik-ka lu dan-nat E.NUN-ka lu-u KALAGan ri-kis-ka mu-¦ur bi-lat-su-nu „Die Festungen seien Dir überantwortet. Deine Wacht sei stark. Dein Bund sei mächtig. Empfange ihren Tribut!“31 Damit begründet Salmanassar III. eine Tradition, die über hundert Jahre anhielt. Erst die Eroberungen Tiglatpilesers III. im westlichen Syrien und seine Neuordnung des Provinzialsystems bereiteten ihr ein Ende.32 Unter Šamši-Adad V. bildete Kar-Salmanassar einen Knotenpunkt der EuphratGrenze Assyriens und Šamši-ilu nannte sie „Stadt meiner Herrschaft“ (!l b l"t#ja). 26 Yamada 1998 und 2000, 87-143; vgl. Ikeda 1979 und 1999, 271-281. 27 RIMA 3, A.0.102.2: i 34, 37f., ii 33. Zu Burmar’ina (= Tell Shiuk Fawqani 15 km nördlich von Tell Ahmar am Ostufer des Euphrats) vgl. Fales 1996. 28 RIMA 3, A.0.102.2: ii 34f.; vgl. Pongratz-Leisten 1997. 29 Lamprichs 1995, 384. 30 RIMA 3, A.0.102.2: ii 39f. 31 SAA 3, Nr. 17 (= STT 43): 11f. 32 Sowohl Dajjan-Aššur als auch Šamši-ilu übten die gleiche Funktion am Euphrat aus; zur Analyse der assyrischen Westpolitik vgl. Lamprichs 1995, 381-398; zur Neuordnung unter Tiglatpileser III. vgl. Weippert 1982.

452

Militärgrenze und Euphrathandel

Sie wurde zum Zentrum eines militärpolitischen Interaktionsnetzes beiderseits des Flusses und zu einem Eckstein assyrischer Imperialpolitik33. Assyrische Truppen griffen in Auseinandersetzungen syrischer Staaten jenseits des Euphrats ein und Šamši-ilu regelte Grenzverläufe zwischen diesen Staaten neu, wie die Stelen von Antakya und Pazarcõk zeigen.34 Er leitete Feldzüge bis nach Urartu und Damaskus35 und ernannte Statthalter wie Ninurta-bel-u½ur. Dies wurde in der Geschichtsforschung vergangener Jahre immer wieder als Überschreitung der Machtbefugnisse und als politische Abkoppelung von der assyrischen Zentralmacht interpretiert.36 Erst Stephanie Dalley hat vor kurzem Šamši-ilu von diesem Vorwurf befreit und seine Militärpolitik als imperiales Konzept in die Tradition der assyrischen Vizekönige (šar m!t ¤anigalbat) des 2. Jahrtausends gestellt37 Wahrscheinlich war er, wie schon Wolfram von Soden vermutete,38 auch ein Mitglied der Königsfamilie. In Kar-Salmanassar und auch in Hadattu trafen Güter aus unterschiedlichsten Regionen ein, sei es als Kriegsbeute, Geschenke, Tribute oder Abgaben. Die Orthostatenreliefs von Arslan Tash und Tell Hadjib geben Prozessionen von Tributbringern wider,39 und vielleicht handelt es sich bei einigen der in Arslan Tash gefundenen Elfenbeine um Teile jenes Damaszener Palastschatzes, den Šamši-ilu als Tribut von seinem Damaskusfeldzug mitbrachte.40 Die Militärgrenze mit ihrem regen politischen und administrativen Leben, ihren Klientels beiderseits des Euphrats und ihrem Waren- und Güterfluss, förderte einen Kulturaustausch und eine gegenseitige Beeinflussung, besonders im Bereich der jeweiligen Führungseliten. Österreichischen Historikern fallen hier natürlich sofort der römische Limes an der mittleren Donau und die Militärgrenze der Habsburgermonarchie gegen das osmanische Reich als Parallelbeispiele ein. Am Euphrat lässt sich der Kulturaustausch in fast allen Bereichen erkennen: assyrische Einflüsse prägten die Sprache, die Verwaltung, die Architektur, die Monumentalkunst, die Bauinschriften usw. Im Gegenzug wanderten aramäische Konzepte, Ideen und Motive bis in das assyrische Kernland, wie sich an zahlreichen Beispielen aus Wirtschaft, Verwaltung und Kunst belegen lässt.41

33 Vgl. Lamprichs 1995, 99; Klengel 1997; Ikeda 1999, 281-290. 34 Vgl. RIMA 3, A.0.104.2 und A.0.105.1. 35 Vgl. RIMA 3, A.0.2010, A.0.104.2011 und A.0.105.1. Ob ihm auch die in A.0.104.2012 beschriebene Gründung der Stadt Šarru-iddina zuzuschreiben ist, bleibt unsicher. 36 Vgl. von Soden 1985; Grayson 1993; 1994 und 1999; Jasink 1995, 169-173; Kah-Jin Kuan 1995, 107-134. 37 Dalley 2000, 81-84; vgl. Cancik-Kirschbaum 1999 sowie Harrak 1987,197-205 und Lemaire & Durand 1984, 40-47. 38 Von Soden 1985, 137f. 39 Siehe Unger 1925; Albenda 1988; Bär 1996, 189-194, 230f.. 40 Vgl. Winter 1981, 123. Drei zusammengehörige Fragmente (AO 11489) tragen eine aramäische Inschrift Hazaëls von Damaskus, Thureau-Dangin et al. 1931, 135 und Tf. XLVII (Nr. 112); vgl. dazu Eph#al & Naveh 1989. 41 Vgl. zu diesem Fragenkomplex Winter 1976; 1982 und 1983, 189; Tadmor 1982; Ponchia 1991, 56-59; Lamprichs 1995, 99; Bunnens 1996; Gerlach 2000; Herrmann 2000 und Dalley 2000, 85f.

Hannes D. Galter

453

Der Fernhandel zwischen Assyrien und der Mittelmeerküste Der zweite Faktor, den ich kurz streifen möchte, ist der des Fernhandels.42 Bit Adini war vor seiner Eroberung durch die Assyrer, wie andere nordsyrische Staaten auch, ökonomisch durch Landwirtschaft, Kunsthandwerk und durch Handelskontakte charakterisiert. Die Tribute, die es z. B. an Assurnasirpal II. abliefern musste und die auch importierte Rohstoffe bzw. Luxusgüter umfassten, zeigen das deutlich: ma-da-tu šá ma-¦u-ni DUMU a-di-ni KÙ.BABBAR,MEŠ KÙ.GI.MEŠ AN.NA.MEŠ ZABAR ÚTUL.MEŠ ZABAR GIŠ.BANŠUR ZÚ.MEŠ GIŠ.NÁ ZÚ.MEŠ GIŠ.NA5.MEŠ ZÚ.MEŠ GIŠ.AŠ.TI.MEŠ ZÚ.MEŠ KÙ.BABBAR KÙ.GI GAR.RA.MEŠ ¤AR.MEŠ KÙ.GI sa-’u-ri KÙ.GI šá tam-li-te ga-gi KÙ.GI GÍR KÙ.GI GU4.MEŠ UDU.MEŠ GEŠTIN.MEŠ mada-tu-šú am-¦ur „Den Tribut Ahunis von (Bit) Adini – Silber, Gold, Zinn, Bronze, bronzene Gefäße, einen Tisch aus Elfenbein, ein Bett aus Elfenbein, Truhen aus Elfenbein, Sessel aus Elfenbein mit Silber und Gold überzogen, goldene (Arm)reifen, goldene Ringe mit (Edelstein)besatz, goldene Halsketten, einen goldenen Dolch, Rinder, Schafe und Wein (waren) sein Tribut – empfing ich.“43 Nach 856 v. Chr. übernahm Assyrien die Kontrolle des Fernhandels. Dies wird durch die Wahl von Til Barsip als administratives Zentrum am Euphrat sichtbar. Die Stadt lag nur knapp 20 km stromabwärts von Karkemisch, der wichtigsten Handelsstadt der Region, und war somit bestens in der Lage, deren Aktivitäten zu überwachen und zu steuern.44 Die Umbenennung von Til Barsip in KarSalmanassar („Hafen Salmanassars“) unterstreicht die ökonomische Funktion der Stadt und weist gleichzeitig auf die politische Bedeutung derselben hin. Dies deckt sich mit der Erkenntnis, dass der Handel im assyrischen Reich größtenteils von privater Hand durchgeführt wurde, aber strenger staatlicher Kontrolle unterlag.45. Hadattu (aramäisch „die Neue“),46 ca. 30 km vom Euphrat entfernt, war Etappenstation auf der wichtigen Route nach Assyrien, die über Harran und Guzana bis nach Ninive und Kalhu führte.47 Der Ausbau der Stadtmauer von

42 Vgl. Elat 1991; Lamprichs 1995, 216-250 und für die mittelassyrische Zeit Faist 2001. 43 RIMA 2, A.0.101.1: iii 61f.; vgl. Winter 1983, 185-190. 44 Vgl. Lamprichs 1995, 108 und den Beitrag von Karen Radner im vorliegenden Band. Til Barsip und Karkemisch lagen beide an wichtigen Euphratübergängen und unterhielten als Herrschaftssitze anatolischer Fürstenfamilien in vorassyrischer Zeit enge Kontakte, vgl. Winter 1983. 45 Vgl. Elat 1987 und 1991, 23-29; Dalley 1996-97, 68f.; Faist 2001, 120-124. 46 Vgl. Lewy 1946, 423, Fn. 106; Lipi"ski 2000, 170. 47 Vgl. Faist 2001, 194-200.

454

Militärgrenze und Euphrathandel

Hadattu ist sicherlich im Zusammenhang mit der Sicherung dieser Route zu sehen. Leider haben die Grabungen in Tell Ahmar und Arslan Tash bisher keine Wirtschaftstexte der Zeit Šamši-ilus erbracht, sodass wir in diesem Fall auf Vermutungen angewiesen sind. Das deutlich spätere, aus dem 7. Jahrhundert v. Chr. (Sanherib – Assurbanipal) stammende Archiv aus Til Barsip wirft allerdings ein bezeichnendes Licht auf das Völkergemisch der Stadt. Die Handelskontakte reichten von Ägypten48 und Zypern49 bis in das assyrische Kernland50 und wahrscheinlich auch zum Mittleren Euphrat.51 Diese zum Schluss genannten Kontakte zum Mittleren Euphrat lassen sich auch schon für die vorassyrische Zeit belegen.52 Die Personennamen der Texte aus Til Barsip sind größtenteils assyrisch und aramäisch bzw. Mischformen aus beiden Sprachen. Einzelne in den Texten genannte Personen stammen aus Kleinasien,53 Hamat,54 und Samaria.55 Monumentalinschriften und Dreisprachigkeit Zum Schluss möchte ich noch einmal auf die Mehrsprachigkeit der Inschriften aus Arslan Tash zurückkommen. Ich habe versucht, einige Faktoren aufzuzeigen, die das multikulturelle Klima begünstigten, aus dem heraus diese Mehrsprachigkeit ihre Legitimität bezog. Doch das Beispiel der Königsstatue vom Tell Fekheriyeh hat gezeigt, dass die sprachliche Situation in den Westgebieten des assyrischen Reiches äußerst komplex war und auch durch gesellschaftliche Faktoren beeinflusst wurde.56 An den Höfen von Guzana oder Kar-Salmanassar waren assyrische Sprache und assyrische Kultur tonangebend. Die Schreiber standen in derselben intellektuellen Tradition wie jene der Hauptstadt. Außerhalb des Hofes jedoch nahm der Einfluss lokaler sprachlicher und kultureller Traditionen deutlich zu und schuf eine multikulturelle und multilinguale Gesellschaft,57 die sich auch auf die Genese von Monumentalinschriften 48 Dalley 1996-97, 79f. (T 12): 4. 49 Die australischen Grabungen im neuassyrischen Wohnbereich von Tell Ahmar haben neben assyrischer Keramik und Elfenbeinschnitzereien auch Scherben eines zypriotischen Gefäßes ans Tageslicht gebracht, vgl. Bunnens 1992, 5. 50 Dalley 1996-97, 90f. (T 22): 13’-15’. 51 Dalley 1996-97, 67f. 52 Ikeda 1984: 32. für mA Zeit vgl. Faist 2001, 128-138. 53 Dalley 1996-97, 82f. (T 13): 21 (Tabalaja). 54 Dalley 1996-97, 82f. (T 13): 18 (Hamataja). 55 Dalley 1996-97, 82f. (T 13): 25 (Samiraja), auch in dem aramäischen Dokument aus Tell Shiuk Fawqani könnte ein hebräischer Name angeführt sein, Fales 1996, 106 und 109. 56 Abou-Assaf, Bordreuil & Millard 1982, 67-79, Fales 1983, Galter 1995, 39-41. 57 In Til Barsip wurden aramäische Dokumente und ein Stempelsiegel mit hieroglyphenluwischer Legende gemeinsam mit dem assyrischen Archiv gefunden, vgl. Bordreuil & BriquelChatonnet 1996-97 sowie Bunnens 1992, 5 und Fig. 9. Vgl. dazu auch die zwölf Sprachen und vier Schriften – luwische Hieroglyphen, phönizische Buchstaben, assyrische Keilschrift und aramäische Buchstaben – die etwa zur gleichen Zeit in Karkemisch in Verwendung waren; Starke 1997.

Hannes D. Galter

455

auswirkte. Wenn wir die Torlöwen von Hadattu mit jenen vergleichen, die Šamšiilu in Kar-Salmanassar aufstellen ließ, bemerken wir deutliche Unterschiede. Während die Künstler in Kar Salmanassar – vielleicht durch die Nähe zu Karkemisch bedingt – viel stärker der syrischen Tradition verhaften blieben,58 kopierten jene von Hadattu den Stil des assyrischen Kernlandes. Auf der anderen Seite ist die Inschrift Šamši-ilus rein assyrisch und ohne aramäischen oder hieroglyphenluwischen Paralleltext demonstrativ an der Schauseite der Löwen angebracht.59 Die Inschriften aus Arslan Tash hingegen sind mehrsprachig und befinden sich auf der Rückseite der Figuren. Sie verzichten auf eine politische Machtdemonstration und sehen ihr Auditorium eher im Kreis zukünftiger Bauherren. Auch darin stehen sie den Bauinschriften des assyrischen Kernlandes näher. Wie ich an anderer Stelle zeigen konnte,60 markieren zwei- oder mehrsprachige Monumentalinschriften entweder den Beginn oder das Ende einer Periode intensiven Sprachkontaktes. In diesen kurzen Phasen des Übergangs hatte sich keine der Sprachen als Zeichen von Macht und Prestige durchgesetzt, was die Gestaltung mehrsprachiger Texte zuließ. Der Stil der Inschriften aus Arslan Tash ist ein weiterer Hinweis darauf, dass sich die aramäische Inschriftentradition am Beginn des 8. Jahrhunderts erst in der Entwicklung befand. Während der hieroglyphenluwische Text sich – z. B. bei der Wahl der Titulatur oder der Ortsbezeichnung – deutlich in die Nachfolge der Steleninschriften von Tell Ahmar stellt,61 ist der aramäische anscheinend wie auf der Statue des Hadad-yis#i vom Tell Fekherye eine Übertragung aus dem Assyrischen. Im vorliegenden Fall ist die Sache aber noch etwas komplizierter, da Ninurtabel-u½ur durch den Anbringungsort seiner Inschriften auf der Rückseite der Löwen deutlich zum Ausdruck bringt, dass die Texte für zukünftige Machthaber und Bauherren bestimmt waren. Unter diesem Aspekt erhält die Dreisprachigkeit der Texte eine neue Bedeutung. Dem Verfasser stand die unterschiedliche – anatolische, aramäische, assyrische – Herkunft der Machthaber in Masuwari/Til Barsip/Kar-Salmanassar immer noch deutlich vor Augen. Bis heute ist es Assyriologen nicht gelungen, aramäische und anatolische Herrschaftsperioden in vorassyrischer Zeit klar auseinander zu halten, und vielleicht ist das auch gar nicht möglich, da die Sprache einer Inschrift nicht unbedingt die Muttersprache des Auftraggebers sein musste und auch Personennamen dem sprachlichen Umfeld der Textgenese angepasst wurden.62 Ninurta-bel-u½ur, der Nichtassyrer mit dem assyrischen Beamtennamen, konnte nicht vorhersagen, wie zukünftige Machtverhältnisse aussehen würden, und wollte die Erhaltung seiner Monumentalfiguren und -inschriften nach allen Richtungen hin absichern. Nur 58 Siehe Thureau-Dangin et al. 1936, 141-142 und Roobaert 1990, 126-132; vgl. Winter 1983, 181-183. 59 RIMA 3, A.0.104.2010; vgl. Thureau-Dangin 1930 sowie Thureau-Dangin et al. 1936, 141151. 60 Galter 1995. 61 Vgl. Hawkins 2000, III.10 (ARSLAN TA$) mit III.1 (TELL AHMAR 2), III.2 (BOROWSKI 3) und III.6 (TELL AHMAR 1). 62 Vgl. Dalley 2000, 80.

456

Militärgrenze und Euphrathandel

eines hatte er nicht bedacht: dass seine Torlöwen über zweieinhalb Jahrtausende hinweg der Zeit trotzen und den Verfall seiner Stadt und seiner Kultur am Ort ihrer Aufstellung überdauern würden und dass seine Inschriften, vom Wetter – nicht von Menschen – angegriffen, den Wissenschaftern einer fernen, ihm völlig fremden Kultur größte Leseprobleme bereiten würden. Summary The remains of the stone lions that flanked the city-gates of Arslan-Tash / Hadattu carry inscriptions in cuneiform, hieroglypgic Luwian and Aramaic. They speak about the (re)construction of the city walls and can be dated to the early 8th century B.C. This rare occurrence of parallel texts in three languages and scripts is explained by the multilingual situation in Bit Adini before and after the Assyrian occupation. Two factors supported this multilingual society. The first factor was the military border at the Euphrates with its shifting alliencies, its tributes to be delivered and its treaties to be renewed. The second factor was the long distance trade between Assyria and the West, that brought people from various countries to the border cities at the Euphrates. These factors contributed strongly to a multicultural and multilingual society, in which there was no certainty, which party would hold the political power in the future. For that reason the Arslan Tash inscriptions were carved using three different writing systems.

Hannes D. Galter

457

Literatur Abou-Assaf, A., P. Bordreuil & A. R. Millard. 1982. La statue de Tell Fekherye et son inscription bilingue assyro-araméenne. erc Cahier 7. Paris. Albenda, P. 1988. “The Gateway and Portal Stone Reliefs from Arslan Tash”. BASOR 271, 5-30. Bär, J. 1996. Der assyrische Tribut und seine Darstellung. Eine Untersuchung zur imperialen Ideologie im neuassyrischen Reich. AOAT 243. Kevelaer – Neukirchen/Vluyn. Bordreuil, P. & F. Briquol-Chatonnet. 1996-97. “Aramaic Documents from Til Barsip”. Abr Nahrain 14, 100-107. Bunnens, G. 1992. “Melbourne University Excavations at Tell Ahmar on the Euphrates. Short Report on the 1989-1992 Seasons”. Akkadica 79-80, 1-13. Bunnens, G. 1995. “Hittites and Aramaeans at Till Barsip: A Reappraisal”. In Immigration and Emigration within the Ancient Near East. Fs Lipinski. Hg. K. van Lerberghe, A. Schoors. Leuven, 19-27. Bunnens, G. 1996. Syro-Anatolian Influence on Neo-Assyrian Town Planning. In Cultural Interaction in the Ancient Near East. Hg. G. Bunnens. Louvain, 113128. Cancik-Kirschbaum, E. 1999. „Nebenlinien des assyrischen Königshauses in der 2. Hälfte des 2. Jts. v. Chr.” AoF 26, 210-222. Dalley, S. 1996-97. “Neo-Assyrian Tablets from Til Barsip.” Abr Nahrain 34, 6699. Dalley, S. 2000. “Shamshi-ilu. Language and Power in the Western Assyrian Empire.” In Essays on Syria in the Iron Age. Ancient Near Eastern Studies Supplement 7. Hg. G. Bunnens. Louvain-Paris-Sterling, 79-88. Deller, K. 1999. “The Assyrian Eunuchs and their Predecessors.” In Priests and Officials in the Ancient Near East. Hg. K. Watanabe. Heidelberg, 303-311. Elat, M. 1987. „Der Tamk ru im neuassyrischen Reich.“ JESHO 30, 233-254. Elat, M. 1991. “Phoenician Overland Trade within the Mesopotamian Empires”. In Ah, Assyria … Fs Tadmor. Scripta Hierosolymitana 33. Hg. M. Cogan, I. Eph«al. Jerusalem, 21-35. Eph«al, I. & J. Naveh. 1989. “Hazael’s Booty Inscription.” IEJ 39, 192-200. Faist, B. I. 2001. Der Fernhandel des assyrischen Reiches zwischen dem 14. und 11. Jh. v. Chr. AOAT 265. Münster. Fales, F. M. 1983. “Le double bilinguisme de la statue de Tell Fekherye.” Syria 60, 233-250. Fales, F. M. 1996. “An Aramaic Tablet from Tell Shioukh Fawqani, Syria.” Semitica 46, 81-121. Galter, H. D. 1990. „Eine Inschrift des Gouverneurs Nergal-ereš in Yale.“ Iraq 52, 47f. Galter, H. D. 1995. „Cuneiform Bilingual Royal Inscriptions.“ IOS 15, 25-50. Gerlach, I. 2000. „Tradition, Adaption, Innovation. Zur Reliefkunst Nordsyriens/ Südostanatoliens in neuassyrischer Zeit.“ In Essays on Syria in the Iron Age.

458

Militärgrenze und Euphrathandel

Ancient Near Eastern Studies Supplement 7. Hg. G. Bunnens. Louvain-ParisSterling, 235-158. Grayson, A. K. 1993. “Assyrian Officials and Power in the Ninth and Eighth Centuries.” SAAB 7, 19-52. Grayson, A. K. 1994. “Studies in Neo-Assyrian History II: The Eighth Century B.C.” In Corolla Torontonensis, Fs. R. M. Smith. Hg. E. Robbins, S. Sandahl. Toronto, 73-84. Grayson, A. K. 1995. “Eunuchs in Power. Their Role in the Assyrian Bureaucracy.” In Vom Alten Orient zum Alten Testament, Fs von Soden. AOAT 240. Hg. M. Dietrich, O. Loretz. Kevelaer – Neukirchen/Vluyn, 85-98. Grayson, A. K. 1999. “The Struggle for Power in Assyria.” In Priests and Officials in the Ancient Near East. Hg. K. Watanabe. Heidelberg, 253-270. Harrak, A. 1987. Assyria and Hanigalbat. A Historical Reconstruction of Bilateral Relations from the Middle of the Fourteenth to the End of the Twelfth Centuries B. C. Texte und Studien zur Orientalistik 4. HildesheimZürich-New York. Hawkins, J. D. 1983. “The Hittite Name of Til Barsip. Evidence from a New Hieroglyphic Fragment from Tell Ahmar.” AnSt. 33, 131-136. Hawkins, J. D. 2000. Corpus of Hieroglyphic Luwian Inscriptions. Berlin-New York. Herrman, G. 2000. “Ivory carving of first millennium workshops, traditions and diffusion.” In Images as media. Sources for the cultural history of the Near East and the Eastern Mediterranean (1st millennium BCE) OBO 175. Hg. C. Uehlinger. Fribourg-Göttingen, 267-282. Ikeda, Y. 1979. “Royal Cities and Fortified Cities.” Iraq 41, 75-87. Ikeda, Y. 1984. “Hittites and Aramaeans in the Land of Bit-Adini.” In Monarchies and Socio-Religious traditions in the Ancient Near East. Hg. T. Mikasa. Wiesbaden, 27-36. Ikeda, Y. 1999. “Looking from Til Barsip on the Euphrates: Assyria and the West in Ninth and Eighth Centuries B.C.” In Priests and Officials in the Ancient Near East. Hg. K. Watanabe. Heidelberg, 271-302. Jasink, A. M. 1995. Gli stati neo-ittiti. Analisi delle fonti scritte e sintesi storica. Pavia. Kah-Jin Kuan, J. 1995. Neo-Assyrian Historical Inscriptions and Syria-Palestine. Hongkong. Klengel, H. 1997. “Beute, Tribut und Abgaben: Aspekte assyrischer Syrienpolitik.” In Assyrien im Wandel der Zeiten. HSAO 6. Hg. H. Waetzoldt, H. Hauptmann. Heidelberg, 71-76. Klengel, H. 2000. “The ‘Crisis Years’ and the New Political System in Early Iron Age Syria. Some Introductory Remarks.” In Essays on Syria in the Iron Age. Ancient Near Eastern Studies Supplement 7. Hg. G. Bunnens. Louvain-ParisSterling, 21-30. Lamprichs, R. 1995. Die Westexpansion des neuassyrischen Reiches: Eine Strukturanalyse. AOAT 239. Kevelaer–Neukirchen/Vluyn. Lemaire, A. & J.-M. Durand. 1984. Les inscriptions Araméennes de Sfiré et l’Assyrie de Shamshi-ilu. EPHE IV/II/20. Genève-Paris.

Hannes D. Galter

459

Lewy, J. 1946. “The Late Assyro-Babylonian Cult of the Moon and its Culmination at the Time of Nabonidus.” HUCA 19, 405-489. Lipi"ski, E. 2000. The Aramaeans: Their Ancient History, Culture, Religion. OLA 100. Leuven-Paris-Sterling. Orthmann, W. 1985. Der Alte Orient. Propyläen Kunstgeschichte 18. Berlin. Ponchia, S. 1991. L’Assiria e gli stati Transeufratici nella prima metà dell’VIII sec. a.C. HANES IV bis. Padova. Pongratz-Leisten, B. 1997. „Toponyme als Ausdruck assyrischen Herrschaftsanspruch.“ In Ana šadî Labn!ni l" allik. Fs Röllig. AOAT 247. Hg. B. Pongratz-Leisten et al. Kevelaer-Neukirchen/Vluyn, 325-343. Roobaert, A. 1990. “The City Gate Lions.” In Tell Ahmar 1988 Season. Abr Nahrain Supplement Series 2. Hg. G. Bunnens. Leuven, 126-135. Röllig, W. 2000. “Aramäer und Assyrer. Die Schriftzeugnisse bis zum Ende des Assyrerreiches.“ In Essays on Syria in the Iron Age Ancient Near Eastern Studies Supplement 7. Hg. G. Bunnens. Louvain-Paris-Sterling, 177-186. Sader, H. S. 1987. Les états Araméens de Syrie depuis leur fondation jusqu’à leur transformation en provinces Assyriennes. Beiruter Texte und Studien 36. Beirut. Sader, H. S. 2000. “The Aramaean Kingdoms of Syria: Origin and Formation Process.” In Essays on Syria in the Iron Age. Ancient Near Eastern Studies Supplement 7. Hg. G. Bunnens. Louvain-Paris-Sterling, 61-76. Starke, F. 1997. “Sprachen und Schriften in Karkamis.” In Ana šadî Labn!ni l" allik. Fs Röllig. AOAT 247. Hg. B. Pongratz-Leisten et al. KevelaerNeukirchen/Vluyn, 381-395. Tadmor, H. 1982. “The Aramaization of Assyria: Aspects of Western Impact.” In Mesopotamien und seine Nachbarn. Politische und wirtschaftliche Wechselbeziehungen im Alten Vorderasien vom 4. bis 1. Jahrtausend v. Chr. BBVO 1. Hg. H. J. Nissen, J. Renger. Berlin, 449-470. Thureau-Dangin, F. 1930. “L’inscription des lions de Til-Barsip.” RA 27, 11-21 Thureau-Dangin, François et al. 1931. Arslan Tash. Paris. Thureau-Dangin, François et al. 1936. Til-Barsip. Paris. Turner, G. 1968. “The Palace and Bâtiment aux Ivories at Arslan Tash: A Reappraisal.” Iraq 30, 62-68. Unger, E. 1925. Die Reliefs Tiglathpilesars III. aus Arslan Tasch. PKOM 7. Konstantinopel. Unger, E. 1927. Assyrische und Babylonische Kunst. Breslau. Unger, E. 1928. “Arslan Tasch.” RlA 1, 156. Ussishkin, D. 1971. “Was Bit-Adini a Neo-Hittite or Aramaean State?” Or. N.S. 40, 431-437. von Soden, W. 1985. „Das nordsyrische KTK/Kiski und der Turtan Šamš%-ilu. Erwägungen zu einem neuen Buch.” SEL 2, 133-141. Weidner, E. 1927. „Tell A¥mar und Arslan Tasch.“ AfO 4, 114. Weippert, M. 1982. Zur Syrienpolitik Tiglathpilesers III. In Mesopotamien und seine Nachbarn. Politische und wirtschaftliche Wechselbeziehungen im Alten Vorderasien vom 4. bis 1. Jahrtausend v. Chr. BBVO 1. Hg. H. J. Nissen, J. Renger. Berlin, 395-408.

460

Militärgrenze und Euphrathandel

Winter, I. J. 1976. “Phoenician and North Syrian ivory carving in historical context: questions of style and distribution.” Iraq 38, 1-22. Winter, I. J. 1981. “Is there a South Syrian style of ivory carving in the early first millennium BC?” Iraq 43, 101-130. Winter, I. J. 1982. “Art as Evidence for Interaction: Relations between the Assyrian Empire and North Syria.” In Mesopotamien und seine Nachbarn. Politische und wirtschaftliche Wechselbeziehungen im Alten Vorderasien vom 4. bis 1. Jahrtausend v. Chr. BBVO 1. Hg. H. J. Nissen, J. Renger. Berlin, 355-382. Winter, I. J. 1983. “Carchemish ša kišad Puratti.” AnSt. 33, 177-197. Yamada, S. 1998. “The Conquest of Til-barsip by Shalmaneser III: History and Historiography.” ASJ 20, 217-225. Yamada, S. 2000. The Construction of the Assyrian Empire. Culture and History of the Ancient Near East 3. Leiden.

ZUR ROLLE DER ALTMESOPOTAMISCHEN SCHULE BEI DER GESTALTUNG UND ÜBERREGIONALEN VERBREITUNG KULTURELLER ORIENTIERUNGSMUSTER Manfred Schretter Die wohl nachhaltigste Errungenschaft des Alten Mesopotamien ist die Erfindung der Schrift. So beginnt C. Wilcke sein Büchlein “Wer las und schrieb in Babylonien und Assyrien? Überlegungen zur Literalität im Alten Zweistromland” (Wilcke 2000, 3) mit der unbestreitbaren Feststellung: “Die Schrift durchdringt alle Bereiche unserer Kultur.” Mit der Schrift untrennbar verbunden ist die Institution Schule und deren curriculum; und wieder schreibt Wilcke (l.c.) “Denn Schulen prägen durch ihre Gestaltung des Lehrplans und die Auswahl der Pflichtlektüre die Gedankenwelt der Teilnehmer...” Und diese Prägung der Gedankenwelt, die im Alten Mesopotamien einer starken, vom Sumerischen dominierten Tradition verhaftet ist, soll im Folgenden mit dem zugegebenerweise etwas strapazierten, wörtlich genommen jedoch treffenden Begriff “kulturelles Orientierungsmuster” bezeichnet werden. Bei der altmesopotamischen Schule als kulturellem Orientierungsmuster denken wir in gut sumerozentrischer Weise zunächst an das bekannte, für die aB Zeit entworfene Bild, wie es sich hauptsächlich aus den Schulerzählungen, Streitgesprächen und Examenstexten darstellt (Volk 2000, Tinney 1999). Wir sehen uns zugleich mit der erstaunlichen Tatsache konfrontiert, daß dieses Muster auch an weit entfernten Orten in fremden Sprach- und Kulturkreisen offensichtlich willkommen war und genutzt wurde. Hier sehen wir eine Chance, die altmesopotamische Schule als kulturelles Orientierungsmuster in ihrer Wirkungsweise einigermaßen adäquat fassen zu können. Erstmals faßbar ist die Schule über die lexikalischen Listen in den archaischen Texten von Uruk. Lexikalische Listen dürfen gleichsam als Leitfossil für Schulen gelten. Nach den archaischen Listen aus Ur, wo das Sumerische als Landessprache gesichert ist, nähern wir uns aber mit den Zeugnissen für Schulen aus Fãrã und Ab³ ºalãbª¦‚ bereits der Peripherie des sumerischen Kernlandes (Südbabylonien) und haben diese dann mit Kiµ und Dschemdet Na½r bereits über-schritten (Steinkeller 1993, 117). Wir haben uns die Schulen der mesopotamischen Peripherie zum Thema gemacht und beginnen mit dem syrischen, nur ca. 100 km vom Mittelmeer entfernten Ebla. Trotz der weiten Entfernung (ca. 700 km nach Kiµ) sind die Gemeinsamkeiten mit Babylonien jedoch überraschend eng. Die Sprache stellte sich als ein eigenständiger früher akkadischer Dialekt heraus (Krebernik 1996, 249). Es wurde ein Diglossiemodell entworfen, wonach im ganzen syrisch-mesopotamischen Raum von Babylonien bis Ebla eine auf dem Babylonischen basierende Hochsprache verstanden wurde, neben der einzelne mehr oder weniger abweichende semitische Dialekte gesprochen wurden (Cooper 1999, 69 zitiert Michalowski 1987, 174). In den Quellen läßt sich eine südliche sumerische Tradition einer nördlichen syrischen gegenüberstellen und als Ort des direkten Kontakts mit Babylonien erweisen (Cooper 1999, 66 mit Verweis auf Steinkeller 1993). Nach

462

Manfred Schretter

Modellen jüngerer Zeit (Cooper 1999, 71 mit Verweis auf Michalowski 1990, 60) wurde in der ED IIIa-Zeit, also etwa 200 Jahre vor Ebla, die sumerische Keilschrift von einer Registriertechnologie zu einem Mittel sprachlichen Ausdrucks umgewandelt zu einer Zeit, als die Keilschrift zur Wiedergabe des Semitischen in Verwendung trat; in dieser Zeit wurden die ersten literarischen Texte in sumerischer Sprache niedergeschrieben, nach diesem Modell als Antwort auf die Möglichkeiten, die sich aus der Entwicklung der semitischen Schrift ergaben. In Ebla waren die Schreiber Eblaiter, die, wie einzelnen Kolophonen entnommen werden kann, Kontakte zu Mari und Kiµ unterhielten (Pettinato 1979a, 257ff.) und deren Austausch mit der etwa 100 Jahre alten Tradition von Fãrã und Ab³ ºalãbª¦‚ durch zahlreiche Paralleltexte erwiesen ist. Die schriftliche Bezeugung fällt im wesentlichen in die Regierung zweier Könige (Irkab-Damu und IµarDamu) über einen Zeitraum von ca. 40 Jahren (Archi,1997/1998, 108). Ihrem Inhalt nach umfassen die Texte aus Ebla, wie bekannt, in überwiegender Mehrheit Wirtschafts- und Verwaltungstexte und weiters Texte aus dem Bereich der Schule, nämlich lexikalische Listen und literarische Texte (Pettinato 1979b). Die lexikalischen Listen (Archi 1992) sind in Ebla in mehrschichtiger Weise vertreten, zunächst mit sumerischsprachigen Listen, die ganz in der Tradition von Uruk mit Parallelen in Dschemdet Na½r und Ur stehen. Daneben findet sich eine einsprachig sumerische Tradition des akrographischen Typs (éµ.bar.kinx-Listen), die Vorläufer in Ab³ ºalãbª¦, nicht jedoch in Fãrã hat (Archi 1992, 16), und die in aB Zeit als sagª-Tafel im Schulcurriculum bekannt ist. Über die aB Zeit hinaus ist diese Tradition nur in einer abweichenden Rezension (Sag B) aus dem Nordwesten (Emar?) in mB Zeit bekannt. Die sumerisch-eblaitische Liste scheint nach A. Archi (1992, 17 - 19) den Versuch darzustellen, das Sumerische in einer leicht zu erlernenden Weise zu organisieren und stellt dann eine eigenständige Auseinandersetzung der eblaitischen Schreiber mit der mesopotamischen Tradition dar. Die in den Schulen die lexikalische Tradition begleitenden literarischen Texte, z.T. als Schulübungen erkennbar, enthalten in Ebla epische, mythische, hymnische Texte, Beschwörungen und Briefe. Die epischen Texte umfassen drei Paralleltexte, die von G. Pettinato als “Gilgameµ und Aratta” bezeichnet wurden, zumindest aber den Sagenkreis um die Könige der Ersten Dynastie von Uruk zum Inhalt haben. Eine Parallele findet sich in Ab³ ºalãbª¦. Häufig versuchen die Schreiber, das Sumerische syllabisch zu schreiben (Pettinato 1979b, Nr. 2093, 2094; Edzard 1984, 33 - 40; Kienast 1988, 608 - 609). Mythische Texte sind im Dialekt von Ebla abgefaßt, Gottheiten und Unterschriften (zà.me) stehen jedoch ganz in sumerischer Tradition (Krecher 1992, 286). In diesem Zusammenhang sei an die Bemerkung von D.O.Edzard (1997, 165) erinnert, wonach das Faktum der sumerischen Tempelnamen einer der stärksten Hinweise auf die kulturelle Kraft des sumerischen Erbes im Alten Mesopotamien sei.

Altmesopotamische Schule

463

Sehr stark vertreten ist die Gattung der Beschwörungen (Krebernik 1984). Wie in Fãrã stehen die Beschwörungen (zum Folgenden vgl. Michalowski 1992, bes. 315 - 321) im Kontext von lexikalischen und literarischen Texten, Parallelen finden sich neben F r auch in Lagaµ (Tell al Hiba). Sie sind auf runden Tafeln geschrieben und zu einem großen Teil im eblaitischen Dialekt abgefaßt. In der späteren ED Zeit scheinen die Beschwörungen im Gegensatz zur aB Schule von Nippur einen Hauptbestandteil der literarischen Überlieferung gebildet zu haben. Zu den aB Beschwörungen gibt es wenige direkte Parallelen, dennoch weisen viele charakteristische Züge der späteren Überlieferung auf eine gleiche Tradition; bereits hier ist die von W. Farber (1989, 2) beobachtete Tendenz zur Integration fremdsprachiger Beschwörungsformeln zu spüren. Die Briefe (Kienast 1990, 64f.) sind im eblaitischen Dialekt abgefaßt, sie scheinen als Gattung eine nordmesopotamische Neuerung zu sein (Cooper 1999, 72 mit Verweis auf eine mündliche Mitteilung von K. Volk). Die Wirtschaftstexte folgen der sumerischen Tradition. Allerdings werden die verschiedenen Gesellschaftsstrukturen (theokratisches System gegenüber aristokratischer Oligarchie (Michalowski 1987, Milano 1995) in der Strukturierung und Führung des Systems deutlich. Im Zentrum der altmesopotamischen Schule als kulturellem Orientierungsmuster in Ebla stehen die lexikalischen Listen sowohl als Ort der Schrifterlernung wie der Auseinandersetzung mit einer traditionell damit verbundenen Weltsicht. Dies inkludiert die Auseinandersetzung mit dem Sumerischen, dem in Ebla kaum praktische Bedeutung im Sinn einer Verkehrssprache zukommt (Briefe z.B. werden semitisch abgefaßt), das aber integrierender Bestandteil überkommener Vorgaben ist, deren praktischer Zweck im Unterhalt eines tauglichen Verwaltungssystems liegt. Hervorzuheben ist der sehr kreative Umgang der eblaitischen Schreiber mit der von ihnen aus dem nordbabylonischen Bereich übernommenen Tradition. Nordöstlich von Ebla liegt Tell Beydar/ Nabada (Sallaberger 1998) mit einem wenig älteren Archiv. Die wenigen Reste von Schultexten lassen den Schluß zu, daß einheimische Schreiber am Ort ihres Wirkens ausgebildet wurden (Ismail 1996, 32). Die Schreibgewohnheiten in diesem Provinzarchiv zeigen unerwartete Nähe zu Adab, Isin und Nippur und stehen Mari näher als Ebla. Die Bezeugung von Mari ist überaus wichtig und reich; sie läßt es für die Frühzeit zu einem zentralen Punkt in I.J. Gelbs “Kish civilization” (Gelb 1992) und nachfolgenden Modellen werden. Die Briefe und Verwaltungsurkunden der aB Zeit füllen Bände. Es besteht kein Zweifel, daß Mari eine Schule besessen haben muß. Allerdings sind so gut wie keine lexikalischen oder literarischen Texte bislang gefunden worden. Ohne den Kontext festmachen zu können muß jedoch auf einen zweisprachig sumerisch-akkadischen Brief (Charpin 1992, Durand 1997, 103 - 110, Guichard 1997) an Zimri-Lim hingewiesen werden, den der Herausgeber Dominique Charpin unter dem Titel “Les malheurs d´un scribe ou de l´inutilité du Sumérien loin de Nippur” veröffentlicht hat. Der Schreiber bezeichnet sich als Einwohner von Mari, der Text gehört zur Gattung der sog. “letter prayers” und enthält Themen aus dem

464

Manfred Schretter

Bereich des “Leidenden Gerechten”. Die Vertrautheit mit der Hochburg der sumerisch geprägten altbabylonischen Schule, Nippur, ist in diesem Text unverkennbar. Wenden wir uns nun dem anatolischen Raum zu. In Kaniµ, der altassyrischen Handelskolonie, wo als Bezeichnung für die einheimischen vorhethitischen Anatolier die Bezeichnung nû’u “dumm, ungebildet” verwendet wird, ist eine Schule durch Schultexte (Hecker 1993), darunter Könisginschriften, Beschwörungen und besonders durch lexikalische Texte (¤¦), erwiesen (Beckman, 1983, 100). Für ¤attuµa hat bereits 1983 Gary Beckman eine grundlegende Studie vorgelegt. Im vorhethitischen kãrum ¤attuµa könnten einige Dokumente von einheimischen Anatoliern verfaßt worden sein, Anzeichen für die Existenz einer Schule gibt es nicht. Für die Schrift des hethitischen Alten Reiches wird die Übernahme aus einem nicht näher definierten syrischen Schreiberzentrum angenommen; sie ist der altakkadischen ähnlicher als der gleichzeitigen assyrischen oder babylonischen Schrift. Die bezeugte literarische Überlieferung dieser Zeit gehört Gattungen an wie königlichen Erlassen, Selbstberichten von Königen, Sammlungen von anekdotischen Erzählungen und legendarisch ausgestalteten Geschichten in der Tradition der Akkadherrscher, die in hethitischer wie in akkadischer Sprache abgefaßt wurden. G. Güterbock (1978, 217) fragt nach dem Zweck der Verwendung des Akkadischen in diesen Gattungen und bietet als Erklärung, daß das Akkadische für die hethitischen Schreiber zunächst das zusammen mit der Schrift übernommene und damit natürlich gegebene Mittel des schriftlichen Ausdrucks gewesen sei, und die Landschenkungsurkunden dieser Zeit zeigen eine starke Verwendung von Akkadogrammen. Sollte die Überlieferungslage nicht allzu sehr täuschen, vermissen wir weitgehend die sumerische Komponente und hätten dann ein gerade vom zeitlich naheliegenden aB curriculum der Schule von Nippur deutlich verschiedenes Muster. Ab dem Mittelhethitischen rechnet Beckman mit zwei Wegen, auf denen mesopotamische Kultur Zentralanatolien erreichte: den direkten Import aus Assyrien und Babylonien wie bestimmte Omina, Gebete, Rituale und Themen aus der Tradition der Akkad-Könige, und den Umweg über hurritische Vermittlung. Auch hier finden wir keine Hinweise auf ein wesentlich sumerisch beeinflußtes Muster. Im Junghethitischen dagegen findet sich wieder eine breite Palette lexikalischer Texte, hier erweitert um eine hethitische Spalte, zweisprachig sumerisch-akkadische und zweisprachig akkadisch-hethitische Texte der Gattungen Hymnen, Beschwörungen, Vorzeichenwissenschaft, medizinische Texte, Weisheitsliteratur. Für den Strang der hurritischen Vermittlung führt Beckman das Gilgamesch-Epos, den Kumarbizyklus, weitere Mythen und Epen sowie Orakel an. In Hattuµa scheint, anders als in Ugarit und Emar, das Hurritische in die Überlieferung von lexikalischen Listen und Hymnen nicht involviert gewesen zu sein. Hinweise auf einen regen Austausch von Fachleuten, auch Schreibern, mit Babylonien sind gut bezeugt, auch kommt das Problem der Dolmetscher zur Sprache. Es gab Schreiber, die das Akkadische nicht verstanden (Beckman 1983),

Altmesopotamische Schule

465

ausreichende Kenntnis des Sumerischen scheint allgemein eher selten gewesen zu sein. Aus allgemeinen Überlegungen, Schriftvergleich, Vergleich des Schulmaterials kommt Beckman zu dem bekannten wichtigen, auf K. Riemschneider zurückgehenden (Izre’el 1997, 10) Ergebnis, daß die Einführung der Keilschrift in Ägypten/Amarna über hethitische Vermittlung erfolgte. Die Schultafeln aus Amarna wurden von Shlomo Izre’el (1997) behandelt. Sie enthalten zwei akkadischsprachige Literaturwerke, nämlich Teile aus dem als µar tam¦ãri bekannten Epos (Sargon) und der Erzählung um den Jäger Keµµi, die offenbar direkt auf Hattuµa zurückgehen. Die lexikalischen Listen (tu-ta-ti, Sa, diri, eine Götterliste sowie ein ägyptisch-akkadisches Vokabular) zeigen enge Berührung zu dem von der hethitisch-akkadischen Schule beeinflußten syrischen curriculum insbesondere in Ugarit. Ein ganz anderes Muster zeigen die in Amarna gefundenen Fragmente von “Adapa und der Südwind”, “Nergal und Ereµkigal” und von einer Erzählung unklarer Zuordnung, die in ihrer äußeren Form, Schrift und Sprache auf das syrisch-mesopotamische Grenzgebiet als Herkunftsort weisen. Izre’el sieht darin wohl zurecht einen Hinweis darauf, daß sich ägyptische Schreiber mit mesopotamischem kulturellem Wissen bekanntmachen wollten. Der Ort der Schule war das Verwaltungszentrum - es sei aber daran erinnert, daß die in anderen Archiven bezeugten Verwaltungstexte hier fehlen - , die Schreiber waren Ägypter, vielleicht war Amarna auch Ausbildungszentrum für kanaanäische Schreiber. Als nächstes sei das äußerst reichhaltige und wichtige Archiv von Emar (Arnaud 1985/7) angesprochen, das ein reiches Inventar an lexikalischen Texten zutage förderte (Sa, Sa paläopgraphisch, Silbenvokabular A, Ea, Diri, ¤¦, Lu-µa, akrographische Listen, sog. “lexikographische” zweisprachige Listen, eine Götterliste, Schulübungen), weiters Omenliteratur, Beschwörungen, mesopotamische (z.T. sumerische) Rituale sowie zweisprachig sumerisch-akkadische literarische Texte im engeren Sinn (z.T. mit syllabischer Wiedergabe des Sumerischen) mit Parallelen in Ugarit sowie akkadische Texte (Gilgameµ, Palme und Tamariske). Im Gegensatz zu den Rechts- und Verwaltungsurkunden stehen diese Texte in spät-aB Tradition aus Mesopotamien. (Auch hethitische und ugaritische Texte wurden gefunden). Zum Schluß darf Ugarit an der Mittelmeerküste nicht fehlen (Soldt 1995; 2001b). Hier finden wir neben der (mesopotamischen) Keilschrift eine semitische Buchstabenschrift, die als Vorbild der äußeren Erscheinung zweifellos die Keilschrift hat. Diese Schrift wurde für den einheimischen nordwestsemitischen Dialekt verwendet, während die sumerisch-akkadischen aber auch hethitischen und hurritischen Texte in der gewohnten Keilschrift geschrieben wurden. Die Verwendung für das Ugaritische ist die Ausnahme. Auch hier wieder das gewohnte Bild: In Keilschrift liegen lexikalische Texte, literarische Texte (Weisheitsliteratur), Beschwörungen (sumerisch, akkadisch), Briefe, juridische und Wirtschaftstexte vor. Im äußeren Erscheinungsbild unterscheiden sich die Texte in ugaritischer Keilschrift davon nicht sonderlich: Schulübungen, literarische und religiöse Texte, Briefe, juridische und Wirtschaftstexte.

466

Manfred Schretter

Neben dem Palast finden sich Archive in verschiedenen Privathäusern, dort scheint auch die Ausbildung der Schreiber erfolgt zu sein. Diese tragen häufig ugaritische Namen, andere scheinen babylonischer und auch hurritischer Herkunft zu sein. Es gibt Zeugnisse dafür, daß derselbe Schreiber sowohl Buchstaben- wie Silbenschrift verwendete. Die Herkunft des Schulmaterials ähnelt dem in Ebla. M. Dietrich (1996) sieht in der Einführung der ugaritischen Form der Keilschrift einen politischen Akt. Für die Zeit vor 1350 (Beginn der keilschriftlichen Bezeugung) fordert er in Ugarit Schrift auf Papyrus. Im Zuge politischer Auseinandersetzungen kommt ‘Ammith-tamru I aus Nordwest-Arabien als König nach Ugarit, bringt seinen lokalen Dialekt mit und führt die keilschriftliche Tradition und damit die mB koin ein. Auf die bodenständige ugaritische Literatur sieht er trotz der äußeren Form keinen inhaltlichen Einfluß gegeben. Nach diesem flüchtigen Blick auf die Schulen der mesopotamischen Randgebiete soll nun eine ebenso flüchtige Bilanz folgen: * Die Grundstruktur der altmesopotamischen Schule als kulturellem Orientierungsmuster umfaßt (in ganz groben Zügen): 1. die zentralen Bedeutung der lexikalischen Listen (Listenwissenschaft), 2. die begleitende Aufnahme im Grunde nutzloser literarischer Texte in das Schulcurriculum, 3. das Sumerische als “Bezugssprache”; der Umgang damit ist in unterschiedlichem Maß intensiv, jedoch in jedem Fall gegeben , und schließlich 4. den eigentlichen Unterrichtszweck, der grundsätzlich in der Aneignung der Schrift als Mittel der Wirtschaftsverwaltung gelegen war, aber auch auf andere Bereiche wie Verträge, Briefe usw. und auf andere als nützlich erkannte Disziplinen (Beschwörungen, Omina, …) ausgedehnt werden konnte. * Die Grundlage derartiger kultureller Orientierungsmuster möchte ich im Phänomen einer allgemeinen menschlichen Beharrungstendenz sehen, für die K. Lorenz (1975, 306 - 310) instruktive Beispiele beigebracht hat und in deren Rahmen auch Kuhns Modell wissenschaftlicher Revolutionen (Kuhn 1976), wonach bewährte Muster erst nach größtem Widerstand aufgegeben werden, gesehen werden könnte. Die Keilschrift z.B. hat den Schritt zur Buchstabenschrift trotz größter Nähe nie getan. Das Muster wird als ganzes einschließlich des aktuell Nutzlosen übernommen. Dem widerspricht nicht die im Gesamtrahmen immer gegebene Auseinandersetzung und Weiterentwicklung. * Die Schule in den Randgebieten scheint ihrer vorwiegenden Positionierung in der öffentlichen Verwaltung und ihrer grundsätzlichen Ausrichtung nach Babylonien wegen nicht primärer Ort des Kulturtransfers nach Griechenland gewesen zu sein. * Ähnliche kulturelle Orientierungsmuster dürfen wir in Verbindung mit anderen Schriftsystemen erwarten, wie dem phönikischen, hebräischen, aramäischen oder griechischen.

Altmesopotamische Schule

467

Bibliographie Archi, A. 1992, Transmission of the Mesopotamian Lexical and Literary Texts from Ebla. In: Fronzaroli 1992, 1 - 29. Archi, A. 1997/98, Procedures in Publishing the Ebla Texts, AfO 44/45, 108 114. Arnaud, D. 1985/87, Recherches au pays d´ Aµtata-Emar VI. 4 Bde. Tome 1.2: Textes sumériens et akkadiens. Planches, tome 3: Textes sumériens et akkadiens. Texte, tome 4: Textes de la bibliothèque, transcriptions et traductions. Synthèse 18, 28. Paris. Beckman, G. 1983, Mesopotamians and Mesopotamian Learning at Hattuµa. JCS 35, 97-114. Charpin, D. 1992, Les malheurs d´un scribe de l´ inuntilité du Sumérien loin de Nippur. In: DeJoung Ellis 1992, 7 - 27. Charpin, D., Durand, J.-M. 1997, Florilegium Mariaqnum III: Recueil d´ études à la mémoire de Marie-Thérèse Barrelet.Memoires de NABU 4. Paris. Cohen, M.E., Snell, D.C., Weinberg D.B. 1993, The Tablet and the Scroll. Near Eastern Studies in Honor of William W. Hallo. Bethesda. Cooper, J.S., Schwartz, G.M. 1996, The Study of the Ancient Near East in the Twenty-First Century. The William Foxwell Albright Centennial Conference. Winnona Lake. Cooper, J.S. 1999, Sumerian and Semitic Writing in Most Ancient Syro-Mesopotamia. In: Lerberghe 1999, 61 - 77. DeJong Ellis, M. 1992, Nippur at the Centennial. Papers Read at the 35e Rencontre Assyriologique Internationale, Philadelphia,1988. Occasional Publications of the Samuel Noah Kramer Fund, 14. Philadelphia Dietrich, M., Loretz O. 1995, Ugarit. Ein ostmediterranes Kulturzentrum im Alten Orient. Ergebnisse und Perspektiven der Forschung. Band 1 Ugarit und seine altorientalische Umwelt. Münster. Dietrich, M. 1996, Aspects of the Babylonian Impact on Ugaritic Literature and Religion. In: Wyatt 1996, 33 - 47. Durand, J.-M. 1997, Les documents épistulaires du palais de Mari. Présentes et traduits par Jean-Marie Durand. Tome 1. Litteratures anciennes du Proche-Orient 16. Paris. Edzard, D.O. 1984, Hymnen, Beschwörungen und Verwandtes (aus dem Archiv L. 2769). Archivi reali di Ebla, testi V. Rom. Edzard, D. 1997, The Names of the Sumerian Temples. In: Finkel, I.L. 1997, 159 - 165. Farber, W. 1989, Schlaf Kindchen, schlaf! Mesopotamische Baby-Beschwörungen und -Rituale. Mesopotamian Civilizations, 2. Winnona Lake. Finkel, I.R., Geller, M.J. 1997, Sumerian Gods and Their Representations. Cuneiform Monographs, 7. Groningen. Fronzaroli, P., 1992, Literature and Literary Language at Ebla. Quaderni di Semitistica 18. Gelb, I.J. 1992, Mari and the Kish Civilization. In: Young 1992, 121 - 202.

468

Manfred Schretter

Gibson, McG., Biggs R.D. 1987, The Organization of Power. Aspects of Bureaucracy in the Ancient Near East. SAOC 46. Chicago. Guichard, M. 1997, Copie de la supplique bilingue suméro-akkadienne “Les malheurs d´un scribe”. In: Charpin 1997, 79 - 82. Gunter, A.C. 1990, Investigating Artistic Environments in the Ancient Near East. Washington. Güterbock, H.G. 1978, Hethitische Literatur. In: Röllig, W. 1978, 211 - 253. Hecker, K. 1993, Schultexte vom Kültepe. In: Mellink 1993, 281 - 291, Tf. 47 48. Ismail, F., Sallaberger, W., Talon, Ph., Van Lerberghe, K. 1996, Introduction to the Archive. [Tell Beydar / Nabada]. Subartu II, 31 - 32. Izre’el, Sh. 1997, The Amarna Scholary Tablets. Cuneiform Monographs, 9. Groningen. Kienast, B. 1988, Rez. zu Edzard 1984, BiOr 45, 605 - 613. Kienast B., Waetzoldt H. 1990, Zwölf Jahre Ebla: Versuch einer Bestandsaufnahme. Eblaitica 2, 31 -77. Krebernik, M. 1984, Die Beschwörungen aus Fara und Ebla. Untersuchungen zur ältesten keilschriftlichen Beschwörungsliteratur. Texte und Studien zur Orientalistik, 2. Hildesheim. Krebernik, M. 1996, The Linguistic Classification of Eblaite. Methods, Problems, and Results. In: Cooper 1996, 233 - 249 Krecher, J. 1992, UD.GAL.NUN Versus 'Normal' Sumerian: Two Literatures or One? In: Fronzaroli 1992, 285 - 303. Kuhn, Th.S. 1976, Die Struktur wissenschaftlicher Revolutionen. 2. revidierte und um das Postskriptum von 1969 ergänzte Aufl. Frankfurt am Main. Lerberghe, K. van,Voet G. 1999, Languages and Cultures in Contact. At the Crossroads of Civilizations in the Syro-Mesopotamian Realm. Proceedings of the 42th RAI. OLA 96. Leuven. Lorenz, K. 1975, Die Rückseite des Spiegels. Versuch einer Naturgeschichte menschlichen Erkennens. München, Zürich. Mellink, M.J. 1993, Aspects of Art and Iconography, Anatolia and Its Neighbors. Studies in Honor of Nimet Özgüç. Ankara. Michalowski, P. 1987, Charisma and Control: On Continuity and Change in Early Mesopotamian Bureaucratic Systems. In: Gibson 1987, 55 - 68. Michalowski, P. 1990, Early Mesopotamian Communicative Systems: Art, Literature, and Writing. In: Gunter 1990, 53 - 69. Michalowski, P. 1992, The Early Mesopotamian Incantation Tradition. In: Fronzaroli 1992, 305 - 326. Milano, L. 1995, Ebla: A Third-Millennium City-State in Ancient Syria. In: Sasson 1995 II, 1219 - 1230. Pettinato, G. 1979a, Ebla. Un impero inciso nell´ argilla. Mailand. Pettinato G., 1979b, Catalogo dei testi cuneiformi di Tell Mardikh. Materiali epigrafici di Ebla, 1. Neapel. Röllig, W. 1978, Altorientalische Literaturen. Neues Handbuch der Literaturwissenschaft, 1. Wiesbaden.

Altmesopotamische Schule

469

Sallaberger, W. 1998, Der antike Name von Tell Beydar: Nabada (Na-ba4da(ki)/Na-ba-ti-um(ki)), NABU 1998/130. Sasson, J.M 1995, Civilizations of the Ancient Near East, 4 Bände, New York. Soldt, W.H. van 1995, Babylonian Lexical, Religious and Literary Texts and Scibal Education at Ugarit and its Implication for the Alphabetic Literary Texts. In: Dietrich 1995, 171 - 212. Soldt, W.H. van 2001a, Veenhof Anniversary Volume. Studies presented to Klaas R. Veenhof on the occasion of his sixty-fifth birthday. Leiden. Soldt, W.H. van 2001b, Na¦iµ-´almu, an Assyrian Scribe Working in the “Sourthern Palace” at Ugarit. In: Soldt 2001a, 429 - 444. Steinkeller, P. 1993, Observations on the Sumerian Personal Names in Ebla Sources and on the Onomasticon of Mari and Kish. In: Cohen 1993, 236 245. Tinney, St. 1999, On the Curricular Setting of Sumerian Literature. Iraq 61,159 172. Volk, K. 2000, Edubba’a und Edubba’a-Literatur: Rätsel und Lösungen. ZA 90, 1 - 30 Wilcke, C. 2000, Wer las und schrieb in Babylonien und Assyrien? Überlegungen zur Literalität im Alten Zweistromland. München. Wyatt, N. 1996, Ugarit, Religion and Culture: Proceedings of the International Colloquium on Ugarit, Religion and Culture - Edinburgh, July 1994. Essays Presented in Honour of Prof. John C. L. Gibson. Ugaritisch-biblische Literatur, 12. Münster Young, G.D. 1992, Mari in Retrospect. Fifty Years of Mari and Mari Studies. Winona Lake.

ASTRONOMICAL REFLEXES IN ANCIENT COINS Salvo De Meis Representations of dateable astronomical subjects are not very frequent in coins, however those which can be found are of considerable interest. First, because of their rarity, then for the related aspects which range from history, philology, dating, and, not least, aesthetics. It is known that early coins were first minted on one side only (rectum, obverse), and short legends or decorative images (kings, gods, city symbols) were included; afterwards the other side too (versum, reverse) was decorated, and then, instead of the quadratum incusum1, other images appeared, such as auxiliary ones or marks. The main purpose of coins was commercial exchange, the preferred payment for soldiers or mercenaries, or goods and commodities. The so–called gold Dar[e]iko/j (fig.1) with the image of Dareios in kneeling schema, with bow and arrow, was quite often a corruption means, sometimes with better results than the army itself.2 In classical Antiquity, the first form of money appeared in Greece, around 630 B.C., near Pheidon of Argos, and the oldest gold and silver3 coins are attributed by Herodotus [1, 94,1]4 to the Lydians (who claimed to be the inventors and first users); mention of this is in a fragment of Xenophanes5, taken as good by Herodotus. Anyway one of the coins type was the si/gloj, what shows a Mesopotamian derivation (akkadian šiklu). The first coins were minted in Aigina, then Corinth and Athens, while Sparta started only in the 3rd century B.C. In the obverse were represented also private people or the town symbols, such as the bee of Ephesos or the lion of Lydia, while the coins for soldiers had kings’ heads. Legends such as town names, mint symbols or even year and month are of later use, and include figures such as beasts, winged horses, corn ears (for Demeter), apples (me/loj) for the city of Melos, the head of Pallas for Athens. This raises the question whether actually there were coins with astronomy related symbols, or if the heads of Zeus, Athena or Nike were just those of the protecting gods, not the images of stars and planets, and then the eagle of the Ptolemaioi must not be confused with the constellation Aquila.

1

2 3 4 5

It is the trace of the square punch which was put underneath the metal to be coined, to keep it still. It was formed by four parts crossed by two perpendicular grooves. Later the form evolved into more elaborated shapes, such as divisions in triangles. See Roaf 1992, 202. Also Head, Historia Numorum2, 825; R. N. Frye, personal communication. Very early coins were made of elektron, an alloy which contained other metal besides gold. Ludoiì gaìr kaiì prw=toi a)nqrw/pon h(mei=j iÓdmen, no/miwsma xrousou= kaiì a£rgurou= koya/menoi e/xrh/santo.

Diels 1903, Frg. 4, Pythagoras, Xenophanes, 4, 47.

Salvo De Meis

471

Similarly, the Dioscuri of the second century are not to be regarded as representations of the zodiacal sign; they were also represented in bigae or quadrigae, and Sol, Hercules, Jupiter were the gods, not the astronomical subjects. In Seleucid, Partian, Bactrian coins one finds images of kings, such as that of Seleucus I Nikator, which had so much importance for the Seleucid Era, mostly used in Babylonian astronomy. Seleucus is represented in a tetradrachm6, with a leather helmet, bull’s horn and ear; the reverse shows a Nike crowning a panoplia and with the legend BASILEWS SELEUKOU and a monogram. (fig. 2) The figure of king with lion head is also in coins of Alexander the Great, such as in a tetradrachm7 (in the Berlin Museum) minted after the king’s death. Mints were not always local, and for example coins were imitated in Gallia or Britannia, such as at Massalia8, the gold stater of Philip II (fig. 3); this is another aspect of the studies of ancient coins, which give information concerning not only commercial, but historical, military, economical themes as well. The diffusion of coins generated of course falsifications already in early times, and laws were made against it, such as in Rome the Lex Cornelia testamentaria nummaria9, which punished slaves with death and free people with exile; and after Constantine’s time falsification of coins was considered as falsification of kings. Other laws, such as the Aternia et Tarpeia (454 B.C.) and Menenia et Sestia (451 B.C.)10 stated the values of metal as exchange value, to 6 7 8

Baumeister 1887, No. 1107. Baumeister 1887, No. 1095. Massalia, now Marseilles, was founded by the Greeks around 600 B.C. as Massali/a. It seems that the copying of these staters was made due to their vast circulation, or after the Roman preys at Kynoskephale (197 B.C.) and Pydna 168 B.C.); the typical Celtic stylization transformed slowly the heads into other forms, horses into sticks-and-globes, in a sort of abstract art. Even in this situation there have been tentatives of seeing astronomical events in representations which are not only almost undecipherable, but without any sort of documentation, seeing comets and novae everywhere. The horse, even stylized as a large eye, has been understood as a sign of observation, but no historical evidence has been given to support such alleged dating. The horse remains the main motif of these coins. The evolution of the original stater to the Celtic one is clear from the figure 3, which, for example, shows how the legend FILIPPOU degenerated into various decorative motifs, presumably also because the Celtic artisans did not understand what they were copying or wanted to show their interpretation. A coin with the legend CN.CORNEL.L.E (“Münzmeister”, triumvir monetalis, in –86, Kl. Pauly 1311,n.47) has been erroneously interpreted as celebrating the solar eclipse of –119 November 11, “proof “ of the Roman victory on the Gauls. Besides the time error, there is no document for this eclipse, which anyway was barely visible due to the low magnitude at Rome and Gallia (about 0.65) if not predicted (very difficult then) or because of clouds, in which case no “proof” could be claimed. (as L. Zimmermann, claims in Sky & Telescope, March 1995, 28-29. The author even invents a comet for the year –16, as the one inspiring Augustus to celebrate Caesar’s comet of –43). 9 Ulp. Dig. 48, 10, 9. An example [Babelon 1885, 148] is the legend: M.SANQVINIVS Q.F. III VIR. A.A.A.F.F.S.C., meaning Marcus Sanquinius Quinti Filius, triumvir, aere, argento, auro, fiando, feriundo, Senatus consulto, stating the authority of this triumvir monetalis. 10 Cic. De Rep. II, 60 quotes that “quarto circiter et quinquagesimo anno post primos consules [i.e. 454 B.C.] de multa et sacramento, Spurius Tarpeius et A. Aternius consules comitiis

472

Astronomical Reflexes

replace the use of animals for commerce. And the penalties for non observation of the laws were quite severe. To remain within the subject of truly astronomical representations, one must anyway consider the mythological aspects which were transferred to stars and planets, already since Babylonian times, when the stars were gods. Such is the case of many coins, until we find that some astronomical event actually occurred and was celebrated; the danger is that some modern writer distorts the interpretation by seeing in the minted figures astronomical meanings, which are fully a product of his imagination, instead. This is a real danger for the studies, because it is a poisoning of information for the beginners or for non specialized people, and a cause of irritation for the serious scholar, and although it is not a novelty, still it is a sign of lack of honest study, which spreads in many publications, even in some astronomical journals. To have an astronomical meaning a coin must have a clear reference to a documented event, so that historical and philological data can support the identification, or that the event has been recalculated beyond doubts or it is historically known. This explains their rarity. One of the most important examples is the silver denarius (fig. 4) struck during Augustus time11; the obverse shows the laureate head of the emperor with the legend CAESAR AVGVSTVS, while the reverse has a star with eight rays, one of them showing a sort of plume, an allusion to a comet tail, and the legend DIVVS IVLIVS. Another coin has the legend IVLIVS CAESAR, and has the head of Caesar, laureate and with a comet above. These denarii celebrate the comet which appeared in 44 B.C., and which Augustus12 with a clear sense of politics accepted that it was the soul of Julius Caesar, also taking it as a favourable omen, contrary to the common belief on these celestial bodies. He moreover put a crown on the statue of Caesar, as it can be seen in an aureus issued by the emperor13 and in a denarius of L.Lentulus14. Plinius [NH, 2,23] writes that the emperor dedicated a temple to the comet that was seen during the ludi, the games he ordered to celebrate Venus genetrix; in fact other coins have a temple, such as we see in the aureus of 36 B.C. where a star is shown on the temple pediment, or that with a Salic priest (one of those dancing at the games) with stola, caduceus and round shield, and the legend AVGVST. DIVI F. LVDOS SAEC.15, a clear dedication of the ludi saeculares.16

11 12

13 14 15

centuriatis tulerunt” and continues on the value of animals for interchange; Aul. Gel., XI, 1, 2. Babelon 1885, II, 84, nn. 261-264, dates it at the first year of Augustus’ empire, 17 B.C. Commentarii de vita sua, fr. VI, also quoted by Plin. NH 2, 94. Ipsis ludorum meorum diebus sidus crinitum per septem dies in regione caeli sub septemtrionibus est conspectum. Id oriebatur circa undecimam horam diei clarumque et omnibus e terris conspicuum fuit. Eo sidere significari vulgus credidit Caesaris animam inter deorum immortalium numina receptam, quo nomine id insigne simulacro capitis eius, quod mox in foro consecravimus, adiectum est. Babelon 1886, II, 417-8. Issued in 12 B.C., see Zanker 1990, fig. 25. Babelon 1886, II, 416-8. See also Zanker 1990, fig. 26.

Salvo De Meis

473

Cassius Dio [45, 7, 1] quotes the appearance of the comet as an astral apotheosis. Other quotations are in Suetonius [Caesar, 88, 2; Aug. 10,2], Seneca [NQ, 7, 17, 2], Plutarch [Caesar, 69, 3], etc. Among the first ones to attempt locate the comet in the sky was Halley, who believed that the comet of 1680 was a return of it17, and further was Lubienetzki 1681 [tab. 63, n. XLVI]18, but Riccioli19 already had given a better dating, 44 B.C. Even if the literary texts do not give precise astronomical information, I recalculated in 1990 the comet’s orbital elements, and its position as seen from Rome can be derived from them, confirming the historical data of the observation mentioned by Augustus in July, not in September as it was assumed before20. Moreover, Chinese and Korean records21 have independent mentions which are quite consistent with the observation of this comet; they were made during the fifth year of the reign of Chhu-Yuan22; fig. 5 shows the path of the comet in the sky, in a map with modern limits and Chinese constellations in the background in an updated orbit23. D.K. Yeomans of JPL, the leading cometary expert who studied this comet deeply [Yeomans 1991, 13, 367], confirmed me that he agreed that the Roman and Chinese observations concerned one and the same comet.24 Another path is based on a different orbit [Kronk 1999, 22-23], but mine is higher in celestial latitude, thus corresponding better to Augustus’ words (fig. 6). Such difference can be explained by the few data available, hence the incertitude in the orbital elements. Another question is the luminosity of the comet; a burst has been proposed, but this is not necessary, as we do not know exactly the magnitude from the observations. The appearance in Rome might have been in the undecima hora, as quoted by Augustus in his Commentarii de vita sua, that is about 17 to 18 hours, Local Time, in regione coeli sub septemtrionem. But while this conclusion meets the requirements of convergence of historical, philological and astronomical data derived from the coin, there are other cases full of absurd attributions and even alleged “historical” and astrological conclusions, which must be dismissed.

16 These were held in 17 B.C., confirmed by Censorinus, de die natali [17,11], but their sequence was not always 100 years; Censorinus [17, 10 sqq.] gives many dates, while in 17,7 he states that the measure of the Roman saeculum is left to incertitude; cf. too RE, s.v. Saeculum. 17 Halley 1715, II, 881-905. 18 Lubienetzki 1681. Often without astronomical support for ancient comets, however. 19 Riccioli 1651, Lib. VIII, Cap. III, 5. 20 For example, in the otherwise useful Pingré 1783, 277-278, followed by many others. 21 Ho Peng Yoke 1962, 127-225; the comet's records are at number 59 of the catalog. 22 King from 49 BC to 33; his dynastic name was Yuan Di, Chhu-Yuan is the “nian hao”, the augural name until 43 BC. 23 For the sky map I used that of Ho, to which I superimposed the path of the comet. 24 Letter of 1991 May 30.

474

Astronomical Reflexes

A simple one is the mention of a solar eclipse at Caesar’s death25, but it can be calculated with precise astronomical methods that no eclipse was visible in the known world in –4326, and that from –50 to –40 four small eclipses occurred in Rome, the last on –47 Jan 4, but of magnitude 0.199, almost invisible if not predicted, hence the search is hopeless. Other examples are typical of wrong identification from coin images. One concerns a coin of Antioch, which has been misused even to date the birth of Christ27. It is a bronze of a Quadratus (fig. 7). The obverse shows a Tyche, that is Tu/xh kthtikh¢ or a£ciwmatikh,@ that is the fortune of acquiring, or of honors. The reverse shows a ram with its head turned back, a crescent and five dots. The legend is : ANTIOXEWN EPI KOUADRATOU ET ER. Now, the legends of other coins from Antiochia have names of legati, such as SESTIOU, MOUKIANOU, and C. Ummidius Durmius Quadratus was legatus to Syria. The mark ET ER means ETOUS ER, that is year 105, corresponding to 58/59 A.D., counting from the Caesarian Era28. According to M. Molnar29, the ram “is looking at a crescent Moon and a star”. This induces him to state that it represents the lunar occultation of Venus of April 27, 51 A.D. and that the ram is looking at the Moon because of the exceptional event. Such conclusions are completely wrong, because: - The ram is Aries, traditionally represented with its head backwards, according to Manilius [Astronomicon, IV, 506] “cervice prior flexa quam cornibus ibit” and [ibid. I, 284] “respicit admirans adversum surgere Taurum”, and other authors have similar statements. Hence there is to wonder at statements concerning the animal looking at something else, unless more specifically proven by the three criteria mentioned. - There is no good reason to state that “the star” on the coin is Venus or another planet, and, moreover, one asks why to celebrate seven years later an event which, in the case of the Venus occultation, was unobservable and undocumented. In fact the occultation quoted occurred in the region during daytime, and with the Moon’s illumination of 0.06 only, that is a very thin crescent, only 19° high, the ingress occurring at the illuminated side. Hence the occultation was not visible, and moreover in the year +51 it is most likely that it could not 25 Vergil, Georg. 1, 466-9, and Servius ad loc.; Plin., NH 2, 98 mentions prodigiosi et longiores solis defectus, etc. Servius writes of an eight-hour defectus, an impossible eclipse. 26 The annular eclipse of –43 April 18 was visible in South America and Antarctica, the total one of October 12 was visible from Kamchatka to North America. 27 It should be clear that at present such dating is impossible, as the sources are very vague and documents non existing, and that the “star” has just a religious meaning and that the word of the Evangelist is a)ste/r, which may be a nova, a comet, or otherwise. 28 Bickerman 1968, p. 73 and n. 60, indicates that the Era of Caesar (or Pharsalus) begun on 48 B.C. in June. 29 The Coins of Antioch, Sky and Telescope, Jan. 1992, 37-39.

Salvo De Meis

-

-

-

475

have been calculated in advance to allow for preparation of observations or anyway for a prediction. It can be seen on the contrary that five dots are represented, and, if any, the Pleiades could be taken into account, also due to the form in which the “stars” are displayed. For example in the Aratus Codex Vossianus30, the Pleiades are in a circled disposition around a centered figure, as in the coin. In the year +56 several lunar occultations (or close approaches) of the Pleiades were visible from Antiochia, on March 9, April 5, June 26, August 20, November 9, all at the border Aries-Taurus, and this might be a reason for a celebrating coin, although historical data are wanted for a reliable dating. A very similar coin was issued by Antoninus Pius in a set of zodiacal signs (fig.8), see below, without any reference to observed phenomena; also the other signs have stars: phenomena here too? It is enough to look at F.H. Cramer’s work31, where 9 pages of coins with crescent (and crescent with stars) are listed, or to an Etruscan coin with crescent and 9 stars32, to exclude – without need of historical proof – astronomical events; or to browse through the many illustrations of the classical handbooks of numismatics33 which represent images that somebody, without any solid reason, could wrongly associate to astronomical phenomena.

Hence, caution must lead research, and Molnar’s dating is to be rejected, with his conclusions.34 Similarly, in the falsification of the gold stater of Philip II, in Gaul a progressive stylization occurred35, however somebody, without historical and philological support has even claimed that the obverse represents the Sun, the Moon and a hypothetical comet, of which even a dating is proposed without proof! Incidentally, Molnar seems to specialize in proposing almost non observable phenomena, such as a conjunction Mercury-Jupiter in +106. This occurred on August 13 at 8:24 UT, hence in daytime and moreover at only 9° of elongation from the Sun, hence not visible. However Molnar uses it to date a coin of Traianus36, which has two heads (claimed, without reason to represent Mercury and Jupiter) and a star in the obverse. Besides the invisibility of the planets, what the star means is not revealed by Molnar. The type is however the same of other coins with the legend NERVA ET TRAIANVS.37 Moreover the coin is a restitutio of a former one, as the legend states: IMP. CAES.TRAIANVS.AVG.CC-IDAC PP.REST, hence again the dating is wrong. The complete name of the emperor Fol. 42v. Cramer 1954, 31-39. EI XIV (1951), 536 Tav. C. Babelon, Cohen, Mac Donald, Mattingly, Belloni, for example, quoted infra. Not to speak of other similar “datings” concerning the birth of Christ. See EI XVI (1950) 311 s.v. Gallia ; EUA III (1971) 270 s.v. Celtiche, correnti; Olmsted 2001, plates 63-70. 36 Mercury, Jan-Feb 1995, 26, fig. 8. 37 Gnecchi 1907, 105. 30 31 32 33 34 35

476

Astronomical Reflexes

was Marcus Ulpius Nerva Traianus Crinitus, anyway, as the young consul was adopted by emperor Nerva on 27 October 97 in the occasion of the revolt of praetorians, and named co-regent as well.38 Also Plinius in his Panegiric of Traianus refers about the deification of Nerva by his adoptive son.39 Evidently Molnar is particularly unlucky with astronomical phenomena and Roman politics, and we wonder what he could derive from the Thracian coin in the British Museum, which has a crescent and nine stars above plus two below40. Even, there was no quintuple planetary grouping during the period of Nerva and Traianus41. A type of coins has the figure in the reverse, being a negative silhouette of that one in the obverse, resulting from a coin put underneath the metal while minting or from a simplified sketch of the obverse. One is from Poseidonia42, as the legend POS shows; similar images, say bulls, in both figure-and-silhouette forms are from Sybaris. In this case the god is Neptune, the god of the town, shown with his trident. A tetradrachm from Samos with the legend LOXITHS and the mark 43 SA(mi/wn) has a protome of bull , as in the common representations of Taurus, and it might be “the warriors of Samos”. (fig.9) Another from Gela (GELAS)44 has also a protome of bull with human bearded face. This is no recollection of the Mesopotamian anthropomorphic bulls, but the personification of the river god Acheloos, which is a mixture of the myth according to which Herakles broke the horns of Acheloos and another legend which names “Acheloos” every underground water. Such myths expanded both in Magna Graecia and in Athens.45 An interesting set of coins (actually medals) with astronomical and astrological images was issued by Antoninus Pius46 in the year 8 of his imperium in Egypt and in later years, to celebrate the return of the Sothiac cycle in +139 47 38 39 40 41 42 43 44 45 46 47

Kl. Pauly s.v. Traianus, col. 920, 6. Cramer 1954, 151-153. Cramer 1954, No.58, B.M., Thrace, p. 165, No. 33. De Meis 1994, Table 1. Baumeister 1887 No.1024 Baumeister 1887 No.1063, tetradrachm from Samos; shows the Vitta (sacrificial crown), laurel bough, and a bee. Baumeister 1887 No. 1136. Kl. Pauly. s.v. Acheloos. The diagram is modified from Flammarion, Le terre del cielo, Milano 1913, 70. See also Gundel 1992, Kat. No.254. This “Sirius period” or cycle of 1461 Egyptian years (1460 common), has been deeply studied by Neugebauer 1938, with the conclusion motto “Lasciate ogni speranza”. According to Censorinus, De Die Natali, c. 18, writing in +238, the Sothiac period reoccurred “abhinc annos centum Imperatore Antonino Pio II et Bruttio Praesente Coss., iidem dies fuerint ante diem XII. Kal. August., quo tempore solet canicula in Aegypto facere exortum”, that is in +139. Ideler 1806, 76-94, writes that Censorinus gives a reliable date for the heliacal rising of Sirius, and makes further calculations. The whole question deserves however a special study. As the Egyptian year is of 365 days and the Julian one 365.25, the difference will be 365 days after 365/0.25 = 1460 years, the length of the annus sothiacus or canicularis, because the date

Salvo De Meis

477

and thus the beginning of a new period for the world, in coincidence with his own new power; it was around this period that Ptolemy was flourishing48( again in fig. 8). The letters LH are in all the coins, meaning 58, the age of Antoninus, born on September 19 of +8649, and show that the year was +144/5. One of the images represents Antoninus and the full display of the Zodiac and of the gods, and especially important is another one [Gundel 1992, Kat. n. 128] which has two concentric Zodiacs with the same beginnings, thus probably showing the coincidence of the vague year and the Sothiac cycle. It is well known the attitude towards astrology of Nerva and Traianus, and Antoninus is equally faithful to it, especially in his stay in Egypt50, and so the figures represent the various zodiacal signs and the gods in their u(yw/mata51: Aries (f.)Mars; Taurus (f.)-Venus; Gemini52(m.)-Mercury; Cancer (f.)-Luna, Leo (m.)-Sol; Virgo (f.)-Mercury; Libra (m.)-Venus; Scorpius (f.)-Mars; Sagittarius (m.)-Jupiter; Capricornus (f.)-Saturn; Aquarius (m.)-Saturn; Pisces (f.)-Saturn.53 The gods are represented as busts with a po/loj above their heads. Of interest is also a coin representing Augustus with a foot on a globe with circles (fig.10), and another one from Carrhae, with star, crescent and globe on a basis, which is in the Hunterian Collection [Mc Donald pp. 301-2], minted by

48

49 50 51 52

53

would let coincide the 1st Thoth and the heliacal rise of Sirius (Sothis), and that every 4 years the date will change of one day. Now, besides Neugebauer’s considerations, it can be shown by recalculation that, for example from +131 to +143 the 1st Thoth occurred in a range from July 22 to 19, while the heliacal rise of Sirius at latitude 30° (Memphis or Heliopolis) was around July 19 or 20 or 21, according to values of the arcus visionis of –10°, –11°,–12°. With the same values, that heliacal rise occurred from –1330 to –1317 about July 17, 18, 19. The difference of one day has no importance for the heliacal rising, subject to many variables, but the point is that for several many years there is no specific year in which the coincidence Sirius rising-Thoth is one and the same. This means that many years can be found in which the “sothiac” year may have been renewed. Really, “lasciate ogni speranza”, but Antoninus did not know it (or used it on purpose). Toomer 1984, 1, states that taking care of the Canobic Inscriptions, “the Almagest can hardly have been published earlier than the year 150”. Ptolemy’s observations in his book range from +127 to +141, hence in Antoninus’ time. The hybrid Latin and Greek notation is L = 50, H = 8. See Cramer 1954, 146-154. Bouché-Leclercq 1899, 195. It is of interest to note that instead of the Dioskuroi Castor and Pollux (represented as naked youngsters), here Herakles (with clava and lion skin) and Apollo (dressed, near a quite large lyre) are shown. Sometimes Amphion and Zethos, Boeothian Dioskuroi are represented in other zodiacs, such as for example in the Bianchini Egyptian planisphere [Boll 1903, 305]. This was found in Rome and, robbed by Napoleon, is now in the Louvre. A mention of Herakles and Apollo as Gemini is in Hyginus [Astr., II, 22] and Manilius [II, 440] quotes “formosus Phoebus” as protector of Gemini. Incidentally a Carolingian manuscript has a miniature with Herakles and Apollo as Gemini. See Gundel 1992, p. 328 Kat. No. 460 (2). The abbreviations “m.” and “f.” mean masculine and feminine, according to the nature of the sign, and of the night or day “house”.

478

Astronomical Reflexes

emperor Lucius Aurelius Verus, as the legend LOUK AV HO VHROC shows. Another shows the head of Augustus, crescent and seven stars54. This last image is rather known also for other issues, such as that of TVRPILIANVS with one large star [Cohen 1880, 135 n. 495] and crescent, or others with more stars. In Cohen55 and Babelon56 we find a silver denarius of 74 B.C. with a horizontal crescent, seven stars and the legend TRIO, a sort of rebus for Septemtrio, and below the crescent L. LVCRETI; the obverse has a Sol, that is a head with radiuses. L. Lucretius Trio was one of the triumviri monetales encharged to mint money. This coin was reissued, with slight modifications, by Traianus after about two centuries, as we can see from the legend in the reverse IMP.CAES.TRAIAN.AVG.GER.DAC.P.P.REST.57 A silver denarius and a three denarii worth kistophorous58 are shown with the figure of Capricornus. This was the zodiacal sign adopted by Augustus, although he was born under Libra59. Suetonius [Aug. 94, 12] gives a post quem explanation concerning the horoscope cast by the astrologer Theogenes, and there is abundant literature on this subject, with variations on the theme and would-be justifications, based on the claim that the horoscope was referred to the dies genitalis or instead to the dies natalis, that is the dates of the conception or of the birth of the emperor60. A denarius with (obverse) a head of Augustus and AUG. DIVI. IL and (reverse) a capricorn with a globe and IMP. XI, is dated in EI61 as of 12-11 B.C. Further images and comments can be found in Zanker 1990; of interest a denarius representing Octavian with a foot on a globe, which has a net of meridians and parallels62. However, Vespasianus too was not born under Capricornus63, but he as well issued a coin with capricorn and a (starred) globe below, besides another one with two capricorni (and SC, Senatus Consulto). The choice of the sign can be traced in Firmicus Maternus [Math. 8, 28, 1]: in prima parte Capricorni quicumque habuerit horoscopum erit rex imperator. 64

54 55 56 57 58

59 60 61 62 63 64

Cohen 1880, 84, N. 142. Cohen 1880, 85 Babelon 1886, II, 580 N.32 “P.P.” stands for “pater patriae”. kisto/foroi were originally tetradrachms from Asia Minor and Creta, later used by Romans: Cicero (proconsul), Augustus, Vespasianus for example. The name derives from the “cista mystica” of Dionysos in which where ivy garlands. Augustus was born on September 23, 63 B.C., paulo ante solis ortum, as in Suetonius (Aug. 5). See Cramer 1954, 83, who dates the horoscope of Augustus to +11, even if his coins with capricorn were minted in –27 [Kraft K. JNG 17 (1967), 17-27]*. Enciclopedia Italiana, vol. XVII, s.v. “Globo”. Zanker 1990, fig. 31a, also in Gundel 1992, 61 and Kat. No.306. According to Suetonius, Titus Flavius Vespasianus Augustus was born near Rieti on November 17, 9 A.D.; hence his sign was Scorpius. [v. RE, KP]. See Domenicucci 1996.

Salvo De Meis

479

A brief note about celestial globes for their correlation with astronomical coins is in order here. Several art documents represent a personage with a globe and a “radius”; the coin of Samos, minted in 230 A.D.65 represents Pythagoras sitting and with radius and globe, to commemorate his wisdom, and the legend is PUQAGORHS SAMIWN, to confirm his birthplace. (fig. 11). The coin is reproduced also in the frontispice of Diels 1903. A similar coin from Klazomene has Anaxagoras in the place of Pythagoras66, others show Urania. For example, an image of Urania with globe and radius is on several coins issued by Q. Pomponius Musa in 68/66 B.C.67 and the globe has traces of the zodiacal limits. Moreover the support of the globe has been interpreted as a mere base, and according to Schiaparelli it might have been a dioptra68; however in other coins the support is clearly a tripod or a column, such as we shall see in the coins showing Pythagoras and Hipparchos. Similar Roman coins with Urania or other personages with globe and radius were issued also by Augustus, Traianus or Commodus69 A coin issued at Nicaea by Alexander Severus (III century A.D.)70 shows Hipparchos, the greatest astronomer of Antiquity, with a globe in front of him. (IPPARXOS NIKAIOU). (fig. 12). The globes were used not only to study astronomy and mathematics, but also to give visual help in the readings of the astronomical poems such as Aratus’ Faino/mena or later the Aratea, and the Byzantine Leontios gives precepts for their fabrication: periì kataskeuh=j 'Aratei/aj sfai/raj;71 their use for predictions of stellar phases was indispensable at that epoch, and Ptolemy [Alm. VIII, 3] gives precepts for the construction of a solid star globe. Cicero writes [de rep. I, 14, 21] that Philus72 (one of the participants of the dialogue) refers that C. Sulpicius Gallus predicted the lunar eclipse of the battle of Pydna (–167 June 21)73 and that in the house of M. Marcellus he had seen a mechanical orrery built by Archimedes, which was taken to Rome as war prey74. Such globe was sung by Ovid in Fasti VI 277-875. Again Cicero [de rep. I, 14, 22] indicates Thales as the inventor of the solid globes, and it was Anaximandros who first postulated that the universe was a globe76.

65 66 67 68 69 70 71 72 73 74 75 76

BM RE VII, 1428, 18. RE XC, s.v. Zodiakos, 617, 23 This is reported by Tabarroni G., Sfere celesti nelle monete romane, but without precise indication of the source. Tabarroni G., cit., Gundel H. RE XC, 617 sqq.; Cohen 320. Paris, Bibl. Nat., Cabinet des Medailles. Buhle Th., repr. in Maass E., Comm. in Ar. Rel. (VII). L. Furius Philus, was a student of astronomy, mentioned by Cicero elsewhere [Ad Quintum fratrem, III, 5; de amicitia 4, 14]. See Kl. Pauly s.v. Furius, II, 643, n. 31 and RE XII, 2360. See De Meis 2002. Marcellus conquered Syracuse in 212 B.C. “arte Syracosia suspensus in aëre clauso / stat globus, immensi parva figura poli”. RE VII, 1428, 8.

480

Astronomical Reflexes

A probably Roman marble globe from Arolsen was published in 186277, and is apparently dispersed at present78; it showed a zodiacal band with a sequence of images of the signs79. Another one is in the Vatican Museums80 and is dateable [Gundel 1992, 203] about the second century A.D. The interest is in the clearly depicted zodiacal band, although the figures are not classical (for example Aries and Taurus front to front, Virgo is naked, Libra is a naked man holding a scale made of shells). A further one is in Mainz81, and shows some 48 constellations, also as seen from outside, that is with East and West inverted 82. There are lines of the ecliptic and of the colures, of the equator and of the tropics. It has been dated around 150 and 200 AD on the basis of stylistic criteria. Dating is possible checking the longitude of Aries, although the longitudes of several stars are wrong, such as for example Sirius, Aldebaran, Orion. Of course the most known celestial globe is that of the Atlante Farnese, which clearly shows the structure of meridians and thus gives hints for the dating of the original work, from the passage of the equinoctial colure through the horn of Aries, that is the star g Arietis. Ptolemy [Alm. VII, 5] gives for this star the longitude 6.33°, latitude 7.12°, which correspond to a right ascension around 3° and a declination around 9°, thus the original sculpture has been dated at about the second century A.D.83; figure 13 is from the Maass’ Aratus, to which I have a superimposed a net of parallels and meridians to guide in estimating longitudes. Thiele84 saw in the figures the representation of a throne, void because dedicated to a living emperor; Gundel [RE XI 1168 s.v. Kometen] showed that this was the Thronus Caesaris, a constellation of the time of Augustus85, just over the Crab, thus demonstrating post-hipparchian (and augustean) additions. A direct study of the statue was made by Francesco Bianchini (1662-1729), who had also detailed engravings made for future publications. One is shown

77 Gaedechens 1862. 78 Tabarroni 1961, xxix, 42-44. 79 Aries and Taurus are both with their head towards east, while the other images are correctly represented, as seen from the Earth. 80 Sala dei Busti 341. 81 At the Römisch-Germanisches Zentralmuseum (RGZ), Inv.O.41339. 82 Details in Kuenzl 1996. 83 Bianchini measured directly on the globe, an equatorial distance of about 3° from the colure to the star. Recalculation of the positions of the star gives values comparable to this from the year 60 to 110 A.D., namely from 2.82° to 3.46°. As this might be a too early date for Ptolemy’s observations (see above), it is possible that he observed later, and by calculation obtained the value of 3°; however his estimate for the mean annual precession (1°/century) was smaller than the real one (1.397°/century) and thus an approximation for dating is not easy. While, according to Graßhoff 1990, 215, several coordinates stem from Hipparchian observations, not all have the same difference in longitude, thus showing real observations. 84 Thiele 1898, 41-42. 85 Besides Böker R., Caesaris thronus [RE, Suppl. VIII (1956) 918-921], see the comments to the denarius of Augustus. A. Le Boeuffle 1977, p.151, is inclined to believe that the constellation is the Southern Cross, but how could Romans see it?

Salvo De Meis

481

here.86 (fig. 14). Gundel [RE, XC, 615 s.v. Zodiakos,] accepts a dating of the second half of the first century A.D. Such dating however refers to the original statue of which the Farnese Atlas is a copy, with additions. A picture of the original globe may be compared to Bianchini’s drawings, and shows a slight displacements of the Aries’ horn (and of Virgo) with respect to the colures. Constellations’ myths can be found in coins, such as the following ones. Generally all classical constellations are represented, except Orion. A tetradrachm of ca. 370 B.C. from Klazomene has in the reverse a swan, the animal sacred to Apollo, together the name of the money officer, PUQEOS, while the obverse gives the name of the artifex QEODOTOS EPOEI aside the head of Apollo87. A didrachm from Phaistos88, a city in southern Kreta, has a figure of Herakles with the skin of the Nemean lion and the club, fighting the hydra of Lerna while a big crab is pinching his foot89. The reverse shows a bull with the legend FAISTIWN and the explanation is that the town derived its name from FAISTOS, the nephew of Herakles, who apparently initiated the cult of the hero. A stater from Corinth [Baumeister 1887, No. 1009] shows Pegasus, born from the blood of the Gorgon and being the city’s emblem celebrated by Pindarus [Olymp., XIII, 63]. The obverse shows a quadratum incusum, an indication of the archaic epoch of the mint. A silver stater of Euagoras I (ca. 435-374 B.C.) with a legend which Baumeister discusses 90 as found only in syllabaries of Cyprus, has a head of Heracles covered by the lion skin, while the reverse has a capricorn (the legend should read ba si le/ wj EU). Very interesting is the representation of a lion-bull combat in a tetradrachm from Akanthos.91 Figure 15 is shaded here to evidence the lion. Another one is in the previous fig. 1 with the Dareiko¢j. This motif was deeply studied by W. Hartner92. Considering the decorations of the Achaemenian palaces of Persepolis he showed the astronomical meaning of this motif from 4000 B.C. until Greek times, with a peculiar astronomical insight. Hartner, who clearly states his separation from Pan-Babylonism, to avoid misunderstandings, noted that the constellations of Taurus, Leo and Scorpius around 4000 B.C. do not occupy the positions of the equinoxes and of the summer solstice, but they precede them by 10° to 25°; he examines the heliacal

86 87 88 89 90 91 92

It can be seen in Tabarroni 1956. Baumeister 1887, No.1062. Baumeister 1887, No.1057. V. Herakles by Euripydes. Baumeister 1887, No. 1071. Baumeister 1887, No.1088. Hartner 1965.

482

Astronomical Reflexes

phenomena and finds that, at Persepolis, on February 10, 4000 B.C.93 while the Pleiades are setting heliacally the other constellations are in particular positions, such as at culmination or achronical rising, Leo being at the zenith. The myth generated would have been the supremacy of the Lion, killing the Bull which is trying to escape below the horizon. So far so good; however the same configuration can be found every year, except that precession is on alert, and in 500 B.C. the relative positions of Leo and Taurus are the same, but the date has changed into March 28. The heliacal phenomena are the bounding elements, so Hartner makes an “accuracy test” comparing for the equinoxes and solstices the phenomena of the representative stars he has chosen, using a stereographic diagram with the horizon of Persepolis. - Spring equinox. (–4000 April 4 Julian = March 21 Gregorian). The Pleiades rise heliacally, but Hartner has been mislead by the diagram for the cosmic setting of Antares ( Sco), because this occurs five months later, not five days (when a normal setting takes place). Hartner rarely makes mistakes, but this time he relied on a diagram instead of computing. The culmination of Cygnus is correct. - Summer solstice. (–4000 July 26 Julian = –4000 June 23 Gregorian). Regulus and Sirius rise heliacally, g Cas (the Deer, lu-lim) is near the zenith, a little after culmination. - Autumn equinox. (–4000 October 23 Julian, –4000 September 23 Gregorian). Antares rises heliacally. According to Hartner, Aldebaran ( Tau) is two to three days after cosmic setting (with an arcus visionis of 15°). Again he has been mislead by the diagram: it is not a cosmic setting (which occurred on April 8 Julian) but Aldebaran rose when the Sun set. - Winter solstice . (–4000 January 20 Julian = December 21 Gregorian). 1-iku (b Peg) rises heliacally, two days before a Peg, six days before Fomalhaut. In –500 there occurred analogous phenomena, and the continuity of the motif has its reason in the easy observable positions of the constellations, transmitted in myth and art. Incidentally this configuration may be observed at present on May, However the heliacal phenomena occur on days quite different from solstices and equinoxes. For example, always at Persepolis, the Pleiades (h Tau) rise heliacally on June 7 and Antares sets cosmically on November 28, rising acronically on June 2, that is not on March 21. Some implication by Hartner on the Zoroastrian calendar are better clarified by Panaino 1999. Moreover in a personal communication, Panaino gives further details94. 93 In his paper Hartner uses the Gregorian calendar also for years before 1582, in order to maintain the dates of the months. This is not the usual method, and might give some complication; for example in –4000 the spring equinox is stated on March 21, whereas the correct Julian date was April 24, as in that year there was a difference of about 32 days between the Julian and the Gregorian calendar. Hence February 10 Gregorian corresponds to March 13 Julian. 94 According to Hartner (1979), the g h mb rs, as normally considered season feasts would represent a survival of the Old Avestan Calendar, embedded in the later one, where they indicated the cosmic set of some asterisms visible at Persepolis. The g h mb rs should have

Salvo De Meis

483

Many images from vase decorations to seals or other ancient artefacts are shown in Hartner’s paper, but no coin; however this is an example of intercultural aspects, which coins may show from commerce to history and astronomy.

Abstract Commerce is the main purpose of coins, however, since Antiquity, besides marks for identification and value, important information was added in their decoration. The representation of kings, gods, myths, was among the most frequent, but astronomical events were also reproduced, although rarely. This paper concerns the study of several astronomical subjects reproduced in ancient coins, to investigate about possible determination of historical or astronomical events, not on general motifs such as isolated constellations or zodiacal signs. Some examples are given on the astronomical reconstruction of phenomena, with indications on how to avoid wrong conclusions, caused by false interpretations, which lack the complete convergence of historical, astronomical and philological reasons. The study is therefore mainly based on detailed astronomical investigation, supported by historical and philological hints to involve other specialists in this type of research. Some known subjects such as the Lion-Bull combat motif, Caesar’s comet, representations of the full Zodiac, are considered, while other ones are dismissed, due to their incoherent astronomical data, as it occurs in several Antiochian or Roman coins. Use is made of drawings, astronomical maps and computing data, to clarify the statements. A brief note is made about celestial globes and their correlation with “astronomical” coins, and dating of some of them is proposed. Finally, one of the aims of this paper is to solicit, and welcome, every mention of other examples, and a further one is the invitation to colleagues to pursue this subject, especially for its place in the MELAMMU Project.

formed the skeleton of the luni-solar (later sidereal) year, used to establish empirical intercalations. However none of the asterisms indicated by Hartner is known in the Avestic literature, while the reference to Persepolis as a primary observation place for an “Old Avestan” calendar, hence truly Iranic Oriental, seems improper. Also, the astronomical data in Lenz-Schlösser 1969 are much questionable from a modern computing point of view, as it will appear from a study that De Meis is completing at present.

484

Astronomical Reflexes

Fig. 1 Roaf 1992, p.202

Fig. 2 Baumeister 1887, N. 1107

Salvo De Meis

Fig. 3 EUA III 270

485

486

Astronomical Reflexes

Fig. 4 By Marco De Meis

Salvo De Meis

Fig. 5 Salvo De Meis, Ho Peng Yoke

487

488

Astronomical Reflexes

Fig. 6 By Salvo De Meis

Salvo De Meis

Fig. 7 Sky and Telescope, Jan. 1992

489

490

Astronomical Reflexes

Fig. 8 C. Flammarion 1913, modified

Salvo De Meis

Fig. 9 Baumeister 1887, N. 1063

Fig. 10 Mc Donald 1905

491

492

Astronomical Reflexes

Fig. 11 Paris. Cabinet des Medailles

Fig. 12 Die Welt der Antike, 1964 fig. 26

Salvo De Meis

Fig. 13 Maass´ Aratus and additions by Salvo De Meis

493

494

Astronomical Reflexes

Fig. 14 Drawing from Bianchini, in Tabarroni 1956 AB Sectio circuli Ascensionis rectae per cornu Arietis DE Circulus Aequinoctialis FGH Tropicus Cancri ZX Explicita 3 Andromeda 9 Piscis Boreus 10 Aries 11 Taurus X Sectio verni Aequinoctii praecedens primum in Cornu Arietis gradibus 7 ½ aetate Ptolemaei

Salvo De Meis

Fig. 15 Baumeister 1887, N. 1088

495

Astronomical Reflexes

496 Figures 1.

Dar[e]iko/j, with Dareios in kneeling schema. Above, Lion-Bull combat.

2.

Tetradrachm of Seleucus.

3.

Gold stater of Philip II.

4.

Silver denarius of Augustus, with image of the comet.

5.

Caesar's comet in the sky; coordinates framework with Chinese constellations.

6.

Caesar's comet in the sky, new orbit determination.

7.

Antiochian coin by Quadratus.

8.

Coins by Antoninus Pius representing the Zodiac.

9.

Tetradrachm from Samos.

10.

Augustus with globe.

11.

Coin representing Pythagoras and globe.

12.

Coin representing Hipparch and globe.

13.

Atlante Farnese: celestial coordinates superimposed on Maass' Ararus

14.

Atlante Farnese: Drawing from Bianchini.

15.

Tetradrachm representing the Lion-Bull combat.

Salvo De Meis

497

Bibliography Babelon E., Description Historique des Monnaies de la Republique Romaine, Paris 1885-6. Bickerman E.J., Chronology of the Ancient World, Ithaca 1968. Baumeister A., Denkmäler des klassischen Altertums, München 1887. Bentley R., Manilius, Cambridge 1739. Boll F., Sphaera, Leipzig 1903. Bouché-Leclercq A., L'astrologie grecque, Paris 1899. Cohen H., Description historique des monnaies frappeés sous l'empire romain, Paris 1880. Cramer F.H., Astrology in Roman Law and Politics, Philadelphia 1954. De Meis S., Manara A., La cometa di Halley, Milano 1985. De Meis S., La cometa di Cesare, Nuovo Orione, 1, 1992, 24-27. De Meis S., Quintuple planetary groupings - Rarity, historical events and popular beliefs, Journ. Brit. Astron. Assoc., 104, 6, 1994. De Meis S., Eclipses, an Introduction for Humanists, Roma 2002. Diels H., Fragmente der Vorsokratiker, Berlin 1903. Domenicucci P., Astra Caesarum, Pisa 1996. Enciclopedia Universale dell’Arte (EUA), Venezia 1963, vol. III. Flammarion C., Le terre del cielo, Milano 1913. Gaedechens R., Der marmorne Himmelsglobus des Antikenkabinettes zu Arolsen, Göttingen 1862. Gnecchi F., I tipi monetari di Roma imperiale, Milano 1907. Graßhoff G., The History of Ptolemy’s Star Catalogue, Berlin 1990. Gundel H.G., Zodiakos, Mainz 1992. Halley E., A Synopsis of the Astronomy of Comets, in D. Gregory “The Elements of Astronomy, Physical and Geometrical”, London 1715. Hartner W., The Earliest History of the Constellations in the Near East and the Motif of the Lion-Bull Combat, JNES, XXIV, N.1 and 2, Jan-Apr 1965. Hartner W., The Young Avestan and Babylonian Calendars and the Antecedents of Precession, JHA 10,1979, 1-22. Head B.V., Historia Numorum, Oxford 1887. Ho Peng Yoke, Ancient and Medieval Observations of Comets and Novae in Chinese Sources, Vistas in Astronomy, 5:127-225, 1962. Huber P.J. and De Meis S., Babylonian Eclipse Observations 750 BC to 1 BC, in press. Ideler L., Historische Untersuchungen über die astronomischen Beobachtungen der Alten, Berlin 1806. Kronk G. W., Cometography, I, Cambridge 1999. Kuenzl E., Sternenhimmel beiden Hemisphaeren, Antike Welt, 27, 1996, 129-134. Le Boeuffle A., Les noms latins d’astres et de constellations, Paris 1977. Lenz W. and Schlosser W., Persepolis - ein Beitrag zur Funktionsbestimmung, ZDMG, Supplementa I, Teil 3, 1969, 956-983.

498

Astronomical Reflexes

Lubienetzki S., Historia universalis omnium cometarum, Lugduni Batavorum 1681. Macdonald G., Catalogue of Greek Coins in the Hunterian Collection, Glasgow 1905. Mattingly H., Coins of the Roman Empire in the British Museum, London 1923. Meeus J.- Mucke H., Canon of Lunar Eclipses -2002 to +2526, Wien 1983. Meeus J., Astronomical Algorithms, Richmond 1991. Molnar A., The Coins of Antioch, Sky and Telescope, Jan. 1992, 37-39. Mucke H.-Meeus J., Canon of Solar Eclipses -2003 to +2526, Wien 1983. Neugebauer O., Die Bedeutungslosigkeit der ‘Sirius Periode’, Acta Orientalia XVII 1938, 169-195. Olmsted G., Celtic Art in Transition during the First Century B.C., Innsbruck 2001. Panaino A., Giovanni V. Schiaparelli e la storia dei più antichi calendari iranici, con tre inediti di G.V. Schiaparelli ed una Nota di S. De Meis, in “Giovanni Schiaparelli: storico della Astronomia e uomo di cultura”, Milano 1999, 99148. Pingré A.G., Cométographie ou Traité historique et théoriques des Comètes, Paris 1783. Roaf M., Atlante della Mesopotamia, Novara 1992. Riccioli G.B., Almagestum Novum, I-II, Bononiae 1651. Tabarroni G., Sfere celesti nelle monete romane, Pubbl. Oss. Astr. Univ. Bologna, VI, N.14, 1956. Tabarroni G., La posizione degli equinozi sulla sfera dell’Atlante Farnese, COELVM, xxiv, n.11-12, 169-174, 1956. Tabarroni G., L’antico globo celeste di Arolsen, COELVM, xxix, 42-44, 1961. Thiele G., Antike Himmelsbilder, Berlin 1898. Toomer G.J., Ptolemy’s Almagest, London 1984. Yeomans D.K., Comets, New York 1991. Zanker P., The Power of Images in the Age of Augustus, Ann Arbor, 1990.

SOME OBSERVATIONS ON THE IMAGE OF THE ASSYRIAN AND BABYLONIAN KINGDOMS WITHIN THE GREEK TRADITION Reinhold Bichler Preface: Berossus and the former Greek tradition1 Within the field of extant Greek historical writing on the subject of the Assyrian and Babylonian kingdoms the fragments of Berossus’ History of Babylonia, written by a so-called “Chaldean” priest2, but addressed to a Greek-speaking audience, deserve our special attention. How could Berossus’ account correspond to the legendary and speculative tradition presented by the former Greek historians? Since Berossus probably had access to some cuneiform sources and was more familiar with the cultural tradition of his country than any other author of our sources written in Greek, he should be able to give us more solid information than his famous predecessors, in particular Herodotus and Ctesias. And this is certainly true, as far as only names and dates are concerned and – to a certain extent – also some concrete deeds of the rulers of Babylon in the first millennium BC, mainly during the time of the Neo-Babylonian Empire. But there are a number of major problems to consider, if we look at the information given in the fragments of his work as far as the history of the Neo-Assyrian Empire and his relationship to the contemporary Babylonian kingdom are concerned. Yet even the fragments relating directly to the Neo-Babylonian kings are in some way dubious since they seem to be written under the influence of former Greek traditions. It would be important to know exactly to what extent Berossus was forced to pay tribute to this kind of tradition, formed by fascinating combinations of fact and fiction. But there are limits to such a comparative inquiry, since the fragments of Berossus’ History, as far as they relate our subject, consist mainly in dynastic-lists, names and chronological dates of rulers and rather brief comments on their deeds and their correspondence to the information given in the Holy Books of the Hebrews. There is no opportunity to hear more about the so-called sacred prostitution or the famous bride-market as presented by Herodotus, and a good part of Ctesias’ stories about a secret world of sex and crime at the “oriental” court3 seems to be totally ignored. Nevertheless, even concentrating on 1

2

3

First of all I want to express my gratitude to Robert Rollinger who encouraged me to participate in the 5th International Melammu conference although I am not an Assyriologist. He gave me a great deal of advice regarding publications I would otherwise have missed. Many thanks also to Leona Cordery who did her best to correct my English. Berossus’ social and cultural status is not easy to define; cf. for example Burstein 1978, 5 f.; Kuhrt 1987, 48; Verbrugghe – Wickersham 1996, 13 ff.; Oelsner 2002, 184 f., with further references. We must not underestimate the importance of Ctesias as the one who established what Helen Sancisi-Weerdenburg has called “the concept Orient”. It means “associations of harems, eunuchs, luxury and intrigues. It has connotations of softness, closedness, indulgence and lack of rigour”; Sancisi-Weerdenburg 1987, 43 f. Pierre Briant expresses a similar judgment concerning Ctesias’ image of the Persian court: “…la cour perse, dominée par les eunuques et

500

Reinhold Bichler

a rather boring theme like the dates of dynastic history we should be able to make some startling observations when comparing Berossus’ fragments with the former Greek tradition. I. Herodotus and Ctesias Concrete information concerning the Assyrians is scarce in Herodotus and their relationship to the Babylonians remains rather vague.4 Nevertheless, some aspects seem to be clear. Herodotus imagined that at one time the Assyrians dominated a widespread territory, including the region of Babylonia, and he calculated that their powerful empire lasted approximately 520 years until the Medes rebelled and the Assyrians lost a great number of their former allies (I 95).5 Finally, the Medes, ruled by King Cyaxares, defeated their former masters and conquered their capital Ninus, i.e. Nineveh. Herodotus had evidently no knowledge that the Medes were successful due to a coalition with the rising new kingdom of Babylonia. He regarded Babylon as the most important city of the Assyrians and as their royal city after the fall of Nineveh. He knew that the Babylonians (as part of the former Assyrian Empire) were ruled by sovereign kings until Cyrus conquered their famous metropolis. But there is no doubt that Herodotus had only vague ideas about the extent of the Neo-Babylonian Empire and even the kingship of Nebuchadnezzar is not clearly presented in the Histories.6 There is also no king-list comparable to that of the Lydians or the Medes. Instead we find a loose series of remarks relating to the one or other prominent ruler over Assyria or Babylonia. To start with the concept of origins, Herodotus simply mentions a certain King Ninus, seen probably as an – eponymous – founder of the metropolis7 located on the river Tigris, and he considers Sardanapallus to be his son (II 150). And probably – but this is not the actually information given by Herodotus – this Ninus is the same person as Ninus, the son of Belus, grandson of Alcaeus and great-grandson of Heracles (I 7). On the other

4

5

6

7

les femmes, est traversée des rumeurs de complots et d’assassinats, eux-mêmes souvent menés à l’instigation des eunuques et des femmes”; Briant 1989, 39 f. - For a short survey of Ctesias’ influence during the centuries until now see Karttunen 1997. See Högemann 1992, 56 f., 153 f.; Bichler 2000, 119. – The general distinction between Syria (= Levante) and Assyria (=Mesopotamia) drawn in Herodotus’ Histories is important enough to consider it a “turning point” in opposition to the former confusion of the two. Cf. Frye 1992, 282. I have omitted the miraculous Scythian rule over Asia during 28 years, an intermezzo which ended a short time before the fall of Ninus according to Herodotus (I 106), since there are no traces of that story in Berossus. Thus, for example, Herodotus mentions the battle at Magdolos – i.e. probably Migdol fought by the Egyptian king Necho at the end of the 7th century BC (II 159), but he was not able to link the enemy with the Babylonian king. For the historical background see Haider 1996, 103 with n. 222. If there should be a real Assyrian background behind the figure of Ninus, Herodotus did not seem to take much notice of that tradition. In his eyes Ninus is directly connected with the name of the city. Cf. Vannicelli 2001.

Assyrian and Babylonian Kingdoms within the Greek Tradition

501

hand the last-mentioned Ninus is the father of Agron, the first king of the Heraclid dynasty in Lydia (I 7).8 Following this concept, the origins of almost all imperial power in Asia can be traced back to Heracles. Apart from this piece of Greek mythological speculation about the “true” origins of Asian power, Herodotus fails to name any Assyrian king within his account of Near Eastern history in Book I. It is only by dealing with the Egyptian affairs that he suddenly sidesteps and tells us a story of King Sardanapallus, son of Ninus, who was robbed in a cunning way by some thieves who dug a channel from the River Tigris to his famous treasury (II 150). There is no hint here of the frivolous tradition of an effeminate king, living a secret and scandalous life behind the walls of his palace as described by Ctesias. However, we should observe that Herodotus does not apparently give us the full story and that Aristophanes took the knowledge of some negative stories about Sardanapallus for granted since he makes a very short allusion to this in his Birds dated 415 BC (v. 1021). A later scholion to the play remarks that Hellanicus – a younger contemporary of Herodotus, whose literary activities took place in the late 5th century, – was even forced to believe in the existence of two separate kings with the same name of Sardanapallus (FGrHist 4 F 63a).9 The origin of the different Greek ideas of thiscurious “oriental” king remains unclear, although there is some important evidence in an Aramaic text relating to the conflict between Assurbanipal and his brother Shamash-shum-ukin, the rebellious ruler in Babylon, whose defeat may well have been an initial reason to develop the later Greek story of Sardanapallus’ death.10 But Sardanapallus’ place in an imaginative Herodotean kinglist is not beyond doubt, since we cannot take for granted that this Sardanapallus, son of Ninus, is considered to be the grandson of Belus, father of Ninus, and therefore belongs to the early years of the Assyrian kingdom.11 However, Ctesias created his Sardanapallus as an effeminate representative of a late period of

8 Cf. Bichler 2000, 135 ff.; Vannicelli 2001. 9 F. H. Weißbach RE I A2 (1920), 2436 – 2475 s. v. Sardanapal; cf. especially 2437. 10 The text is written in Demotic script and its main theme was the New-Year festival of an Aramaic-speaking community in Upper Egypt; the text can be dated about 300 BC, but it preserves some older traditions. It concludes with a propagandistic story of Assurbanipal and his rebellious brother Sarmuge (= Shamash-shum-ukin). The sister of the two rivals tried in vain to persuade Sarmuge to surrender himself; so she announced the circumstances of his forthcoming death by his own hand: “…let fire burn you/ together with your sons/ and your daughters/ and your doctors/who have made you act brashly”. And that is, of course, what happened. Cf. the translated text in Steiner 1997, Col. XVII.5 – XXII.9, especially Coll. XX.6-11. I am very grateful to Karen Radner (Munich) who drew my attention to this document! A strong resemblance between the early Greek traditions about Croesus’ death and that Aramaic text is as remarkable as the muddling of the brothers in the Greek legend of Sardanapallus! The suggestion that Ctesias’ report of the fall of Nineveh includes, besides a great deal of fantasy, some knowledge based on cuneiform traditions about the siege and conquering of Babylon by Assurbanipal – see especially Macginnis 1988 –, could be raised again with new arguments. 11 At least the term son of Ninus names the king, not the city. Cf. Zawadzki 1984, 261 f.

502

Reinhold Bichler

decline and consequently places him at the end of his Assyrian king-list.12 This was then generally accepted by later historians. The last Assyrian king mentioned by Herodotus is Sanacharibos, king of the Arabians and Assyrians, who tried to conquer Egypt, but was denied his goal by a miraculous intervention: a swarm of field-mice gnawed the leather-parts of the weapons of his army (II 142). A great deal of controversial research work has been done in order to compare Herodotus’ story with other Greek traditions of the central literary motif and the Egyptian documents with their scanty content on the one hand and with the Jewish tradition of King Hezekiah, saved from an Assyrian attack under the command of Senacherim by means of divine intervention, and the relevant Assyrian annals on the other.13 There is no need to go into further detail. But we should not forget to consider the chronological framework given by Herodotus. Sanacharibos is seen as a contemporary of Sethos, whose reign was followed by twelve kings with equal rights, and after them by Psammetichus and his dynasty. He belongs more or less to the same chronological level as Semiramis, the Babylonian queen who, in Herodotus’ opinion, lived only four generations (i.e. in the fifth generation) before Nitocris, the mighty mother of the last sovereign ruler of Babylon (I 184).14 If we now consider Herodotus’ calculation that a powerful Assyrian kingdom, before the revolt of the Medes, lasted about 520 years (I 95), we come to realize that the chronological span between Ninus as the legendary founder of the Assyrian capital and Herodotus’ Semiramis (who is considered as a Babylonian queen) must be estimated to be more than those 520 years. Ctesias’ effort to present Semiramis as a partner of Ninus and founder of Babylon swept such calculations away. Evidently Ctesias did a good job as a storyteller. Herodotus’ Semiramis was still a rather unimportant figure. She is mentioned as one of two existing female rulers of Babylon and the remarkable dykes in the plain are attributed to her (I 184). Ctesias took the opportunity to transform her into an immortal literary character. By his influence Semiramis became the most important example of a barbarian queen before Cleopatra, whereas the traces of Sennacherib disappeared: they are neither to be found in Diodorus, our main source for Ctesias’ Assyriaca, nor in Strabo or Justinius who also depended – though not directly – on Ctesias’ gallery of kings and queens when they turned their attention to the Assyrian Empire. Of greater importance, therefore, is Berossus’ critical commentary on the Greek legends of Semiramis and his rich account of Sennacherib. But let us return to Herodotus’ account! After the fall of Nineveh, a part of the former Assyrian territory was dominated by the Median king Cyaxares and his 12 That in Ctesias’ story “Sardanapalus, after he had enjoyed pleasure in strange ways, died as noble as he could” (cf. Athenaeus XII 529 b; translated by Charles Burton Gulick), should not be overseen, but it belongs to the same concept: “K. (scheint) es gerade als pikant empfunden zu haben…, wie der Weichling tapfer wird”; Jacoby 1922, 2052; cf. also Briant 1989, 43. 13 Cf. for a first documentation of the different sources and problems Borger – Hinz – Römer (Hg.), 1984, 388 ff.; West 1987, 268 ff.; Lloyd 1988, 99 ff.; Loretz 1996; Schoors 1998, 25 ff., 96 f. 14 Cf. Bichler 2000, 137 f.; table nr. 1.

Assyrian and Babylonian Kingdoms within the Greek Tradition

503

son Astyages, i.e. Umakishtar and Ishtumegu following the cuneiform tradition. Finally, Cyrus the Great took over the Median capital, Ecbatana, and built up his own powerful Persian Empire. The basic dates given by Herodotus correspond to our knowledge. But in Herodotus’ report Cyrus’ campaign against Babylon took place rather towards the end of his reign than at a date corresponding to our year 539 BC. Also the circumstances of this campaign are as legendary and as marvelous as his famous description of the city of Babylon.15 And we must realize the fact that the same author, who preserved a rather surprising memory of King Sennacherib and was able to differentiate between the kings of Assyria and the later rulers of Babylon, probably had no real information concerning the rule of Nebuchadnezzar II and evidently underestimated the limits and the power of Babylon during the time between the fall of Nineveh and Cyrus’ campaign. To be aware that both male figures, the late king Labynetus, the former husband of Queen Nitocris, and their son, the younger Labynetus, Cyrus’ weak adversary, reflect in some way a certain knowledge of the existence of King Nabonidus is not much help, since Herodotus gives no further information relating to his person. Of far greater importance in Herodotus’ report are the famous stories of Queen Nitocris with particular reference to her tomb which bore a mock-inscription through which King Darius was deceived, and to her efforts to divert the course of the river in order to provide greater security for the city – a dubious measure that enabled Cyrus to follow this example and conquer the city in this very way (I 185 – 187). The problems posed by Herodotus’ stories of Queen Nitocris are notorious. Of course we know about some women within the Neo-Assyrian and the NeoBabylonian dynasties who were able to exercise a powerful role as the king’s mother or widow and could even have buildings erected in their name like, for example, Naqia, the mother of Esarhaddon. Furthermore, it is important to note that King Nabonidus’ mother Adad-guppi was also such a powerful person16. However, the concrete relationship to Herodotus’ colourful report of this queen`s deeds, and her name Nitocris, which she shares with the only Egyptian queen mentioned by Herodotus, is more than doubtful.17 The Babylonian Nitocris seems to have totally disappeared in the later Greek historiography, but some of the motives in Herodotus’ account of the deeds of that dubious queen have survived in various forms.18 The story that the River Euphrates was once diverted in order to enter the besieged city of Babylon was even accepted – as we shall see – by Berossus. 19 I do not wish to speculate too much by tracing back the general motif 15 Cf. Rollinger 1993, 19 ff.; Kratz 2002, 152 f., with further references. 16 Cf. M. P. Streck, RlA IX (1998/2001), 165 s. v. Naqi’a and 590 f. s. v. Nitokris; Reade 2000, 199 f. But we should not neglect all the details and the special colour in Herodotus’ stories which differ a great deal from the information based on cuneiform sources! Dalley 1996, 529, simplifies the problem: “H.s (i.e. Herodotus’) Nitocris is generally thought to incorporate the character and works of Naqia”. 17 See Asheri 1988, 374 f. For the Egyptian Nitocris see Haider 2002. 18 Th. Lenschau, RE Suppl. VII (1940), 570 – 572 s. v. Nitokris. 19 Stephanie Dalley tends to accept the basic fact in Herodotus’ report, if only the legendary diversion of the Euphrates would be located at a greater distance to the city: “It seems

504

Reinhold Bichler

to the Sumerian tale of Gilgamesh’s death, but one should at least consider the possibility.20 Much more important in regard to the development of the later Greek historiography is the total lack of any concrete knowledge about the rulers of the Neo-Babylonian kingdom and the widespread power attributed to them in Ctesias and those writers of a universal history or geography who are basically influenced by his work, either directly or through intermediaries: Diodorus, Strabo, Justinus. So it is time to take a closer look at Ctesias’ account. Ctesias’ name is widely associated with fantasy, invention, even lies.21 On the other hand, those who want to defend his veracity believe in the existence of otherwise unknown written or – easier to pretend – oral traditions as the basis for his stories.22 To make my point clear I have to admit that I do not consider Ctesias to be an author who fits into the usual categories of historical writing. He should be neither regarded as a liar nor be defended for his reliability. In order to narrow my approach I shall concentrate on the well known testimony of Photius, the Byzantine patriarch, who composed a general abstract of the Persica: “Read a work of Ctesias of Cnidos, the Persica in twenty-three books. In the first six he deals with Assyria and events before the existence of Persia. From the seventh onwards he deals with Persia. In Books 7, 8, 10, 11, 12, 13 he discusses Cyrus, Cambyses, the Priest, Darius and Xerxes, in almost every point giving an account opposed to Herodotus; he accuses him of lying frequently and calls him a storyteller” (Bibliotheca Nr. 71 p. 35 b Wilson).23

20 21

22 23

possible that Cyrus diverted the river in order to enter the greater Babylon past the Median wall, since this interpretation would explain why nobody in central Babylon noticed what was going on”; Dalley 1996, 528. But such a “correction” of Herodotus’ report destroys its literary wit: The Persians entered the city along the passable river-bed by an act of surprise meanwhile the citizens were celebrating a feast (I 191). Now it is possible that Cyrus took Babylon by force, corresponding to the core of the Greek tradition. But no exact method enables us to detect the concrete “real“ history behind Herodotus’ (or other Greeks) stories as long as there are no clear cut references in cuneiform texts. Cf. also Kratz 2002, 152, especially n. 36. – Nesselrath 1999 who aims to defend Herodotus’ status as an eye-witness in Babylon, stresses the argument that he had access to some oral traditions based not immediately on cuneiform records: “Herodot verdankt seine Darstellung sicher keinem jener schriftlichen Zeugnisse, auf die mehr als anderthalb Jahrhunderte nach ihm ein Berossus noch zurückgreifen konnte, sondern einer Quelle, die selbst von diesen Zeugnissen wohl schon sehr weit entfernt war“; Nesselrath p. 203. The basic argument is simple: whatever Herodotus may have reported as legendary in our eyes is reduced to otherwise unknown oral traditions. Cf. also the critical remarks in Wiesehöfer 2002, 38: “Es bleibt allerdings zu fragen, in welchem Verhältnis die so vermittelten Nachrichten, die sich Autopsie verdankenden Teile und die neu gestalteten Passagen im babylonischen Logos Herodots zu einander stehen sollen“. Cf. the English translation of the Sumerian text: The Death of Bilgamesh: “The great wild bull is lying down”, in: George 1999, 195 ff.; cf. especially M 239 ff. (p. 205 ff.). One of the most prominent scholars of this sceptical tradition is Felix Jacoby: “Wer die großen Exzerpte bei Diodor, Nikolaos, Photios hintereinander liest, begreift die Diskussionen nicht, die gelegentlich immer noch die Glaubwürdigkeit des K. und seinen Wert als historische Quelle für einzelne Partien seines Werkes zu retten suchen“; Jacoby 1922, 2047. Cf. for example Lenfant 1996 with further references. Cf. also n. 25 The quoted translation is given by Wilson 1994, 55.

Assyrian and Babylonian Kingdoms within the Greek Tradition

505

That Ctesias gave “in almost every point an account opposed to Herodotus”, is easy to confirm if we follow the patriarch’s abstract. I will give a short selection of striking examples24: Croesus, defeated by Cyrus, was not saved by a miracle from the burning funeral pyre but could free himself from his chains several times; there is no mention in Photius’ abstract that Cyrus conquered Babylon, but Cambyses died in this city; he had wounded himself by carving a piece of wood with his knife - a rude mockery in contrast to Herodotus’ story of the kings fateful death; Cyrus, on the other hand, was wounded in his last battle in the same way as Cambyses in the Histories, but his adversaries were not the Massagetes but the Derbikes; Cambyses, who conquered Egypt, fought against Amyrtaios instead of Psammenitos; Herodotus’ “false” Smerdis appears to be transformed into a “false” Tanyoxarkes whose deception is even more incredible than that of his Herodotean counterpart, and the revolt against his later reign is perpetrated by men whose names differ – with the only exception of Darius himself – totally from what we know from Herodotus and the Behistun inscription;25 the bloody revolt of Babylon is not connected with Darius and Zopyros, but with Xerxes and Megabyzos; Darius’ general Datis was killed in the earlier battle at Marathon – in complete contrast to Herodotus; Leonidas’ famous defense at Thermopylae came to a fatal end due to the bad advise of some traitors, so Xerxes’ Spartan guest Demaratos who is presented in the Histories as an honest man with respect to his Greek countrymen; the chronological order of the battles at Plataea and Salamis is inverted in a similar way as the order of some of Cyrus’ campaigns; the Persian general Mardonius was not killed at Plataea and the refugees in the acropolis at Athens were not massacred but could escape when Xerxes’ army set fire to it, and so on, every point contradicting Herodotus’ report.26 Could all this be regarded as being based on otherwise unknown sources, such as popular traditions, court gossip, not forgetting simple cases of misunderstanding and error? On the other hand, must we then consider these antiHerodotean stories to be the simple result of forgery and lies? In my opinion there is a better way to understand Ctesias’ intention if we are ready to accept this strange kind of opposition to Herodotus as a game, like a kind of persiflage, and thus, we must not take this as a serious attempt to correct his famous predecessor. Also Ctesias’ corresponding tendency to evidently neglect some of the most colourful reports in Herodotus and instead to present a series of pretty “new” stories and otherwise unknown details should not be overlooked. This fulfills the same purpose: to amuse an educated audience. If there are even strong arguments to interpret his autobiographical remarks as fictitious, we could also consider this aspect of his work to be part of a literary game27. But I do not insist on this 24 For further examples cf. especially Jacoby 1922. 25 Lenfant 1996 is even prepared to believe that the names of these six conspirators which differ totally from the information given by Herodotus’ report and by Darius’ inscription at Behistun are based on competitive oral traditions; cf. 373 ff. 26 Cf. the translated text in Wilson 1994, 56 ff. The Greek text with a German translation and a commentary is given by König 1972. 27 See Dorati 1995, especially 46 ff. But Dorati does not stress the aspect of a literary game in Ctesias’ pretension as being an accurate eye-witness at the kings court, he rather regards the

506

Reinhold Bichler

understanding of his biography. However, it may be helpful for our approach to Ctesias’ reports about Assyria and Babylonia to bear the importance of irony and persiflage in his contradiction of Herodotus in mind. Now let us first consider the outlines of Ctesias’ history of Assyria and then some of the most important topics mentioned in his royal portraits. For him, the Assyrian Empire lasted a very long time and was finally followed by the Medes and their Persian successors. During all this time the region of Babylonia figured as some sort of a satrapy of first the Assyrians and then the Medes. A sovereign Babylonian kingdom does not occur in Ctesias’ fragments. The beginning and the end of the Assyrian empire are represented by colourful, even unforgettable persons: Semiramis, the powerful wife and widow of King Ninus and Sardanapallus, the effeminate mock-image of an oriental king who dominates the world outside from the secret interior chambers of his palace. Around these most important figures the historical writer’s imagination has woven a rich setting of novels with other sharply defined characters. There are Semiramis’ different opponents, and last but not least her husband Ninus and their decadent son Ninyas. Then there is Sardanapallus’ court with all its eunuchs and mistresses and on the other hand the mighty adversaries who could finally defeat this former greatest Empire.28 But between the reign of Semiramis’ son Ninyas and that of Sardanapallus we find a gap in Ctesias’ report, filled up only with proper names and the dates of 30 rulers (including Sardanapallus) – a great number of unimportant kings who reigned over a period of 1300 or 1360 years, i.e. approximately double the length calculated by Herodotus for the existence of the Assyrian Empire before the secession of the Medes under their king Deioces. If we are not misled by the fragmentary status of Ctesias’ work, the king-list is “filled up” with some chronological cross-references to the Greek mythological past, but the only remarkable date in Diodorus’ eyes was the supply of soldiers delivered by king Teutamos (Diodorus II 22) which were required to defend Troy against the Greek heroes. – In contradiction to Herodotus the origins of the Assyrian empire are not chronologically correlated – not even in a very approximate way – with the fall of Troy but are estimated as going back almost as far as the fall of Troy was antecedent to the end of the Assyrian empire.29 In contradiction to Herodotus’ report, through her marriage Semiramis became the first Assyrian queen and is praised as the foundress of Babylon, whose most important buildings were simply buildings not mentioned in Herodotus’ famous description of the city. And just to be contrary the city of Ninus, founded by her husband, is located near the River Euphrates. Diodorus seems to follow Ctesias faithfully in his “error”, but he gives the correct placement of Ninus within another source-context “historian” as a victim of the newly established rules to argue with reference to the superior qualities of an eye-witness: “…l’autopsia costituisce prima di tutto un topos ed un’aprioristica esigenza dello storico”; p. 51. 28 For the general aim of Ctesias’ image of the Assyrian Empire see Sancisi-Weerdenburg 1987 (cf. above n. 3). 29 A detailed analysis of Ctesias’ king-list is presented by Boncquet 1990; cf. especially p. 15: “In his eagerness to improve on Herodotus and to demonstrate that the Assyrians had an older history than the Greeks, Ctesias put Ninus some 1000 years before the Trojan War”.

Assyrian and Babylonian Kingdoms within the Greek Tradition

507

(cf. XVII 53,4 and 55,3), while Nicolaus of Damascus (i.e. the Byzantine Excerpta de insidiis) corrected Ctesias’ “error” without any commentary (FGrHist 90 F 3, line 22 f.).30 Strabo who was probably dependent on Ctesias through some intermediary sources avoided the “mistake” (cf. XVI 1-3). But let us return to the catalogue of kings and queens. The best documented Assyrian king in Herodotus, Sennacherib, simply disappears under the influence of Ctesias’ work, if we take Diodorus, Strabo and Justinus as our evidence. Nevertheless, he is brought back to mind by Berossus and the later chronographers. But we also observe the loss of Herodotus’ Babylonian queen Nitocris and she was never mentioned by later writers. If one should consider her to be a tolerable loss, with regard to her doubtful historical existence, we must take in evidence the fact that her husband and her son disappeared with her. However, more importantly, due to Ctesias’ influence, there is no hint at all of the former existence of a sovereign Babylonian Empire either in Diodorus or in Strabo and Justinus. Herodotus’ superior historical knowledge was underestimated by those important writers of universal history and geography. Now there are strong arguments that Ctesias had his own good reasons to “correct” Herodotus’ report concerning the history of Babylon after the fall of Nineveh. If he pursued the idea that at any time one mighty kingdom held the position of hegemony over (upper) Asia, the Medes, as the ones who – according to Herodotus! – took the capital of the former Assyrian Empire must also be regarded as the heirs of this power, whereas the region of Babylonia appeared to be only some kind a satrapy of either the Assyrians or the Medes.31 This approach bears his logic, but we must not forget the price which has to be paid by Diodorus, Strabo and other writers under Ctesias’ influence: they had to neglect Herodotus’ otherwise well-known Babylonian Logos as far as the history of the city was concerned. And, of course, they had to ignore Berossus’ Babylonian History, but this would not be surprising if we consider the limited reception of his work as a whole.32 This neglect of Berossus’ work by those authors who formed the mainstream of universal-history is a pity since he himself must have been eager to reach the Greek-speaking public. Thus we have to take a closer look at his situation between his own Babylonian tradition and the dominance of Greek historiography. II. Berossus and the Greek tradition Berossus was evidently forced to make certain compromises for Greek-speaking public and – more important – to the Greek art of historiography in general. He wrote in Greek, he presented himself as the author, he considered the telling of the mythological tradition – stories about the creation of the world and the origins of mankind – as a primary factor in relating history and he embedded the history of Babylonian kingdoms in the description of the country, its geography and its 30 See Bigwood 1980, 197. 31 Cf. Kuhrt 1987, 32 f. 32 Cf. Verbrugghe – Wickersham 1996, 27 ff.

508

Reinhold Bichler

specific products.33 But there are also important differences to the common Greek tradition of historiography. Of course, our knowledge is limited by the very unsatisfactory status of the fragments, but it seems to be not only accidental that there are a few traces of real stories, of all that rich tradition of novels and even romances. Nevertheless, Berossus seems to follow certain lines of Greek tradition given by Herodotus and – more important – by Ctesias, a tradition so different from the information Berossus could have received from cuneiform sources. Before we go into detail, we have to be aware that Berossus concentrated his attention on the kingdom of Babylon and neglected the importance of the NeoAssyrian Empire. This fact is well known and a plausible explanation is given, for example, by Amélie Kuhrt: “Assyrian history was completely ignored except for those Assyrian kings who had ruled directly over Babylon; in this Berossus was clearly following the Babylonian chronicle tradition”.34 But a closer look at the relevant fragments lets one pose some critical questions. No easy answer will do. Berossus was in some respect influenced by Greek traditions concerning the Assyrian Empire, but he was not able to conceal these traditions with his concept of Babylonian rule. He had, in my opinion, only vague ideas about the NeoAssyrian Empire and its most important rulers and that impression is – probably – not a simple consequence of the fragmentary status of his work.35 Let us first consider the rank he attributed to the legendary Queen Semiramis, legendary not meaning her actual existence, since her name may be traced back to Sammuramat, wife of Samshi-Adad V and mother of Adad-Nirari III, “although there is no evidence she bore a title equivalent to the modern conception of what a queen is”.36 Yet, she certainly had a special rank in the royal family and for some years she ruled de facto the empire, including Babylonia. We are not able to follow the way through the darkness of all these unspecified “cultural relations” which may have been responsible in bringing about a piece of solid tradition concerning her role in early Greek historiography. From the time of her first appearance in Herodotus’ Histories, Semiramis maintains her position in the western image of Assyria and Babylonia and, due to Ctesias literary power, she was even respected as the mother of a long-lasting dynasty and the city-founder of Babylon.37 33 See especially Kuhrt 1987, 46 ff.; Verbrugghe – Wickersham 1996, 25 ff. 34 Kuhrt 1987, 45. 35 Of course, if one considers Alexander Polyhistor to be the source of almost all the relevant later “fragments” – cf. especially Schnabel 1923, 134 ff.; Burstein 1978, 10 ff. –, it would be easy to attribute all kinds of confusion or ignorance to him and to those using him as their source. But the problems raised by the extant fragments remain the same. One could even move one step further and follow Schnabels conviction that Polyhistor based his Assyriaka and Mediaka primarily on Ctesias, “ihn aber gelegentlich durch eine Einlage aus Berossos ergänzte, ebenso wie er in sein Berossosexzerpt Einlagen aus anderen Schriftstellern machte”; cf. Schnabel 1923, 153. But in this way our judgement about the problem, what could be attributed to Berossus and what not, would become widely arbitrary. 36 Verbrugghe – Wickersham 1996, 21. 37 The main source for our knowledge of Ctesias’ portrait of Semiramis is Diodorus, but he adjusted the tradition in order to develop his own picture, and there are strong arguments that the image of the queen in Ctesias’ original work was in a great many details worse, more

Assyrian and Babylonian Kingdoms within the Greek Tradition

509

Berossus certainly knew about her husband Ninus from his Greek sources and he was probably aware of the dubious character of this person who appeared as an eponymous hero corresponding to Greek ideas of mythological city-founders. There is also no doubt that he would never have accepted Ctesias’ provocative gesture to place Nineveh, Ninus’ new capital, on the River Euphrates. In Berossus’ dates for the Mesopotamian kings there was evidently no room for king Ninus. But regarding his wife, the situation is different.38 Berossus probably rejected all the romantic and novelistic imaginary accounts of Semiramis as an attractive, even frivolous and indeed very powerful woman, and he could not sanction her position as the lady who founded Babylon of her own will. But what we know for certain from all his doubts – due to Josephus’ quotation – is not much: “Thus Berossos gave his account about the kings mentioned above and about many other things besides in the third book of his Chaldean history, in which he also blames the Greek writers for their silly mistake in saying that Semiramis of the Assyrians founded Babylon and ascribing to her its wondrous buildings” (F 9a Verbrugghe – Wickersham). Berossus’ statement about the Greek writers sounds rather sharp, nevertheless, he made a substantial contribution to their legendary tradition about Semiramis: he gave her a place at the beginning of a special epoch, starting with her as the founder of a dynasty who was followed by 45 anonymous kings over a time span of some 526 years until we come to other well-known representatives of Assyrian power: to Phulos and to Senakheirimos, both embedded in either the Hebrew or the Greek tradition. The chronological time span of 526 years may remind one of Herodotus’ calculation that the existence of the Assyrian Empire lasted about 520 years until the Medes revolted during the reign of their king Deioces. However, the number of 45 kings would be difficult to conceal with Herodotus’ ideas.39 On the other hand, the resemblance to Ctesias’ king-list should not be overlooked. There was also a long series of rather unimportant kings, i.e. 29 persons who ruled over a span of even 1300 or 1360 years. And this king-list covered a gap of historical information between the famous deeds of the family of the city-founders – i.e. Ninus, Semiramis and their son Ninyas – and the colourful story of the decadent last emperor, Sardanapallus. A similar but in other ways different gap in Berossus’ report included all the kings between Semiramis and Phulos, but finally, he too marked the beginning and the end of a constant reign over Assyria with the kingship of Semiramis and that of Sardanapallus. But there is a tricky oriented on the themes of sex and crime. See Comploi 2000, especially 233 ff., with a comparison of the different fragments and further references. 38 Kuhrt 1987, 45, stresses the argument that in Berossus’ account “Ninus and Semiramis were entirely absent“. That should be corrected in respect to Semiramis. Nevertheless, she is right to refer back to Abydenus, quoted by Eusebius (Karst 1911 p. 25): “Des Ninos und der Sâmiram haben sie (die Chaldäer) nicht sonderlich acht”. 39 Herodotus himself preferred the widely accepted calculation which was the equivalent of roughly three generations to a total of 100 years; see Ball 1979; Burkert 1995. The tradition about the Lydian dynasty as reported by Herodotus – 22 generations of rulers of Heracledean origin over 505 years (I 7) – is highly dubious. A calculation with 45 kings during an estimated time of 526 years would be impossible in Herodotus’ eyes.

510

Reinhold Bichler

problem: it seems to be unclear to what extent this king-list was oriented on the rule over Assyria as well as over Babylon. One should, therefore, take a first step to consider the names of these queens and kings in the extant fragments of Berossus which are explicitly connected in some way or the other with the Neo-Assyrian Empire; there are only a few! First, Semiramis is introduced as a queen who reigned over Assyria. Her position as the first in a new dynastic series demonstrates her estimated importance, but her identity as a concrete “historical” figure in the modern sense would remain doubtful as far as Berossus is concerned, whose chronological calculation would take her back to the Bronze Age, at least more than 400 years before the reign of Sammuramat. The next figure to be examined is Phulos. It is unclear in how far Berossus reported the special deeds of this king, since our information does not go back to Berossus himself, but to Alexander Polyhistor and those referring to him, whose special concern was to prove the correctness of the Holy Scriptures by quoting Chaldean traditions given by Berossus. 40 If we are able to identify Berossus’ king Phulos as Tiglatpilesar III, this is mainly due to the Hebrew tradition (cf. especially Regnorum IV 15, 29) in correspondence to our cuneiform sources; but it is also possible that Berossus himself mentioned the king’s name in a manner that enabled Polyhistor (and his followers) to identify him as the well-known Assyrian conqueror. Nevertheless, we should note that Polyhistor simply refers to him as “King of the Chaldeans”. It is only due to Polyhistor’s or Eusebius’ remark that “the history of the Hebrews mentions (him) and also calls Phulos” (F 5 Verbrugghe – Wickersham) that a reader, who had no knowledge based on cuneiform records, would necessarily conclude that this Phulos ruled over the entire Assyrian empire. There is no similar problem regarding Sennacherib. Josephus testifies that “Berossos, the writer of the Chaldean history, records the kingship of Senakheirimos and says that he ruled the Assyrians…” (F 7 Verbrugghe – Wickersham). But another obstacle is presented by Eusebius’ quotation: since his reference-author Polyhistor (if not Berossus himself) wrote that this Senakheirimos was king (immediately) after Phulos (F 5 p. 52 Verbrugghe – Wickersham), we have to consider a remarkable gap in the expected Assyrian king-list. Neither Shalmanesser V nor Sargon II is mentioned in the fragments. However, their successor Sennacherib was important enough to find his place in Berossus’ report. For once his presence is mentioned in the Holy Scripture, noted at least by Polyhistor (if not yet by Berossus) and, therefore, by the later chronographers (F 8b Verbrugghe – Wickersham). But Berossus – via Polyhistor - gave much more information. What he said about Sennacherib’s confrontation with the Greeks in Cilicia is very important for our knowledge41, though there are some details which must be treated with great

40 To what extent our knowledge of Berossus’ work depends mainly on Polyhistor is not easy to decide; cf. Kuhrt 1987, 34 ff.; Verbrugghe – Wickersham 1996, 27 ff. Cf. also n. 42. 41 See Haider 1996, 85 ff., especially n. 151 with further references.

Assyrian and Babylonian Kingdoms within the Greek Tradition

511

caution.42 Josephus finally mentions a campaign “throughout Asia and Egypt” (F 8a Verbrugghe – Wickersham). In this respect Herodotus maintains a greater knowledge. Nevertheless, Berossus’ account has other qualities. He gives a great many details concerning the treatment of Babylon during Sennacherib’s reign as reported by Eusebius via Polyhistor (F 8b Verbrugghe – Wickersham). With one important exception – concerning the reign of Ashur-nadin-shumi who is ignored as is Mushezib-Marduk – and apart from some minor errors, Berossus` extant fragments present a correct king-list for Babylonia during the reign of the Assyrian king Sennacherib.43 But Eusebius probably had no clear-cut ideas about the concrete relationship between those rulers over Babylon and the AssyrianEmpire, with the one exception of Sennacherib’s campaign: “Senakheirimos, king of the Assyrians, led an army against Babylonia, showed a bold front, and conquered. He took captive Belibos (i.e. Bel-ibni) and his friends and brought them to Assyria. He then ruled over Babylonia and made his son Asordanios (i.e. Esarhaddon) king over them. Then he went back to Assyria” (F 8b Verbrugghe – Wickersham). Within the fragments of Berossus, this brief comment by Eusebius is the only testimony relating immediately to Sennacherib’s son and successor Esarhaddon. However, we are told that Sennacherib was killed in a conspiracy by another son, Ardumazan, a fact which is noted by Eusebius via Polyhistor (F 8b Verbrugghe – Wickersham). Furthermore, Eusebius remarks generally that Polyhistor was in agreement with the Hebrew tradition when he reported about Senakheirimos’ son. This is important not only in respect of the name of the murderer Ardumazan (or Adramelos, following Abydenus who was also dependent on Berossus), but also with regard to the comment in the Book of Kings, that Sennacherib’s son Asordan (i.e. Esarhaddon) followed his father on the throne, when Sennacherib was slaughtered by his sons Adramelech and Sarasar (Regnorum IV 19, 37). 44 Without this reference and with nothing other than the comments of Eusebius, we have no chance of getting a clear idea of Esarhaddon’s kingship over the Assyrian Empire. And that he – and not his father, as noted by Berossus – indeed “campaigned throughout Asia and Egypt” would never be supposed by reading only the fragments of the Babyloniaca. The case of Assurbanipal is even more complicated. He is only mentioned by Eusebius or Polyhistor who lists the successors of Sennacherib as follows: Sennacherib’s son (=Asordanios), Samoges and Samoges’ brother. The next to be mentioned is already Nabopalassaros. Evidently, Samoges’ brother must have been identified with Sardanapallus, since a few lines later Eusebius – still basing 42 Cf. Lanfranchi 2000, 22 ff.; Rollinger 2001, 240 ff. – Lanfranchi compares the different versions of the battle between Sennacherib and the Greeks in the extant fragments based on either Alexander Polyhistor or Abydenus in order to re-establish Berossus’ original version and he considers the possibility that Berossus himself blended different information based on cuneiform records with the result of his own historical reasoning. 43 Cf. Burstein 1978, 36 f. = Appendix 3, and the tables in Verbrugghe – Wickersham 1996, 76 ff. The problem of the identity of Senacherib’s brother who is listed as the next follower by Eusebius is treated by Burstein 1978, 23 n. 71: “…at present no solution seems possible”. 44 See Parpola 1980.

512

Reinhold Bichler

his facts on Polyhistor – says that after Samoges, Sardanapallus gained the throne and reigned over the Chaldeans. So far the fragmentary quotation of Polyhistor’s text corresponds to the fact that Assurbanipal had defeated his rebellious brother Shamash-shum-ukin, i.e. Samoges, and conquered the city. Next we are told by Eusebius that the father of Naboukhodonosoros (i.e. Nabopolassaros) sent envoys to the satrap of the Medes in order to collect a bride for his son (F 8b Verbrugghe – Wickersham p. 56). No further comments on Sardanapallus are made in Berossus’ fragments. Not a single word makes an allusion to any of the fantastic stories about Sardanapallus’ deeds in the older Greek tradition. At least the usual Greek name of the king is given. But to get the idea that this Sardanapallus once reigned over the entire Assyrian Empire one has to compare the brief piece of information given by Berossus’ or Polyhistor’s fragments with the legendary Greek tradition of Sardanapallus as presented by Ctesias. Once again it seems to be unclear to what extent the rulers of Babylon, who were listed from Phulos down to Sardanapallus, are connected with a contemporary kingdom in Assyria.45 Last but not least one should not forget that the general relationship between Berossus’ king-list from Semiramis to Sardanapallus and his remarks about the chronological order of the Babylonian kingdom is unclear. Berossus himself was aware of the lack of concrete dates and deeds relating to the kings mentioned in earlier books of the History of Babylonia. And there was evidently an explanation. I quote the Byzantine chronographer Syncellus: “As Alexander and Berossos record, both of whom have recounted the foundation stories of the Chaldeans, Nabonassaros, having collected the deeds of the kings who ruled before him, destroyed them, so that only from his reign on is there an accurate record of the Chaldean kings” (F 7 Verbrugghe – Wickersham).46 We could be glad if the consequences of that statement would be a Babylonian king-list from Nabonassaros down to the rulers of the Neo-Babylonian Empire and further to the Persian kings, as is the case in some cuneiform chronicles and in the Ptolemaic Canon. However, the extant fragments of Berossus are disappointing. There is still a lack of information concerning the rulers between Nabonassaros and Phulos and between Phulos and Senakheirimos. Obviously a full Babylonian kinglist from Nabonassaros downwards would not harmonize with Berossus’ own ideas. 45 There is no mention of any existing ruler between Sardanapallus and Nabopolassaros in the context of the Armenian version of Eusebius related to Polyhistor (and in the fragments collected by Verbrugghe-Wickersham). But obviously Berossus had more information about the last rulers of the Assyrian Empire. Abydenus mentions Sarakos (i.e. Sin-shar-ishkun) as the last ruler over Assyria and reports that his palace burned down (Eusebius ed. Karst p. 18 = FGrHist 685 F 5). The same tradition was attributed by Syncellus expressis verbis to Polyhistor (= Berossus F 7 d Jacoby, FGrHist 680). Burstein 1978, 26 n. 101, considers the possibility that Berossus himself transferred to Sarakos “the manner of death assigned in the Ctesian tradition” to Sardanapallus. Another consideration is presented by Murphy 1989, 36 n. 76 relating to Ctesias’ story of Sardanapallus: “If Sin-shar-ishkun did burn himself in his palace, he imitated the final act of King Shamash-shuma-ukin…in 648 B.C.”. – For the situation of Nineveh after the fall see Dalley 1993 and Curtis 2003; for the final period of Nippur see Cole 1996, 78 ff. 46 The authenticity of the quotation is clearly defended by Burstein 1978, 22 n. 66.

Assyrian and Babylonian Kingdoms within the Greek Tradition

513

The lost catalogue of 45 kings between Semiramis and Phulos (cf. F 5 Verbrugghe – Wickersham) could have been the result of some knowledge based on Babylonian sources and the necessary tribute to the speculative Greek tradition concerning the rulers of the Assyrian empire. On the one hand Berossus was eager to show the importance of Babylon over the centuries and therefore tried to give an exact list of the Babylonian rulers, on the other hand, he had to respect the traditions known to the Greek public. There was no easy way to avoid the dilemma. The Egyptian Manetho had similar problems. In both cases one should not underestimate the authority of the established Greek historiography. The problem even exists in those parts of Berossus’ fragments which concentrate on the following epoch of the Neo-Babylonian kings. First one should consider the strange comment made by Eusebius that the father of Naboukhodonosoros, i.e. Nabopalassaros, sent envoys to Astyages (Azdahak), the satrap of the Medes (Marer), to choose Astyages’ daughter Amytis (Amuhidin) as a bride for his son (Eusebius ed. Karst p. 14 = F 8 b Verbrugghe – Wickersham p. 56). Polyhistor, who is quoted as the immediate source of information, and probably Berossus himself, ignored the king-list of the Medes given by Herodotus. 47 But Herodotus is in accord with our cuneiform sources when he tells us that Cyaxares (=Umakishtar) was the chief of the Medes at the time of the fall of Nineveh (and not his son Astyages =Ishtumegu). Otherwise the motif of a political marriage which placed Astyages’ daughter (i.e. Mandane, mother of Cyrus in Herodotus’ story) at the head of a new era is well known from its Herodotean version. Ctesias made up his own story. He called Astyages’ daughter Amytis and told some stories full of bloody slaughter about her role at the Persian court. But apart from this special approach to “history” Ctesias too – like Herodotus – reported that Astyages was the last emperor of the Medes and was defeated by Cyrus. Ctesias neglected the existence of the Neo-Babylonian Empire but he was full of stories about the empire of the Medes. Berossus, on the other hand, evidently had his problems not only with respect to the Neo-Assyrian Empire but also to the kingdom of the Medes. Their king is seen as some sort of Babylonian satrap. There is no comment on the fall of the Assyrian Empire due to Nabopalassaros’ coalition with the king of the Medes in the extant fragments. But there must have been some tradition about a Median princess at the court in Babylon. Perhaps in this way Ctesias’ Amytis found her way into Berossus’ fragments. However, Josephus quotes Berossus by telling us that Naboukhodonosoros “had constructed and prepared what are called Hanging Gardens for his wife, who had a love of the mountains since she had grown up in Media” (F 9 a Verbrugghe – Wickersham = contra Apionem 141). The Hanging Gardens, of Babylon found a prominent place in the later ancient literature and they appeared in different catalogues of marvellous buildings, but Berossus remains the only one to attribute their construction to King Nebuchadnezzar. To this day scholars are trying to trace the tradition of these wondrous gardens, with their architectural remains, back to a number of different places either in Babylon itself 47 Burstein 1978, 25 n. 97, calls the “identification of the Median king involved in the capture of Nineveh” in the same text “a surprising error”.

514

Reinhold Bichler

or even in the former Assyrian capital of Nineveh.48 The crucial point does not lie in the location of the Hanging Gardens nor in the romantic nature of the story of the king dedicating the gardens to a homesick wife. There is another problem to consider: The combination of Astyages as a Median satrap under the rule of Nabopolassaros and a princess named Amytis as his daughter and Nebuchadnezzar’s wife seems oddly dependent on a confused Greek tradition, going back to Herodotus on the one hand and to Ctesias and later Greek writers on the other, “corrected” only by Berossus’ true knowledge of the importance of Nabupolassaros and Nebuchadnezzar. 49 Apart from his explanation of the origin of the Hanging Gardens, Berossus here gives another remarkable example of his duty to his Greek-speaking public which is well recorded in the extant fragments and once again gives its author the possibility to praise the deeds of that famous king who was so badly neglected by classical Greek writers.50 Through Josephus we are also informed that Nebuchadnezzar “rebuilt the old city (i.e. of Babylon) and added a new one outside the walls and made sure that those who intended to besiege the city could no longer divert the river’s course” (F 9a p. 58 Verbrugghe – Wickersham = contra Apionem § 139). We should note that Josephus pretends to quote Berossus word for word (§ 134). This makes this testimony all the more important: Berossus or his sources were evidently in some way impressed by the legendary Herodotean tradition about Nitocris and Cyrus and their fatal measures to divert the River Euphrates.51 Thus we have to note that even this part of Berossus’ report which concentrated on the Neo-Babylonian kingdom – a subject which could be 48 Cf. especially Reade 2000 with further references. His arguments support the identity of the gardens visited by Alexander the Great as being the ‘Hanging Gardens’ and he wants to locate them at the Kasr-district, mainly on the Western Outwork. - Dalley 2002 stresses the argument that Sennacherib evidently dedicated a part of his Western Palace at Nineveh, probably including access to the gardens, to the pleasure of his wife Tashmetum-sharrat. But her general tendency to trace the tradition of the Hanging Gardens back to Nineveh – cf. especially Dalley 1994 – is based on the assumption of a total confusion of the two capitals i.e. Nineveh and Babylon - in the Greek tradition. Yet Herodotus was as well aware of the difference between the two cities. 49 Meanwhile, the identity of the creator of the Hanging Gardens was a kind of guess-work in the Greco-Latin tradition, Berossus was eager to establish the importance of Nebuchadnezzar. See, for example, Reade 2000, 200: “It was the failure to recognize the contribution of Nebuchadnezzar…that especially offended Berossus”. Cf. also Burstein 1978, 27 n. 106: “In describing the Hanging gardens…Berossus was catering to the interests of his Greek readers”. – Dalley 1994, on the contrary, suggests that “Josephus or his source wrongly attributed to Berossus a passage about the Hanging Gardens”. Since there is an alternative quotation from Abydenus by Eusebius – FGrHist 685 F 6; cf. Burstein 1978, 27 F 2b – she assumes that this quotation “may be attributed correctly to Berossos but be corrupt in having the name of Nebuchadnezzar substituted for the name of Sennacherib”; op. cit. 56. Dealing with the same fragment she also assigns the water-buildings attributed to Nebuchadnezzar by Abydenus to Sennacherib; op. cit. 55 f. 50 For Megasthenes, on the contrary, see n. 52. 51 The authenticity of the tradition of the diversion of the river is stressed by Stephanie Dalley; cf. n. 19.

Assyrian and Babylonian Kingdoms within the Greek Tradition

515

considered to be his domain, not covered by classical Greek historiography – shows the influence of its art of story-telling. Bearing this in mind, one should not be surprised to find that the outer boundaries of the kingdom of Nabopolassaros and his son were clearly overestimated. Egypt seems to be considered to be something like a province within their kingdom – maybe as Amélie Kuhrt pointed out – the memory of those kings should be constructed as a counterpart to the idealization of ancient Egypt and its military power by writers like Hecateus of Abdera. “In this respect Berossus could have been building up on the figure of Nebuchadnezzar II presented as a world-conqueror by Megasthenes in the Indica …some years earlier”.52 In the eyes of the new dynasty founded by Seleucus it must have been a tempting idea to see oneself in the tradition of a world-wide kingship. And once more we may take note to what extent Berossus was forced to respect the expectations of his Greek or rather Macedonian audience.

52 See Kuhrt 1987, 56; FGrHist 715 (= Megasthenes) F 1 resp. FGrHist 685 (=Abydenus) F 6 p. 407; these quotations of Megasthenes go back to Eusebius. For Megasthenes Nabokodrosoros even exceeded Heracles and conquered the Libyans and the Iberians and forced a part of them to settle on the right banks of the Pontos. The Iberians in question seem to be the inhabitants of a region near the Caucasus; cf. the commentary to Euseb. P.E. IX 41,1 p. 456 d 4 by E. H. Grifford (Oxford 1903).

516

Reinhold Bichler

Bibliography John Curtis, The Assyrian heartland in the period 612-539 Bc, in: Giovanni B. Lanfranchi, Michael Roaf, Robert Rollinger (Hg.), Continuity of Empire (?). Assyria, Media, Persia. Proceedings of the International Meeting in Padova, 26th-28th April 2001 (HANE/M V), Padova 2003, 157-167. David Asheri (ed.), Erodoto, Le storie. Libro I (introduzione e commento), Milano 1988. Janick Auberger (ed.), Ctésias, Historien de l’Orient, traduit et commenté, Paris 1991. Rashid Ball, Generation Dating in Herodotos, The Classical Quarterly 29, 1979, 276 – 281. Reinhold Bichler, Herodots Welt. Der Aufbau der Historie am Bild fremder Länder und Völker, ihrer Zivilisation und ihrer Geschichte, Berlin 2000 (Antike in der Moderne). Joan M. Bigwood, Diodorus and Ctesias, Phoenix 34, 1980, 195 – 207. Jan Boncquet, Ctesias’ Assyrian king-list and his chronology of Mesopotamian history, Ancient Society 21, 1990, 5 – 16. Rykle Borger – Walter Hinz – Willem H. Ph. Römer (Hg.), Texte aus der Umwelt des Alten Testaments I 4: Historisch-chronologische Texte I, Gütersloh 1984. Pierre Briant, Histoire et idéologie. Les Grecs et la “décadance perse”, in: Mélanges Pierre Lévêque 2: Anthropologie et société, ed. par M.M. Mactoux – E. Geny, Paris 1989 (Centre de Recherches d’Histoire Ancienne 82), 33 – 47. Walter Burkert, Lydia between East and West or How to Date the Trojan War, in: The Ages of Homer. Festschrift E. Townsend Vermeule, ed. by J. B. Carter S. P. Morris, Austin 1995, 139 – 148. Stanley Mayer Burstein (ed.), The Babyloniaca of Berossus, Malibu 1978 (Sources from the Ancient Near East I 5). Steven W. Cole, Nippur in Late Assyrian Times. c. 755 – 612 BC, Helsinki 1996 (State Archives of Assyria Studies IV). Sabine Comploi, Die Darstellung der Semiramis bei Diodorus Siculus, in: R. Rollinger – Ch. Ulf (Hg.), Geschlechterrollen und Frauenbild in der Perspektive antiker Autoren, Innsbruck – Wien – München 2000, 223 – 244. Stephanie Dalley, Nineveh after 612 BC, Altorientalische Forschungen 20, 1993, 134 – 147. Stephanie Dalley, Nineveh, Babylon and the Hanging Gardens, Iraq 56, 1994, 45 – 58. Stephanie Dalley, Herodotos and Babylon, OLZ 91, 1996, 525 – 532. Stephanie Dalley, More about the Hanging Gardens, in: Of Pots and Plans. Papers presented to D. Oates, ed. by Lamia al-Gailani Werr and others, London 2002. (Nabu Publications), 67 – 73. Marco Dorati, Ctesia falsario?, Quaderni di storia 21, 1995, 33 – 52. Richard N. Frye, Assyria and Syria: Synonyms, JNES 51, 1992, 281 – 285.

Assyrian and Babylonian Kingdoms within the Greek Tradition

517

Andrew R. George (ed.), The Epic of Gilgamesh. The Babylonian Epic Poem and Other Texts in Akkadian and Sumerian, London 1999. Peter W. Haider, Griechen im Vorderen Orient und in Ägypten bis ca. 590 v. Chr., in: Ch. Ulf (Hg.), Wege zur Genese griechischer Identität. Die Bedeutung der früharchaischen Zeit, Berlin 1996, 59 – 115. Peter W. Haider, Der Neith-Mythos und seine Historisierung bei Herodot, in: Ch. Ulf – R. Rollinger (Hg.), Geschlechter – Frauen – Fremde Ethnien in antiker Ethnographie, Theorie und Realität, Innsbruck – Wien – München – Bozen 2002, 58 – 78. Peter Högemann, Das alte Vorderasien und die Achämeniden. Ein Beitrag zur Herodot-Analyse, Wiesbaden 1992 (Tübinger Atlas des Vorderen Orients, Beihefte Reihe B Nr. 98). Felix Jacoby, Ktesias, RE XI 2, 1922, 2032 – 2073. Josef Karst (Hg.), Eusebius Werke V: Die Chronik, aus dem Armenischen übersetzt, Leipzig 1911. K. Karttunen, Ctesias in transmission and tradition, Topoi 7/2, 1997, 635 - 646 Friedrich Wilhem König (Hg.), Die Persika des Ktesias von Knidos, Graz 1972 (Archiv für Orientforschung, Beiheft 18). Reinhard Kratz, From Nabonidus to Cyrus, in: A. Panaino – G. Pettinato (eds.), Ideology as Intercultural Phenomena, Milano 2002 (Melammu Symposia III, Chicago, October 27-31, 2000), 143 – 156. Amélie Kuhrt, Berossus’ Babyloniaka and Seleucid Rule in Babylonia, in: A. Kuhrt – S. Sherwin-White (ed.), Hellenism in the East. The interaction of Greek and non-Greek civilizations from Syria to Central Asia after Alexander, Berkeley – Los Angeles 1987, 32 – 56. Giovanni B. Lanfranchi, The Ideological and Political Impact of the Assyrian Imperial Expansion on the Greek World in the 8th and 7th Centuries BC, in: S. Aro – R. M. Whiting (eds.), The Heirs of Assyria, Helsinki 2000 (Melammu Symposia I, Tvärminne, Finland October 8-11, 1998), 7 – 34. Dominique Lenfant, Ctésias et Hèrodote ou les réécritures de l’histoire dans la Perse achéménide, REG 109, 1996/2, 348 – 380. Allan B. Lloyd, Herodotus Book II. Commentary 99 – 182, Leiden 1988. Oswald Loretz, Rezension von: E. Frahms, Einleitung in die Sanherib-Inschriften (Archiv für Orientforschung Beih. 26, Wien 1997), UF 28, 1996, 787 – 790. J. D. A. MacGinnis, Ctesias and the fall of Nineveh, Illinois Classical Studies 13, 1988, 37 – 41. Edwin Murphy (ed.), The Antiquities of Asia. A Translation with Notes of Book II of the Library of Diodorus Siculus, New Brunswick 1989. Heinz-Günther Nesselrath, Herodot und Babylon. Der Hauptort Mesopotamiens in den Augen eines Griechen des 5. Jh.s v. Chr., in: J. Renger (Hg.), Babylon: Focus Mesopotamischer Geschichte, Wiege früher Gelehrsamkeit, Mythos in der Moderne, Saarbrücken 1999, 189 – 206. Joachim Oelsner, Hellenization of the Babylonian Culture?, in: A. Panaino – G. Pettinato (eds.), Ideology as Intercultural Phenomena, Milano 2002 (Melammu Symposia III, Chicago, October 27-31, 2000), 183 – 196.

518

Reinhold Bichler

Simo Parpola, The Murderer of Sennacherib, in: B. Alster (ed.), Death in Mesopotamia, 1980 (Mesopotamia 8), 171 – 182. Julian Reade, Alexander the Great and the Hanging Gardens of Babylon, Iraq 62, 2000, 195 – 217. Robert Rollinger, Herodots Babylonischer Logos. Eine kritische Untersuchung der Glaubwürdigkeitsdiskussion an Hand ausgewählter Beispiele, Innsbruck 1993 (IBK 84). Robert Rollinger, The ancient Greeks and the impact of the Ancient Near East: Textual evidence and historical perspective (ca. 750 – 650 BC), in: R. M. Whiting (ed.), Mythology and Mythologies: Methodical Approaches to Intercultural Influences, Helsinki 2001 (Melammu Symposia II, Paris, October 4-7, 1999), 233 – 264. Helen Sancisi-Weerdenburg, Decadence in the empire or decadence in the sources? From source to synthesis: Ctesias, in: Achaemenid History I, Leiden 1987, 33 - 45. Paul Schnabel, Berossos und die babylonisch-hellenistische Literatur, Leipzig 1923. Antoon Schoors, Die Königreiche Israel und Juda im 8. und 7. Jahrhundert v. Chr., Stuttgart –Berlin – Köln 1998 (Biblische Enzyklopädie 5). Richard C. Steiner, The Aramaic Text in Demotic Script (1.99), in: William W. Hallo – K. Lawson Younger, Jr. (eds.), The Context of Scripture I: Canonical Compositions from the Biblical World, Leiden – New York – Köln 1997, 309 – 327. Pietro Vannicelli, Erodoto e gli Eraclidi d’Asia, in: S. Ribichini – M. Rocchi – P. Xella (eds.), La questione delle influenze vicino-orientali sulla religione greca, Roma 2001 (Atti del Colloqio Internazionale, Roma, 20-22 maggio 1999), 189 – 194. Gerald P. Verbrugghe – John M. Wickersham (eds.), Berossos and Manetho, introduced and translated, Ann Arbor 1996. Stephanie West, And it came to pass that Pharaoh dreamed: Notes on Herodotus 2.139,142, Classical Quarterly 37, 1987, 262 – 271. Josef Wiesehöfer, Kontinuität oder Zäsur? Babylonien unter den Achaimeniden, in: R. G. Kratz (Hg.), Religion und Religionskontakte im Zeitalter der Achämeniden, Gütersloh 2002, 29 – 48. N. G. Wilson (ed.), Photius, The Bibliotheca. A selection translated with notes, London 1994. Stefan Zawadzki, Herodotus’ Assyrian History, Eos 72, 1984, 253 – 267.

UN PROGETTO DI COLONIZZAZIONE ARMENA DELLA TERRA SANTA NELL‘ETA’ DI T’OROS II Fabio Martelli Scopo di questo intervento è la descrizione di un progetto di trasformazione della demografia della Terra Santa grazie ad un trasferimento di migliaia di soldati ed ufficiali armeni unitamente alle loro famiglie. T’oros principe della CilicioArmenia propose tale soluzione, che avrebbe avuto un forte impatto sulle strutture sociali, economiche ed ideologiche del regno franco del Levante, al re Amaury I. Per comprendere la reale natura di questa politica, fallita dopo un lungo e complesso negoziato, è necessario esaminare l’assetto generale delle potenze regionali del tempo. La crisi della potenza latina in Terra Santa sotto la pressione delle forze islamiche condusse ad alleanze tra gruppi con orientamenti geopolitici differenti. In tale contesto le intese politiche tra i vari gruppi di potere, spesso sigillati da vincoli matrimoniali che non tenevano in gran conto le diverse confessioni religiose delle due parti, portarono a diverse alleanze. Nel regno di Cilicia, retto da principi armeni, possiamo parlare di due tendenze: la dinastia dei Rupenidi aveva sempre manifestato un indirizzo filoccidentale ed antibizantino, mentre la dinastia degli Hetumidi aveva ricercato la protezione degli imperatori di Costantinopoli. In questa situazione il principato rupenide aveva tratto vantaggio dalle conquiste franche in Levante e i suoi domini avevano cominciato ad espandersi dalle alte montagne della Cilicia alle pianure costiere del Mediterraneo. Le comunità armene che popolavano questi territori in tale epoca comprendevano soprattutto monaci e mercanti; un considerevole gruppo armeno viveva, poi, a Gerusalemme e altre comunità avevano colonizzato le terre al di là del Giordano dove le loro gerarchie ecclesiastiche godevano di forti privilegi grazie alle posizioni di potere acquisite dai loro connazionali che avevano conquistato posizioni di grande prestigio politico. Inoltre la chiesa armena era monofisita e perciò staccata da quella di Costantinopoli: ciò faceva degli armeni i potenziali alleati dei franchi, spesso in lotta con il potere bizantino; ciò meglio spiega i tentativi della Chiesa cattolica e dei suoi rappresentanti in Oriente di raggiungere un’intesa dottrinale, almeno di facciata, con le gerarchie ecclestiche armene. Paradossalmente anche la caduta di Gerusalemme favorì la politica dei Rupenidi perché fu allora che i monarchi latini chiesero aiuto ai principi armeni, rafforzando tali intese con legami matrimoniali. Se ciò da un lato accresceva la autorevolezza dei Rupenidi, dall’altro costringeva i loro principi a prendere parte a numerose battaglie, talvolta contro taluni Stati latini del Levante. L’espansione dell’Islam provocò la caduta dei principati cristiani più piccoli e della stessa contea di Edessa dove viveva un gruppo di famiglie della nobiltà armena: come conseguenza si determinò una migrazione di ritorno verso il territorio armeno. Se inizialmente i principi armeni

520

Fabio Martelli

chiamarono nelle loro terre mercanti e mercenari franchi per rinforzare il loro potenziale demografico, sotto il regno di T’oros II possiamo constatare che la Cilicio-Armenia si era già poderosamente ripresa proprio sotto questo profilo. Il principato rupenide fu essenzialmente multiculturale: sin dalle sue stesse origini la civiltà armena si era proposta come mediatore culturale tra l’Occidente latino e il mondo bizantino e islamico. Un esempio di tale crasi culturale può essere rilevata nel linguaggio ed in particolare nelle strutture lessicali: nella lingua armena figurano imprestiti franchi e latini afferenti alla sfera semantica militare ed alle terminologie connesse alle gerarchie feudali. D’altra parte cronisti e letterati dei principati franchi facevano uso di perifrasi e circonlocuzioni che traducevano parole armene relative alle unità di cavalleria ed al loro armamento. Il regno al cui trono ascese T’oros II era una sintesi di tale multiforme koinè culturale realizzatasi tra gli Stati cristiani del Levante. Il re armeno fu senza dubbio un principe guerriero, grande stratega e uomo di Stato dotato di uno spiccato intuito per la Realpolitik. Egli fu sempre in conflitto con l’impero bizantino e sia la tradizione greca sia gli storici armeni gli attribuiscono crudeli stragi di Romei. Ma al tempo stesso il re accettò infine di riconoscere la supremazia militare di Costantinopoli ed si sottomise al basileus, ricevendo il titolo di protosebaste; ciò nonostante T’oros II, non appena i bizantini ridussero i loro effettivi in Oriente, rioccupò poi le terre che aveva dovuto riconsegnare loro.1 Questa sua capacità di gestire in forma quasi cinica le relazioni internazionali lo indusse analogamente a prendere parte a varie coalizioni di Stati cristiani contro il dominio islamico, rifiutando tuttavia di impegnarsi in quelle imprese di cui (a buon diritto) prevedeva un risultato rovinoso. Ad esempio, alcuni esponenti della nobiltà latina poterono riconquistare la loro libertà dopo essere caduti prigionieri di Nureddin grazie alla mediazione dello stesso T’oros che aveva evitato di aver un ruolo attivo in quella campagna. Il progetto di T’oros II di colonizzare la Terra Santa ci è descritto da un brillante uomo politico, il cronista franco Ernoul: vissuto all’epoca di Federico II egli è la sola fonte che descrive con dettaglio questo episodio. Secondo Ernoul, nel 1169 T’oros II si recò in pellegrinaggio a Gerusalemme accompagnato dai suoi nobili e da numerose truppe e naturalmente re Amaury lo ricevette con grandissimi onori. T’oros era di fatto uno dei più importanti alleati del re franco, ma la sua valutazione sul regno latino non era di certo positiva: come ebbe modo di far notare allo stesso Amaury, lo Stato era sul punto di crollare ed il suo potenziale demografico era insufficiente per assicurarne la difesa in caso di attacco islamico. Tale situazione costringeva, poi lo stesso Amaury a grandi spese per potersi

1

G. Dédéyan, Les pouvoirs arméniens dans le Proche-Orient mediterranéen (1068-1144), Paris 1990; C. Mutafian, Le royaunne arménien de Cilicie, Paris 1993; K. Hinteian, History of the Armenians in the Holy Land, Jerusalem 1989; F. Chalandon, Jean II Comnene et Manuel I Comnene, Paris 1912, pp. 417-468; 516-551; P. Magdalino, The Empire of Manuel I Komnenos, Oxford 1994, pp. 66 ss; W.H. Rudt de Collenberg. The Rupenides, Hethumides and Lusignans, The structure of the armeno-cilician Dynasty, Lisbonne-Paris 1963.

Colonizzazione Armena

521

avvalere di mercenari, al punto da indurlo a far ricorso al suo personale patrimonio. T’oros era sicuro, inoltre, che, in caso di attacco islamico contro il regno, la popolazione musulmana si sarebbe rivoltata contro i dominatori latini. Ma egli osservava anche che le principali fortezze e le maggiori proprietà fondiarie erano sotto il controllo della Chiesa e degli Ordini cavallereschi. Ad evitare il crollo del regno, T’oros avrebbe proposto di trasferirvi 30.000 soldati armeni equipaggiati di tutto punto, guidati dai loro ufficiali e accompagnati dalle rispettive famiglie.2 Naturalmente Amaury avrebbe dovuto assegnare terre a questi coloni, sulla base dello status sociale di ciascuno di loro mentre la popolazione araba avrebbe dovuto essere cacciata da quelle regioni. Sulla scorta delle conoscenze relative alla struttura dell’esercito armeno, possiamo valutare uno standard che prevedeva che un contingente di 1.000 cavalieri fosse accompagnato da altri 2.000 combattenti tra arcieri, fanti e cavalieri armati alla leggera.3 Re Amaury accettò subito la proposta di T’oros, ma, per dar seguito alla sua realizzazione, egli doveva sottoporlo al Consiglio regio ed alle gerarchie ecclesiastiche. Mentre i baroni recepirono con favore il progetto, il clero impose una precisa precondizione: sebbene monofisiti, gli armeni erano pur sempre cristiani e dovevano perciò assoggettarsi al pagamento della Decima. Al contrario T’oros e lo stesso Amaury avevano convenuto che i nuovi coloni fossero sottoposti allo stesso regime fiscale dei sudditi musulmani e, dunque, che fossero esenti proprio dalla Decima. Nonostante i molti tentativi promossi dai due re, la posizione del clero non potè essere modificata e, a questo punto, T’oros lasciò la Terra Santa.4 Prima di analizzare in dettaglio questo racconto è necessario verificarne la autenticità. Prima di tutto un solo cronista, vissuto molto tempo dopo tali eventi, scrisse in merito al progetto di T’oros. Inoltre, ponendo attenzione alle cifre riferite da Ernoul circa l’entità delle forze che il principe armeno avrebbe schierato in Terra Santa, è evidente che si tratta di numeri troppo alti per le risorse militari della Cilicio–Armenia. Infine può sembrare del tutto implausibile che Amaury rifiutasse l’aiuto di T’oros a causa di una mera controversia sul regime fiscale dei coloni, problema certo marginale se raffrontato ai grandi pericoli che andavano crescendo intorno al regno. Si potrebbe forse pensare che lo stesso Ernoul pose particolare enfasi su tale episodio per dimostrare che problemi interni di tale fatta erano stati all’origine delle vere motivazioni che avevano condotto alla caduta del regno latino del Levante.5

2 3 4 5

Ernoul, edited by Nas-Latrie, Paris Société de L'histoire de France (da ora Ernoul, op. cit.), pp. 24-28. Id., op. cit., pp. 25-26. Ibid., pp. 27-28. C. Dédéyan, op. cit., II, pp. 405 ss.; Ernoul, op. cit., p. 29, R.C. Smail, Crusading Warfare 1097-1193, Cambridge 1956, pp. 91 ss.

522

Fabio Martelli

I cronisti armeni coevi forniscono poche notizie sul regno di T’oros, mentre quelli posteriori sembrano essersi preoccupati soprattutto di mettere in luce il contrasto tra questo principe e suo fratello Meleh che si era convertito all’islam per ragioni di opportunismo; altri cronisti armeni, infine, non riferiscono alcun dettaglio sulle scelte politiche di T’oros, concentrandosi sul suo rigore morale e sul suo impegno in favore della fede monofisita. Se dunque la quasi totalità delle azioni politiche e militari di T’oros sono state di fatto omesse, non deve destare sorpresa il fatto che in queste fonti non vi sia traccia del progetto di colonizzazione della Terra Santa poiché esso avrebbe potuto essere frainteso dai lettori posteriori e cioè essere interpretato come un segno di indifferenza del principe verso il proprio Stato e soprattutto come un cedimento verso la Chiesa e il potere dei latini.6 Incomprensibilmente gli autori franchi non hanno riferito alcunché su questo episodio: tuttavia, va ricordato che, essi erano interessati a mostrare il valore e la forza della società latina del Levante. Perciò, per loro, sarebbe stato preferibile omettere ogni notizia circa una vicenda in cui la Chiesa locale sembrava aver anteposto i propri interessi economici alla salvezza stessa della Cristianità orientale. È plausibile invece che, oltre dieci anni dopo, nel clima di rinnovamento culturale promosso da Federico II, un cronista come Ernoul abbia potuto riferire una vicenda non certo esaltante per i poteri laici e soprattutto ecclesiastici del regno latino d’Oriente. L'assenza di altre menzioni relative ad essa, non è perciò una valida prova per respingere l’autenticità del progetto di colonizzazione descritto da Ernoul. La Chiesa latina locale, come in molte regioni d’Oriente occupate dai latini, non ebbe, in effetti, esitazioni nel voler condizionare l’azione del potere secolare. Il re di Gerusalemme possedeva un tesoro personale arricchito da rilevanti entrate, ma esso era impoverito dalle spese necessarie a pagare i mercenari; oltre a ciò su di esso pesavano anche le continue donazioni alla Chiesa, imposte dalle gerarchie ecclesiastiche. Il caso del dominio latino su Cipro è un importante esempio di tale attitudine. I re franchi dell’isola e loro nobiltà cercarono di raggiungere un accordo con la locale aristocrazia greca e ciò presupponeva anche una politica di tolleranza verso la Chiesa ortodossa cipriota. Ma gli arcivescovi latini dell’isola pretesero di smantellare le antiche diocesi ortodosse, ridisegnandone i confini, demolendo monasteri ed imponendo varie tasse, compresa la Decima, ai sudditi ortodossi. Poiché simili pretese vanificavano la politica regia, i monarchi latini emisero decreti e leggi a tutela della componente greca e della sua Chiesa, politica cui il clero latino si oppose con una campagna di conversioni forzate in seno alla quale vari sacerdoti e monaci ortodossi furono uccisi. I re ciprioti si rivolsero allora direttamente al Pontefice, ma il clero latino dell’isola respinse di fatto, ignorandola, una Bolla con cui il Pontefice ordinava a quest’ultimo di rinunciare alle precedenti pretese, compresa la famigerata Decima. Dinanzi alla sostanziale disobbedienza del clero di fronte al volere papale, i redi Cipro compresero la loro impotenza, i vescovi furono così liberi di 6

Le fonti sel regno di T'oros, Michele Syro and Sembad di Edessa, nate in ambito ecclesiastico, sono vere e proprie opere agiografiche.

Colonizzazione Armena

523

fare ciòche volevano ed il potere latino a Cipro perse ogni possibilità di raggiungere una intesa con la società locale.7 Si potrebbe citare un gran numero di esempi che dimostrano la debolezza del potere secolare rispetto a quello ecclesiastico nel Levante latino, ma ciò che più preme è sottolineare come ogni politica di integrazione con le comunità di confessione non cattolica residenti in Oriente era condizionata dalla approvazione delle gerarchie ecclesiastiche. Amaury I, in particolare, monarca di uno Stato che la moderna storiografia continua ad esitare nel definire come un “vero regno”, non aveva modo di contrastare la Chiesa locale su una questione delicata come quella della Decima e si sarebbe perciò comportato così come Ernoul descrive nella sua cronaca. Non è perciò molto significativa la obbiezione secondo cui i 30.000 coloni offerti da T’oros erano assai più di quanto questo principe potesse avere a sua disposizione; è infatti del tutto normale, per i cronisti franchi, moltiplicare il numero dei combattenti e quello delle perdite dei vari eserciti sia in caso di vittoria sia in caso di sconfitta. Lo stesso si può dire per le mirabolanti cifre riferite a proposito delle presunte conversioni di massa di islamici. Cercando ora di enumerare gli elementi che mi sembra supportino la storicità del racconto di Ernoul, credo che, prima di tutto, se ne debbano contestualizzare l’opera e la prospettiva storica ed ideologica. Ernoul, valletto e letterato, fu al servizio degli Ibelin che contesero ai Lusignano il controllo di Cipro. I suoi signori furono appoggiati dal Papa, visto che i loro avversari erano sotto la protezione di Federico II. Il nostro cronista mostra di farsi interprete della politica degli Ibelin: ad esempio condanna aspramente l’accordo raggiunto tra l’Imperatore ed il Sultano circa la difficile questione dei pellegrinaggi cristiani in una Gerusalemme ritornata sotto controllo islamico, sino al punto di descrivere persecuzioni mai avvenute, a quel tempo, contro i cristiani al solo scopo di dimostrare la falsità delle reali intenzioni dei musulmani e di promuovere l’idea di una riconquista militare. Poiché è innegabile che Ernoul scriveva costantemente in un’ottica “guelfa”, anche a costo di falsi patenti: credo perciò che la vicenda di T’oros, così come è descritta dal nostro autore, cioè secondo una chiave di lettura “ghibellina” dei fatti, costituisca una prima, fondamentale prova della credibilità dell’intero racconto.8 Si può constatare infatti che il focus del trama affabulativa si concentra sulla cecità, l’intransigenza e l’avidità delle gerarchie ecclesiastiche che si dimostrano pronte a sacrificare l’intero regno per imporre i propri privilegi. In un’ottica più puntuale, il cronista sembra indicare nel comportamento del clero un gesto di disprezzo per la stessa “filosofia politica” del Levante latino, poiché esso non 7

8

C.P. Kyrris, Greek Cypriot Identity. Byzantium and the Latins 1192-1489, in “Byzantinische Forschungen”, 19 (1993), pp. 229-248; H.J. Magoulias, A study in Roman Catholic and Greek Orthodox Church Relation in the Island between the Years A.D. 1196 and 1360, in “The Greek Orthodox Theological Review”, 10 (1964), pp. 75-106. N.R. Morgan, The Chronicle of Ernoul and the Continuations of William of Tyre, Oxford 1973; D. Jacoby, La Litérature française dans les Etats latins de la Méditerranée orientale à l'époque des croisades, diffusion, création, in Essor et fortune de la chanson de geste dans l'Europe et l'Orient latin, Modena 1984, II, pp. 617-646. Su Ernoul R. d'Amat, S.V. in DBF, 10, col. 1399; G. Tyl-Labory, s.v. in Dictionnaire des Lettres Françaises. Le moyen age, Paris 19922, p. 414.

524

Fabio Martelli

esitava a vanificare lo zelo religioso e la perspicacia politica di cui T’oros II e Amaury I avevano dato prova immaginando il progetto di colonizzazione armena. In altre parole secondo Ernoul, il regno perse la sua ultima possibilità di sopravvivere all’espansionismo islamico proprio a causa di questo comportamento. Il racconto presenta dunque una vicenda che contrappone lo zelo religioso dei principi all’avidità degli ecclesiastici, fornendo così importanti argomentazioni alle correnti “ghibelline” ed in genere filoimperiali.9 Se la vicenda che Ernoul espone circa il progetto “armeno” illustra la cieca arroganza del clero, si deve riconoscere che essa contrasta violentemente con il compito del cronista, cioè quello che era chiamato ad assolvere per ordine dei suoi committenti: dimostrare la falsità e le menzogne degli imperiali, per ribadire che solo le gerarchie ecclesiastiche, a partire dal Papa, potevano proteg-gere i veri interessi del mondo cristiano. Secondo la prospettiva degli Ibelin erano infatti i poteri laici ad aver trasformato le Crociate in una mera fonte di ricchezza, dimenticando gli obblighi cristiani, cioè l'esatto contrario del paradigma illustrato dalla storia di T’oros e Amaury. Perché allora Ernoul, che mostra anche una raffinata conoscenza del diritto, avrebbe dovuto aprire una così vistosa discrasia in seno ad una sintassi ideologica tanto ben concepita, al solo fine di narrare una vicenda di pura fantasia? La sola risposta plausibile è che il cronista credeva fermamente che la storia del progetto di T’oros fosse un evento reale e di grande rilevanza nella storia del Levante, tanto importante da meritare di essere riportato anche a costo di incrinare la linea ideologica impostagli dai suoi protettori. Ernoul scrisse come propagandista degli Ibelin, ma anche come storico e come politico, ancora certo che la Terra Santa potesse essere riconquistata, forse proprio giocando su di impreviste alleanze, come era stato per la grande occasione perduta incentrata sull’ipotesi di una colonizzazione armena. La storia del regno di Gerusalemme sembra confermare tale ipotesi: terminata la conquista e con essa lo sterminio di ebrei e musulmani, la Terra Santa fu popolata dai latini che furono però sempre al di sotto del potenziale indispensabile a controllare il territorio. Perciò si cercò da subito di integrare nel nuovo Stato melchiti e giacobiti e di promuovere poi una migrazione, verso le regioni centrali del regno, di una parte della popolazione delle popolazioni cristiane stanziate sui confini. Al di là di ciò che Ernoul scrisse, si può prendere atto del fatto che il progetto di T'oros rappresentava una scelta in linea con la politica che i re latini avevano autonomamente intrapreso, tanto da poter considerare la proposta del re armeno come una naturale risposta ad essa. Bisogna infatti valutare con grande cautela la storiografia che definisce il regno latino del Levante come un mero strumento con cui affrancare l'Europa dal peso di una nobiltà di cadetti senza terra. Se questa fu forse la strategia politica delle fasi iniziali, di certo essa fallì perché, dopo un esordio entusiastico, si determinò un decremento dell'immigrazione dal continente europeo. Ed ecco perché Amaury necessitava di un massiccio trasferimento di coloni armeni. 9

RHC, Hist. Or. IV, Paris 1898, pp. 330 ss.; RHC, Documents arméniens, I, pp. 45 ss.; 155 ss.; Livre des assises de la Cour des Bourgeois, éd. Beugnot, pp. 172 ss.

Colonizzazione Armena

525

Questa ipotesi sembra trovare conferma nella stessa celerità con cui la proposta avanzata da T'oros fu recepita da Amaury e sottoposta al Consiglio del regno. Tale rapidità decisionale credo indichi il fatto che altri negoziati preliminari erano stati intessuti mesi prima che il principe armeno compisse il suo pellegrinaggio a Gerusalemme in forma ufficiale, mentre lo scopo di quel viaggio consisteva invece nel mettere sotto pressione il Consiglio regio, al fine di indurlo a ratificare un'intesa già raggiunta in precedenza con lo stesso re franco. In tale ottica appare necessario ritornare sulle cifre fornite da Ernoul circa il numero dei coloni armeni: egli di certo esagerò tale cifra, come del resto solevano fare nei loro racconti molti cronisti franchi, ma ciò è irrilevante. Per il nostro autore parlare di 30.000 coloni militari significava solo dare la prova del fatto che il progetto di T'oros avrebbe risolto i problemi demografici del regno, mentre è più rilevante valutare il senso di questo numero per le fonti armene. Sappiamo infatti che, nella sua lunga storia, l'Armenia fornì agli imperi confinanti truppe ausiliarie il cui numero era stimato sempre a 30.000 uomini. Abbiamo molti esempi di principi armeni che offrono a re alleati 30.000 guerrieri anche in pieno medioevo, tanto da indurre a concludere tale cifra aveva un valore simbolico, spesso senza un riferimento puntuale all'entità reale di tali contingenti. 30.000 unità sembra infatti essere un numero funzionale a rappresentare la stessa composizione degli eserciti armeni: cavalleria pesante, fanteria e cavalleria leggera (essendo ogni reparto valutabile a 10.000 uomini). Se Ernoul addottò dunque il numero di 30.000 guerrieri ciò deriva dal fatto che egli lo desunse da fonti armene.10 Tale mera ipotesi acquisisce concretezza se si considerano alcuni aspetti salienti della vita del cronista. Egli era famoso in Oriente come esperto di diritto ed era poi al servizio di Jean Ibelin cui si rivolse Lewon I il Magnifico per avvalersi del sapere suo tecnico, tali servizi furono poi messi a disposizione anche di Hetum I, successore di Lewon.11 Ernoul, che aveva seguito il suo signore alla corte di Hetum I, ebbe così la possibilità di attingere agli archivi armeni: ciò spiega perché la vicenda del progetto di T'oros II è riferita solo dal nostro cronista, mentre è ignorata dagli altri storici franchi. Una volta verificata la storicità dei fatti, il significato politico del progetto appare chiaro. I piccoli Stati del Levante erano infatti sottoposti ad una duplice pressione: gli attacchi delle potenze islamiche, soprattutto sotto la guida di Nureddin e la politica di Manuele Comneno che si andava proponendo come guida di una sorta di Commonwealth cristiano del Levante, in seno al quale armeni e franchi figuravano come suoi vassalli. Amaury I, il cui regno era demograficamente in crisi, accolse il progetto di una colonizzazione armena come una ultima via di salvezza. Così facendo egli risolveva il pesante problema demografico e si affrancava rispetto al condizionamento della Francia e degli altri Stati europei. In altre parole 10 G. Dédéyan, Les Arméniens soldats de Byzance, in “Bazmavep”, I-IV (1987), pp. 167 ss.; G. Dédéyan, Pouvoirs arméniens, cit., I, pp. 246 ss. 11 R. d'Amat, op. cit.; G. Tyl-Labory, op. cit.; L. Alichan,. Léon le Magnifique, Venezia 1888.

526

Fabio Martelli

ogni ipotesi di “mettere sotto tutela” lo stesso Amaury con la promessa di aiuti da Occidente sarebbe stata resa superflua dall'intesa con un regno demograficamente forte come quello di T'oros. Inoltre quest'ultimo era sempre in lotta contro l'espansionismo bizantino e perciò interessato a contenere ogni espansione in Levante anche ad opera di altri Stati. L'importanza del progetto di colonizzazione emerge così con chiarezza come una mossa utile sia al regno armeno sia a quello franco. E' chiaro che T'oros avrebbe potuto inviare a sostegno di Amaury un consistente numero di coloni-soldati, anche se non in trattava di certo di 30.000 uomini. Il principe armeno avrebbe potuto, più plausibilmente, trasferire 1000 o 2000 unità, il che per l'epoca era comunque un esercito di notevole rilevanza, un contributo che avrebbe potuto dunque sancire una vera e propria “rinascita” del regno latino. E' del pari rilevante sottolineare che esisteva un chiaro collegamento tra l'ipotesi di una migrazione armena in Terra Santa e la restaurazione del potere regio nel regno latino: con l'appoggio delle truppe armene, Amaury avrebbe potuto organizzare le proprie campagne senza dipendere dalla “benevolenza” dei grandi Ordini cavallereschi.12 La moderna storiografia definisce come società feudali sia i principati della Cilicio-Armenia sia gli Stati franchi del Levante, dando a vedere di considerarli come strutture statuali omogenee sul piano istituzionale. In realtà è possibile cogliere profonde e rilevanti differenze: il sistema franco sottoponeva all'investitura ecclesiastica la legitimizzazione dei re e perciò trasferiva alla Chiesa una forte valenza politica, che essa tradusse in vera e propria ingerenza nella gestione del regno. Al contrario il principato rupenide si ispirava ai modelli istituzionali della Grande Armenia dell'VIII-IX secolo; tale sistema prevedeva una gerarchizzazione tra i vari membri di una stessa dinastia: così al “trono” principale erano sottoposti quelli dei rami collaterali, senza escludere per ciascuno di essi la possibilità di trasferire feudi a singoli vassalli. Il principato rupenide seguiva dunque tale archetipo, anche sotto il profilo ideologico. Ed in effetti anche durante il governo di T'oros alcuni membri della dinastia gestirono i loro territori con un'autonomia del tutto simile a quella di veri e propri re. Il Katholikos, poi, aveva il compito di presiedere alla cerimonia di investitura dei re (secondo modelli fortemente ispirati al cerimoniale bizantino, ma che, in seguito, recepirono anche moduli occidentali), ma, al tempo stesso, anche i re rivendicavano il diritto di intervenire nella gestione della Chiesa di CilicioArmenia. Quando un conflitto tra i due poteri esplose, Lewon il Magnifico finì per imporsi, legittimando il suo intervento sulla base della presunta prevalenza degli antichi re della Grande Armenia rispetto ad ogni altra autorità, in quanto supremi protettori della fede (ed eredi, in ciò, di Costantino il Grande). Nel principato rupenide, infine, i vari vassalli, sia armeni sia franchi, avevano il diritto di trasmettere ai propri successori sia la terra sia i loro titoli nobiliari, ma il 12 J. Richard, Le payement des dîmes dans le Etats croisés, in Bibliothèque de l'Ecole des Charte, 150, Paris-Genève 1992; Ernoul, op. cit., pp. 28-30.

Colonizzazione Armena

527

monarca poteva in ogni momento revocare la concessione in feudo del territorio ed incamerarlo a favore della corona.13 Amaury I vide nella ipotesi del trasferimento di coloni armeni anche un poderoso strumento grazie al quale riottenere integralmente la pienezza del potere regio usurpato dagli Ordini cavallereschi e, soprattutto, dalla gerarchia ecclesiastica. Con ogni evidenza anche la Chiesa latina del regno comprese che l'arrivo dei coloni-soldati armeni le avrebbe sottratto il controllo che esercitava sull'istituto regio e perciò si oppose a tale progetto. Questo episodio illustra la condizione opposta di due regni, quello latino sull'orlo del crollo e quello di Cilicio-Armenia che attraversava una fase di rinnovata potenza. Per Ernoul la scelta di descrivere, con dettaglio, la storia del progetto di T'oros II doveva avere lo scopo di mostrare al lettore i fattori strutturali di debolezza che avrebbero poi condotto alla crisi ultima degli Stati latini del Levante e, tuttavia, la sua narrazione entrava in una involontaria e quasi inconsapevole sintonia con una scuola di pensiero, forte soprattutto in Francia, che, forse anche sulla scorta delle fallimentari esperienze istituzionali del regno di Gerusalemme, si sforzava di riproporre all'Europa l'idea di Crociata, subordinandola però alla sua strumentalizzazione in un'ottica filomonarchica. In altre parole ogni eventuale nuovo intervento militare in Levante, avrebbe dovuto favorire un processo di accentramento di ogni potere nelle mani dei re, a scapito soprattutto della Chiesa, ponendo le risorse territoriali e militari ottenute con le nuove conquiste sotto l'esclusivo controllo della corona. Così Pierre Dubois14, massimo esponente di tale tendenza, si trova ad illustrare con grande acribia analitica una svolta istituzionale per i regni occidentali, del tutto simile a quella desumibile dal progetto di T'oros II e Amaury I.

13 Matteo di Edessa, Chronique, trad. fr. Paris 1858, pp. 276 ss.; 299 ss., 319 ss.; P. Bedoukian, Coinage of Cilician Armenia, Danbury 1979, pp. 657 ss.; G. Dédéyan, La Chronique attribuée au connetable Sembat, Paris 1980, pp. 57 ss. 14 P. Dubois, De Recuperatione Terrae Sanctae, passim.